Citrus Sinensis ID: 016312
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 391 | 2.2.26 [Sep-21-2011] | |||||||
| Q24306 | 438 | Apoptosis 1 inhibitor OS= | yes | no | 0.138 | 0.123 | 0.457 | 2e-08 | |
| P41436 | 275 | Apoptosis inhibitor IAP O | N/A | no | 0.138 | 0.196 | 0.440 | 6e-08 | |
| Q6NTT6 | 353 | Mitochondrial ubiquitin l | N/A | no | 0.503 | 0.558 | 0.244 | 6e-07 | |
| Q969V5 | 352 | Mitochondrial ubiquitin l | yes | no | 0.570 | 0.633 | 0.235 | 7e-07 | |
| O08863 | 600 | Baculoviral IAP repeat-co | yes | no | 0.153 | 0.1 | 0.384 | 9e-07 | |
| A1E2V0 | 604 | Baculoviral IAP repeat-co | yes | no | 0.153 | 0.099 | 0.415 | 1e-06 | |
| Q4R7G8 | 352 | Mitochondrial ubiquitin l | N/A | no | 0.437 | 0.485 | 0.237 | 2e-06 | |
| Q95M72 | 236 | Baculoviral IAP repeat-co | no | no | 0.158 | 0.262 | 0.373 | 2e-06 | |
| Q62210 | 612 | Baculoviral IAP repeat-co | no | no | 0.199 | 0.127 | 0.329 | 2e-06 | |
| Q95M71 | 236 | Baculoviral IAP repeat-co | N/A | no | 0.158 | 0.262 | 0.358 | 4e-06 |
| >sp|Q24306|IAP1_DROME Apoptosis 1 inhibitor OS=Drosophila melanogaster GN=th PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 60.5 bits (145), Expect = 2e-08, Method: Compositional matrix adjust.
Identities = 27/59 (45%), Positives = 35/59 (59%), Gaps = 5/59 (8%)
Query: 333 IPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS 391
IP+ +LC +C +AF PCGH+V C +CA SV KCP+CR MR+YFS
Sbjct: 385 IPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVT-----KCPLCRKPFTDVMRVYFS 438
|
Anti-apoptotic protein which functions as a caspase regulator, using its E3 ubiquitin-protein ligase activity to smother caspase activity. Binds, ubiquitinates and inactivates initator caspase Nc, and effector caspases ICE and DCP-1. Acts as a NEDD8-E3 ubiquitin-protein ligase for ICE. Suppresses apoptosis by targeting the apoptosome for ubiquitination and inactivation. Plays an important role in cell motility. Overexpression suppresses rpr and W-dependent cell death in the eye. Interaction of th with Nc is required to suppress Nc-mediated cell death; th-mediated ubiquitination of Nc. Acts as a positive regulator of Wnt signaling. Drosophila melanogaster (taxid: 7227) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|P41436|IAP_GVCPM Apoptosis inhibitor IAP OS=Cydia pomonella granulosis virus (isolate Mexico/1963) GN=IAP PE=4 SV=1 | Back alignment and function description |
|---|
| >sp|Q6NTT6|MUL1_XENLA Mitochondrial ubiquitin ligase activator of nfkb 1 OS=Xenopus laevis GN=mul1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q969V5|MUL1_HUMAN Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Homo sapiens GN=MUL1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O08863|BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus GN=Birc3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|A1E2V0|BIRC3_CANFA Baculoviral IAP repeat-containing protein 3 OS=Canis familiaris GN=BIRC3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q4R7G8|MUL1_MACFA Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Macaca fascicularis GN=MUL1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q95M72|BIRC8_PANTR Baculoviral IAP repeat-containing protein 8 OS=Pan troglodytes GN=BIRC8 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q62210|BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus GN=Birc2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q95M71|BIRC8_GORGO Baculoviral IAP repeat-containing protein 8 OS=Gorilla gorilla gorilla GN=BIRC8 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 391 | ||||||
| 225442119 | 391 | PREDICTED: mitochondrial ubiquitin ligas | 0.943 | 0.943 | 0.651 | 1e-141 | |
| 224070805 | 391 | predicted protein [Populus trichocarpa] | 0.976 | 0.976 | 0.639 | 1e-140 | |
| 255560625 | 387 | ubiquitin-protein ligase, putative [Rici | 0.976 | 0.987 | 0.632 | 1e-136 | |
| 356504268 | 388 | PREDICTED: mitochondrial ubiquitin ligas | 0.987 | 0.994 | 0.587 | 1e-129 | |
| 224054081 | 390 | predicted protein [Populus trichocarpa] | 0.938 | 0.941 | 0.603 | 1e-126 | |
| 449447892 | 389 | PREDICTED: mitochondrial ubiquitin ligas | 0.974 | 0.979 | 0.559 | 1e-124 | |
| 356567748 | 387 | PREDICTED: mitochondrial ubiquitin ligas | 0.930 | 0.940 | 0.602 | 1e-122 | |
| 356558912 | 383 | PREDICTED: mitochondrial ubiquitin ligas | 0.930 | 0.950 | 0.581 | 1e-120 | |
| 357514013 | 383 | Baculoviral IAP repeat-containing protei | 0.976 | 0.997 | 0.563 | 1e-120 | |
| 18404810 | 383 | E3 ubiquitin ligase-like protein [Arabid | 0.964 | 0.984 | 0.486 | 1e-100 |
| >gi|225442119|ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|297743001|emb|CBI35868.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 507 bits (1306), Expect = e-141, Method: Compositional matrix adjust.
