Citrus Sinensis ID: 016298


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--
MKHRKLFPASESNGTTSCSYYCDPNCPFNYNCVPLPGIYYLEPPPPPPSHQSNSTPPYVIIFVALVLSFILFLAFYVIKSKTGWCNSETNEGHQQAQSDGEDEDFVDENRIDHPIWLIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIVHETVTAPLATTANQNSDSSSLAVDNHTEHTGNDRELGENGERNREDCENRTETEADRILKDNVNANENGALQVIDDSGDDNQALQAQAQTIRRSVSLDSSLAETICLGLADFGLLESCEFSYDQITKDAEKSDSHSNSAIVAKQDGAYSSSFRLTRNSSIVQSLHKDSVSMKRSFSCSGRFLSPLCNSNRNPNAILPL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHccEEEEEccccccccccccEEccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccEEcccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHcHcccccccHHHHHHccEEEEEccccccccccEEEEEccccccccEEEcccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEEEEcccccccEEEEEHHHccccccccccccccccccccccccccccEEEcccccccccEEEEccccccHHcccccccccEEEcccccEEEccccccccccccccc
mkhrklfpasesngttscsyycdpncpfnyncvplpgiyyleppppppshqsnstppYVIIFVALVLSFILFLAFYVIKSktgwcnsetneghqqaqsdgededfvdenridhpiwLIHTVGLQQSVINSITVCrykkgegliegtecsvclnefqedetvrllpkcnhafHISCIDTWlsshincpmcrahivhetvtaplattanqnsdssslavdnhtehtgndrelgengernredceNRTETEADRILKdnvnanengalqviddsgddNQALQAQAQTIRRSVSLDSSLAETICLgladfgllesceFSYDQITkdaeksdshsnsaivakqdgaysssfrltrnssivqslhkdsvsmkrsfscsgrflsplcnsnrnpnailpl
mkhrklfpasesngttSCSYYCDPNCPFNYNCVPLPGIYYLEPPPPPPSHQSNSTPPYVIIFVALVLSFILFLAFYVIKSKTGWCNSETNeghqqaqsdgeDEDFVDENRIDHPIWLIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIVHETVTAPLATTanqnsdssslavdnhtehtgndrelgengernredcenRTETEADRILKDNVNANENGALQVIDDSGDDNQALQAQAQTIRRSVSLDSSLAETICLGLADFGLLESCEFSYDQITKDaeksdshsnsAIVAKQDGAYSSSFRLTRNSsivqslhkdsvSMKRSFSCSgrflsplcnsnrnpnailpl
MKHRKLFPASESNGTTSCSYYCDPNCPFNYNCVPLPGIYYLEppppppshqsnstppYVIIFVALVLSFILFLAFYVIKSKTGWCNSETNEGHQQAQSDGEDEDFVDENRIDHPIWLIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIVHETVTAPLATTANQNSDSSSLAVDNHTEHTgndrelgengernredCENRTETEADRILKDNVNANENGALQVIDDSGDDNQALQAQAQTIRRSVSLDSSLAETICLGLADFGLLESCEFSYDQITKDAEKSDSHSNSAIVAKQDGAYSSSFRLTRNSSIVQSLHKDSVSMKRSFSCSGRFLSPLCNSNRNPNAILPL
****************SCSYYCDPNCPFNYNCVPLPGIYYL***************PYVIIFVALVLSFILFLAFYVIKSKTGWCN********************DENRIDHPIWLIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIVHETVTAPL*****************************************************************************************DSSLAETICLGLADFGLLESCEFSYDQI*************************************************************************
***RK***ASESNGTTSCSYYCDPNCPFNYNCV************************YVIIFVALVLSFILFLAFYVIKSKTGWCN***********************************GLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIV*****************************************************************************************************************************************************************************************************L
**************TTSCSYYCDPNCPFNYNCVPLPGIYYLEPPPPPPSHQSNSTPPYVIIFVALVLSFILFLAFYVIKSKTGWCNS****************DFVDENRIDHPIWLIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIVHETVTAPLAT******************************************TEADRILKDNVNANENGALQVIDDSGDDNQALQAQAQTIRRSVSLDSSLAETICLGLADFGLLESCEFSYDQIT************AIVAKQDGAYSSSFRLTRNSSIVQS***********FSCSGRFLSPLCNSNRNPNAILPL
******FPASESNGTTSCSYYCDPNCPFNYNCVPLPGIYYLEPPP*******NSTPPYVIIFVALVLSFILFLAFYVIKSKTGWCN**************************HPIWLIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIVH**************************************************************************************AQTIRRSVSLDSSLAETICLGLADFGLL*********************************SSSFRLTRNSSIVQSLHKDSVSMKRSFSCSGRFLSPLC************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKHRKLFPASESNGTTSCSYYCDPNCPFNYNCVPLPGIYYLEPPPPPPSHQSNSTPPYVIIFVALVLSFILFLAFYVIKSKTGWCNSETNEGHQQAQSDGEDEDFVDENRIDHPIWLIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIVHETVTAPLATTANQNSDSSSLAVDNHTEHTGNDRELGENGERNREDCENRTETEADRILKDNVNANENGALQVIDDSGDDNQALQAQAQTIRRSVSLDSSLAETICLGLADFGLLESCEFSYDQITKDAEKSDSHSNSAIVAKQDGAYSSSFRLTRNSSIVQSLHKDSVSMKRSFSCSGRFLSPLCNSNRNPNAILPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query392 2.2.26 [Sep-21-2011]
Q8LFY8413 RING-H2 finger protein AT yes no 0.617 0.585 0.442 3e-53
Q9LX93301 E3 ubiquitin-protein liga no no 0.392 0.511 0.466 1e-28
Q9SRQ8356 RING-H2 finger protein AT no no 0.576 0.634 0.310 8e-28
Q9LF64362 RING-H2 finger protein AT no no 0.579 0.627 0.345 9e-28
P0C041310 Putative RING-H2 finger p no no 0.451 0.570 0.374 3e-25
Q7XLY8383 E3 ubiquitin-protein liga no no 0.357 0.365 0.385 3e-25
Q8GW38369 RING-H2 finger protein AT no no 0.334 0.355 0.387 7e-22
Q9SL78390 Putative RING-H2 finger p no no 0.431 0.433 0.343 3e-21
P93823381 RING-H2 finger protein AT no no 0.625 0.643 0.279 3e-19
Q8W571323 RING-H2 finger protein AT no no 0.336 0.408 0.363 3e-18
>sp|Q8LFY8|ATL54_ARATH RING-H2 finger protein ATL54 OS=Arabidopsis thaliana GN=ATL54 PE=2 SV=2 Back     alignment and function desciption
 Score =  209 bits (531), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 160/278 (57%), Gaps = 36/278 (12%)