Identities = 245/376 (65%), Positives = 300/376 (79%), Gaps = 7/376 (1%)
Query: 19 DGAVLGVALAYTAVRSFLDFRYTSNALGKVRNAPQLKVSDLRALLDEKQSQPSDQEQNSR 78
DGA+LG+ALAY AVRSF+ TS+AL ++ +P +VSDLR+LL SDQ +S
Sbjct: 20 DGAILGLALAYVAVRSFIRLSSTSSALRQIDQSPSFRVSDLRSLLSPSSDDESDQSTSSD 79
Query: 79 --LVIVRGQVEAKSAVDGINWKNLMYSNDILVSESGDKAVILEQRKAFLYNEWRDLFGWT 136
LV+VRG VEAKSA+DG NWK+L N ++ ESG+K VIL++ + +YNEWR FGWT
Sbjct: 80 GLLVVVRGTVEAKSAIDG-NWKSLR-PNVLVSHESGEKGVILQRTQTCIYNEWRGFFGWT 137
Query: 137 PDIRAIFGRSLKTSEPSSLRTVPFILVEGDRWPQSDYIIVNMDGSRQPLPLTTAYQRLEL 196
DIR +F RS K E +SLRTVPFILVEG RWPQSDY+IVNMDGSR PLPLTT Y +L+
Sbjct: 138 SDIRTLFARSWKEKESTSLRTVPFILVEGGRWPQSDYVIVNMDGSRHPLPLTTVYHQLQP 197
Query: 197 ANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVGICNFKNGIPEIKSCKDLPYFLS 256
N SP+TFLQA+FG P+G+L EEK+LPLGK+I+AVGIC+ KNGIPEIKSCKDLPYFLS
Sbjct: 198 VNASPYTFLQALFGHDYPVGLLDEEKLLPLGKEITAVGICSLKNGIPEIKSCKDLPYFLS 257
Query: 257 EKTKDQMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNRWKD-RQQRMSRQLTETP 315
E +KDQMVVDLV +SK+LFWSG++LGS+SIG+LGYA+VRNWNRWK+ RQQR R ++
Sbjct: 258 EMSKDQMVVDLVFKSKVLFWSGVILGSVSIGVLGYAVVRNWNRWKEWRQQRGVRPPSQAV 317
Query: 316 SDDADSQIGSDEEVAGDIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKC 375
+DD D+QI D+ AGD+PDG+LCV+CL RR+ SAF PCGHLVCC+RCA+SVERE SPKC
Sbjct: 318 TDDTDTQIAEDD--AGDVPDGELCVICLMRRKRSAFVPCGHLVCCQRCALSVERELSPKC 375
Query: 376 PVCRMTVRSSMRIYFS 391
PVCR +RSS+RIY S
Sbjct: 376 PVCRQIIRSSVRIYGS 391
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224070805|ref|XP_002303243.1| predicted protein [Populus trichocarpa] gi|222840675|gb|EEE78222.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255560625|ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223539404|gb|EEF40994.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356504268|ref|XP_003520919.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224054081|ref|XP_002298092.1| predicted protein [Populus trichocarpa] gi|222845350|gb|EEE82897.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449447892|ref|XP_004141700.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] gi|449480528|ref|XP_004155921.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356567748|ref|XP_003552078.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356558912|ref|XP_003547746.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357514013|ref|XP_003627295.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] gi|66947626|emb|CAJ00009.1| C3HC4 zinc finger containing protein [Medicago truncatula] gi|355521317|gb|AET01771.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|18404810|ref|NP_564653.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] gi|4587558|gb|AAD25789.1|AC006577_25 Contains similarity to gb|U45880 X-linked inhibitor of apotosis protein from Homo sapiens and contains PF|00097 Zinc finger C3HC4 (Ring finger) domain [Arabidopsis thaliana] gi|16604354|gb|AAL24183.1| At1g54150/F15I1_32 [Arabidopsis thaliana] gi|23505911|gb|AAN28815.1| At1g54150/F15I1_32 [Arabidopsis thaliana] gi|332194934|gb|AEE33055.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 391 | ||||||
| TAIR|locus:2014405 | 383 | SPL2 "SP1-like 2" [Arabidopsis | 0.964 | 0.984 | 0.491 | 2e-95 | |
| TAIR|locus:2202882 | 338 | ZCF61 [Arabidopsis thaliana (t | 0.526 | 0.609 | 0.266 | 7.7e-13 | |
| UNIPROTKB|E1BGD5 | 350 | MUL1 "Uncharacterized protein" | 0.565 | 0.631 | 0.264 | 4.1e-10 | |
| MGI|MGI:1915600 | 352 | Mul1 "mitochondrial ubiquitin | 0.572 | 0.636 | 0.257 | 5.4e-10 | |
| ZFIN|ZDB-GENE-050208-236 | 352 | mul1b "mitochondrial E3 ubiqui | 0.849 | 0.943 | 0.219 | 9.1e-10 | |
| RGD|1309944 | 352 | Mul1 "mitochondrial E3 ubiquit | 0.572 | 0.636 | 0.253 | 2e-09 | |
| TAIR|locus:4515103444 | 178 | AT4G24204 [Arabidopsis thalian | 0.202 | 0.443 | 0.353 | 3.9e-09 | |
| UNIPROTKB|I3LH19 | 352 | MUL1 "Uncharacterized protein" | 0.565 | 0.627 | 0.262 | 1.3e-08 | |
| UNIPROTKB|E2RBI8 | 352 | MUL1 "Uncharacterized protein" | 0.570 | 0.633 | 0.252 | 2.1e-08 | |