Query: 2   KHRKLFP--ASESNGTTSCS-YYCDPNCPFNYNCVPLPGIYYLEPPPP------------ 46
           KHRKLFP  ASE+N T  CS   CDP CP  YNC P P  Y + P  P            
Sbjct: 5   KHRKLFPTLASETNKTLDCSNGVCDPICP--YNCYPEPDYYTISPQLPPWSSSPQPSPCP 62

Query: 47  ---------PPSHQSNSTPPYVIIFVALVLSFILFLAFYVIKSKTGWCNSETNEGHQQAQ 97
                    P    S+S     II +   +  IL   F+++        +  N+G  Q+ 
Sbjct: 63  SPSISAVYLPSQDSSSSLDAISIITITGAVLAILLTGFFLVAKFFSDSVNRVNQGTYQSD 122

Query: 98  SDGED----EDFVDENRIDHPIWLIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLN 153
           ++  D    E+F D  ++DHPIWLI T GLQQS+INSIT+C YK+G+GLIE T+C VCLN
Sbjct: 123 NEDNDTVMEEEFQDREQVDHPIWLIRTTGLQQSIINSITICNYKRGDGLIERTDCPVCLN 182

Query: 154 EFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIVHETVTAPLATTANQNSDSS 213
           EF+EDE++RLLPKCNHAFHISCIDTWLSSH NCP+CRA I   +VT P  +   + +   
Sbjct: 183 EFEEDESLRLLPKCNHAFHISCIDTWLSSHTNCPLCRAGIAMISVTTPRYSGPVEVTPGG 242

Query: 214 SLAVDNHTEHTGNDRELGENGE-RNREDCENRTETEAD 250
           S    +H E+ G D E  ++GE  NR D + +   ++D
Sbjct: 243 S---GSHLENDGVDEE--DHGEIENRVDSDFKESDDSD 275





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana GN=ATL55 PE=1 SV=1 Back     alignment and function description
>sp|Q9SRQ8|ATL51_ARATH RING-H2 finger protein ATL51 OS=Arabidopsis thaliana GN=ATL51 PE=2 SV=2 Back     alignment and function description
>sp|Q9LF64|ATL52_ARATH RING-H2 finger protein ATL52 OS=Arabidopsis thaliana GN=ATL52 PE=2 SV=1 Back     alignment and function description
>sp|P0C041|ATL53_ARATH Putative RING-H2 finger protein ATL53 OS=Arabidopsis thaliana GN=ATL53 PE=3 SV=2 Back     alignment and function description
>sp|Q7XLY8|ATL41_ORYSJ E3 ubiquitin-protein ligase Os04g0590900 OS=Oryza sativa subsp. japonica GN=Os04g0590900 PE=2 SV=2 Back     alignment and function description
>sp|Q8GW38|ATL47_ARATH RING-H2 finger protein ATL47 OS=Arabidopsis thaliana GN=ATL47 PE=2 SV=1 Back     alignment and function description
>sp|Q9SL78|ATL12_ARATH Putative RING-H2 finger protein ATL12 OS=Arabidopsis thaliana GN=ATL12 PE=3 SV=1 Back     alignment and function description
>sp|P93823|ATL1_ARATH RING-H2 finger protein ATL1 OS=Arabidopsis thaliana GN=ATL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
224063285389 predicted protein [Populus trichocarpa] 0.954 0.961 0.540 1e-100
255545848393 ring finger protein, putative [Ricinus c 0.961 0.959 0.5 3e-93
147769273404 hypothetical protein VITISV_008030 [Viti 0.964 0.935 0.490 2e-85
359492465404 PREDICTED: RING-H2 finger protein ATL54- 0.964 0.935 0.490 3e-85
356498809381 PREDICTED: RING-H2 finger protein ATL54- 0.864 0.889 0.415 7e-61
225465766379 PREDICTED: RING-H2 finger protein ATL54 0.928 0.960 0.401 2e-60
356551725381 PREDICTED: RING-H2 finger protein ATL54- 0.869 0.895 0.415 1e-58
302142008318 unnamed protein product [Vitis vinifera] 0.579 0.713 0.528 6e-58
357489801352 RING-H2 finger protein ATL1O [Medicago t 0.806 0.897 0.394 5e-56
359480496372 PREDICTED: uncharacterized protein LOC10 0.823 0.868 0.412 3e-55
>gi|224063285|ref|XP_002301077.1| predicted protein [Populus trichocarpa] gi|222842803|gb|EEE80350.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 219/405 (54%), Positives = 262/405 (64%), Gaps = 31/405 (7%)

Query: 1   MKHRKLFP-ASESNGTTSCSYYCDPNCPFNYNCVPLPGIYYLEPPPPPPSH-QSNSTPPY 58
           MKHRKLFP  +E+N T  C  +CDP CP  YNC P    Y L PPPPPP   Q +   PY
Sbjct: 3   MKHRKLFPIGTETNQTIDCPDFCDPACP--YNCYPYSDYYLLPPPPPPPFLPQEHHLSPY 60

Query: 59  VIIFVALVLSFILFLAFYVI--KSKTGWCNSETNEGHQQAQSDGEDEDFVDENRIDHPIW 116
           VII VAL+ SF L +++YVI  KS +GWC S  N    QAQ D  DE+F+DENR+DHPIW
Sbjct: 61  VIIIVALLASFFLIVSYYVIVAKSCSGWCGSRNNT-EPQAQEDDTDEEFLDENRVDHPIW 119

Query: 117 LIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCI 176
            I T+GLQQS+INSITVC+YKKGEGLIEGTECSVCL+EFQ+DET+RLLPKCNHAFHISCI
Sbjct: 120 FITTIGLQQSIINSITVCKYKKGEGLIEGTECSVCLSEFQQDETLRLLPKCNHAFHISCI 179

Query: 177 DTWLSSHINCPMCRAHIVHETVTAPLATTANQNSDSSSLAVDNHTEHTGNDRELGENGER 236
           DTWL SH NCP+CR HI++   + PL +   QN D+ +       E++  D  LG N E 
Sbjct: 180 DTWLRSHTNCPLCRTHIINGPASTPLISVG-QNHDNLNPTFSTQMENSDVDSGLGNNQES 238

Query: 237 NREDCENRTETE---------ADRILKDNVNANENGALQVIDDSGDDNQALQAQAQTIRR 287
           N E CENR  TE          +R LKD VN+N+ G LQV+  S D +QA     + +RR
Sbjct: 239 N-EPCENRAGTEEVGEILQVGEERTLKDEVNSNDIGDLQVLCSSVDKHQAEDNDIKLLRR 297

Query: 288 SVSLDSSLAETICLGLADFGLLESCEFSYDQITKDAEKSDSHSNSAIVAKQDGAYSSSFR 347
           S S+DS  A T+C+GL D   L       +QI  D E+      S +V K+DG YSS F+
Sbjct: 298 SSSMDSLRATTMCIGLNDHKNL------VNQIDIDEER-----KSNMVLKRDGGYSSVFK 346

Query: 348 LTRNSSIVQSLHKDSVSMKRSFSCSGRFLSPLCNSNRNPNAILPL 392
           LT  SS   SLHK  VSMKRSFSC GRF S   N +  P  ILPL
Sbjct: 347 LTGTSSFSLSLHKGPVSMKRSFSCGGRFFSSRQNPSLKP--ILPL 389




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255545848|ref|XP_002513984.1| ring finger protein, putative [Ricinus communis] gi|223547070|gb|EEF48567.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147769273|emb|CAN61577.1| hypothetical protein VITISV_008030 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492465|ref|XP_003634417.1| PREDICTED: RING-H2 finger protein ATL54-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356498809|ref|XP_003518241.1| PREDICTED: RING-H2 finger protein ATL54-like [Glycine max] Back     alignment and taxonomy information
>gi|225465766|ref|XP_002266755.1| PREDICTED: RING-H2 finger protein ATL54 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356551725|ref|XP_003544224.1| PREDICTED: RING-H2 finger protein ATL54-like [Glycine max] Back     alignment and taxonomy information
>gi|302142008|emb|CBI19211.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357489801|ref|XP_003615188.1| RING-H2 finger protein ATL1O [Medicago truncatula] gi|355516523|gb|AES98146.1| RING-H2 finger protein ATL1O [Medicago truncatula] Back     alignment and taxonomy information
>gi|359480496|ref|XP_003632477.1| PREDICTED: uncharacterized protein LOC100854068 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
TAIR|locus:2207066413 AT1G72220 [Arabidopsis thalian 0.362 0.343 0.571 2.3e-52
TAIR|locus:2142449301 RING1 [Arabidopsis thaliana (t 0.382 0.498 0.493 3.5e-38
TAIR|locus:505006547367 AT4G33565 [Arabidopsis thalian 0.441 0.471 0.418 3.5e-36
TAIR|locus:2151421362 AT5G17600 [Arabidopsis thalian 0.676 0.732 0.295 1.4e-30
TAIR|locus:4515103413310 ATL4H [Arabidopsis thaliana (t 0.502 0.635 0.372 1.6e-30
TAIR|locus:2096444356 AT3G03550 [Arabidopsis thalian 0.466 0.514 0.359 6.4e-28
UNIPROTKB|Q7XLY8383 LOC_Os04g50100 "E3 ubiquitin-p 0.632 0.647 0.296 7.3e-27
TAIR|locus:2199902369 AT1G23980 [Arabidopsis thalian 0.326 0.346 0.395 1.2e-21
TAIR|locus:2018334381 AT1G04360 [Arabidopsis thalian 0.265 0.272 0.406 7.6e-19
TAIR|locus:2181032159 DAFL2 "DAF-Like gene 2" [Arabi 0.186 0.459 0.506 6.7e-18
TAIR|locus:2207066 AT1G72220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 447 (162.4 bits), Expect = 2.3e-52, Sum P(2) = 2.3e-52
 Identities = 84/147 (57%), Positives = 105/147 (71%)

Query:    59 VIIFVALVLSFILFLAFYVIKSKTGWCNSETNEGHQQAQSDGED----EDFVDENRIDHP 114
             +I     VL+ +L   F V K  +   N   N+G  Q+ ++  D    E+F D  ++DHP
Sbjct:    85 IITITGAVLAILLTGFFLVAKFFSDSVN-RVNQGTYQSDNEDNDTVMEEEFQDREQVDHP 143

Query:   115 IWLIHTVGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHIS 174
             IWLI T GLQQS+INSIT+C YK+G+GLIE T+C VCLNEF+EDE++RLLPKCNHAFHIS
Sbjct:   144 IWLIRTTGLQQSIINSITICNYKRGDGLIERTDCPVCLNEFEEDESLRLLPKCNHAFHIS 203

Query:   175 CIDTWLSSHINCPMCRAHIVHETVTAP 201
             CIDTWLSSH NCP+CRA I   +VT P
Sbjct:   204 CIDTWLSSHTNCPLCRAGIAMISVTTP 230


GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2142449 RING1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006547 AT4G33565 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151421 AT5G17600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515103413 ATL4H [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096444 AT3G03550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XLY8 LOC_Os04g50100 "E3 ubiquitin-protein ligase Os04g0590900" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2199902 AT1G23980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018334 AT1G04360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181032 DAFL2 "DAF-Like gene 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0003088801
hypothetical protein (389 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-14
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-11
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 1e-10
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 5e-10
smart0018440 smart00184, RING, Ring finger 8e-08
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 2e-06
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 3e-06
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 3e-06
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-05
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 1e-04
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-04
PHA02926242 PHA02926, PHA02926, zinc finger-like protein; Prov 0.003
pfam0455457 pfam04554, Extensin_2, Extensin-like region 0.004
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 66.6 bits (163), Expect = 2e-14
 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 147 ECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAH 192
           EC +CL+EF+  E V +LP C H FH  C+D WL S   CP+CRA 
Sbjct: 2   ECPICLDEFEPGEEVVVLP-CGHVFHKECLDKWLRSSNTCPLCRAP 46


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|165237 PHA02926, PHA02926, zinc finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 392
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.74
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.44
PHA02929238 N1R/p28-like protein; Provisional 99.22
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.17
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.16
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.11
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.85
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.82
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.8
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.72
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.72
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.67
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.67
PHA02926242 zinc finger-like protein; Provisional 98.66
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.59
PF1463444 zf-RING_5: zinc-RING finger domain 98.52
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.5
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.49
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.48
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.46
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.44
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.43
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.31
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.27
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.24
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.15
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.07
COG52191525 Uncharacterized conserved protein, contains RING Z 98.05
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.01
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.96
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.93
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.85
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.81
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.78
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.73
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.73
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.72
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.72
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.64
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.56
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.41
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.32
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.31
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.15
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.09
KOG4445368 consensus Uncharacterized conserved protein, conta 97.09
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.98
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.95
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.88
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 96.65
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.48
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.48
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.26
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.22
KOG1941518 consensus Acetylcholine receptor-associated protei 96.1
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.03
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.03
PHA02862156 5L protein; Provisional 95.71
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.63
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.46
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.43
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 94.97
KOG2660331 consensus Locus-specific chromosome binding protei 94.96
PHA02825162 LAP/PHD finger-like protein; Provisional 94.72
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.39
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.28
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.22
PHA03096284 p28-like protein; Provisional 94.13
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.06
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 94.05
COG5152259 Uncharacterized conserved protein, contains RING a 94.02
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.96
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 92.61
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 92.53
COG5222427 Uncharacterized conserved protein, contains RING Z 92.39
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 92.08
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 91.93
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 91.26
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.2
KOG4739233 consensus Uncharacterized protein involved in syna 91.0
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.66
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 90.62
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 90.6
PF10272358 Tmpp129: Putative transmembrane protein precursor; 90.49
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 90.27
KOG1940276 consensus Zn-finger protein [General function pred 90.07
PF04641260 Rtf2: Rtf2 RING-finger 89.96
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 89.41
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 89.39
KOG1001674 consensus Helicase-like transcription factor HLTF/ 87.75
COG5175 480 MOT2 Transcriptional repressor [Transcription] 87.65
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 87.01
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 86.62
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 85.27
KOG03091081 consensus Conserved WD40 repeat-containing protein 84.25
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 83.98
KOG02981394 consensus DEAD box-containing helicase-like transc 83.02
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 80.77
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.74  E-value=5.1e-18  Score=168.36  Aligned_cols=78  Identities=29%  Similarity=0.846  Sum_probs=68.3

Q ss_pred             cCCCHHHHhhcceeEecCCCCcccCCcccccccccccCCceeecCCCCCcCChhHHHHHHhcCCC-CCcccccccCCCCC
Q 016298          121 VGLQQSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHIN-CPMCRAHIVHETVT  199 (392)
Q Consensus       121 ~gl~~~~i~~lp~~~~~~~~~~~~~~~C~ICle~~~~~~~vr~lp~C~H~FH~~CI~~Wl~~~~t-CPlCR~~v~~~~~~  199 (392)
                      ..+.+..+.++|+..|+........+.|+||||+|..|+++|+|| |+|.||..||++||.++.+ ||+|++.+......
T Consensus       205 ~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLP-C~H~FH~~CIDpWL~~~r~~CPvCK~di~~~~~~  283 (348)
T KOG4628|consen  205 NRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILP-CSHKFHVNCIDPWLTQTRTFCPVCKRDIRTDSGS  283 (348)
T ss_pred             hhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEec-CCCchhhccchhhHhhcCccCCCCCCcCCCCCCC
Confidence            456788999999999999776655579999999999999999999 9999999999999988855 99999988765443



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 6e-13
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 9e-09
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 3e-08
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 6e-07
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 2e-04
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 5e-04
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 6e-04
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure

Iteration: 1

Score = 71.6 bits (174), Expect = 6e-13, Method: Composition-based stats. Identities = 26/51 (50%), Positives = 34/51 (66%) Query: 144 EGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIV 194 +G EC+VCL E ++ E R LP+C H FH C+D WL SH CP+CR +V Sbjct: 4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 9e-31
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 7e-29
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 4e-23
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 3e-22
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-21
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-19
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 7e-18
2ecm_A55 Ring finger and CHY zinc finger domain- containing 1e-16
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-16
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 8e-14
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 4e-13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-12
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 5e-12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 9e-12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 8e-11
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 3e-09
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-08
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 5e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 6e-08
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 2e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 4e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 8e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 5e-06
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 3e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 4e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-04
3nw0_A238 Non-structural maintenance of chromosomes element 1e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 2e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 5e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 6e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 8e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score =  111 bits (280), Expect = 9e-31
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 125 QSVINSITVCRYKKGEGLIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHI 184
                 +   R+       E T C VC+ +F+  + +R+LP CNH FH  C+D WL ++ 
Sbjct: 3   SGSSGQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKANR 61

Query: 185 NCPMCRAHI 193
            CP+CRA  
Sbjct: 62  TCPICRADS 70


>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.62
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.6
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.47
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.44
2ect_A78 Ring finger protein 126; metal binding protein, st 99.44
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.43
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.39
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.36
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.35
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.29
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.29
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.29
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.28
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.24
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.22
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.2
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.2
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.2
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.19
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.16
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.12
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.11
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.1
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.1
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.07
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.06
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.05
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.03
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.01
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.01
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.99
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.96
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.94
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.94
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.93
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.92
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.92
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.91
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.9
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.87
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.82
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.81
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.8
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.79
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.78
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.78
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.75
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.73
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.69
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.68
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.67
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.66
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.65
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.61
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.61
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.6
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.52
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.49
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.45
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.44
2ea5_A68 Cell growth regulator with ring finger domain prot 98.36
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.36
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.33
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.28
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.25
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.06
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.05
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.0
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.71
3nw0_A238 Non-structural maintenance of chromosomes element 97.51
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 92.66
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 92.29
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.59
2k1a_A42 Integrin alpha-IIB; single-PASS transmembrane segm 90.68
2knc_A54 Integrin alpha-IIB; transmembrane signaling, prote 90.6
2l8s_A54 Integrin alpha-1; transmembrane region, detergent 90.46
1wil_A89 KIAA1045 protein; ring finger domain, structural g 84.42
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 80.57
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.62  E-value=2.7e-16  Score=127.27  Aligned_cols=76  Identities=24%  Similarity=0.612  Sum_probs=67.5

Q ss_pred             hccCCCHHHHhhcceeEecCCCC-cccCCcccccccccccCCceeecCCCCCcCChhHHHHHHhcCCCCCcccccccC
Q 016298          119 HTVGLQQSVINSITVCRYKKGEG-LIEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIVH  195 (392)
Q Consensus       119 ~~~gl~~~~i~~lp~~~~~~~~~-~~~~~~C~ICle~~~~~~~vr~lp~C~H~FH~~CI~~Wl~~~~tCPlCR~~v~~  195 (392)
                      ...|++++.|+.||.+.+..... ..++..|+||++.|..++.++.+| |+|.||..||..|++.+.+||+||..+..
T Consensus        13 ~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           13 ANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELP-CHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             CCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEET-TTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecC-CCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            45799999999999999887543 345678999999999999999999 99999999999999999999999998854



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2k1a_A Integrin alpha-IIB; single-PASS transmembrane segment, alternative splicing, calcium, cell adhesion, cleavage on PAIR of basic residues; NMR {Homo sapiens} PDB: 2k9j_A Back     alignment and structure
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 392
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 1e-19
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-12
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 7e-10
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 8e-10
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-09
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-09
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 2e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 3e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 6e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 8e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.003
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 79.5 bits (196), Expect = 1e-19
 Identities = 26/51 (50%), Positives = 34/51 (66%)

Query: 144 EGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIV 194
           +G EC+VCL E ++ E  R LP+C H FH  C+D WL SH  CP+CR  +V
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.62
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.39
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.39
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.33
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.31
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.23
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.21
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.1
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.04
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.04
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.98
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.89
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.83
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.71
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.69
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.53
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.29
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 89.78
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 85.11
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 81.35
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 80.72
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.62  E-value=9.6e-17  Score=117.16  Aligned_cols=52  Identities=50%  Similarity=1.236  Sum_probs=47.3

Q ss_pred             ccCCcccccccccccCCceeecCCCCCcCChhHHHHHHhcCCCCCccccccc
Q 016298          143 IEGTECSVCLNEFQEDETVRLLPKCNHAFHISCIDTWLSSHINCPMCRAHIV  194 (392)
Q Consensus       143 ~~~~~C~ICle~~~~~~~vr~lp~C~H~FH~~CI~~Wl~~~~tCPlCR~~v~  194 (392)
                      .++.+|+||+++|..++.++.++.|+|.||..||.+||+.+.+||+||++|.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            3567899999999999999888679999999999999999999999999874



>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure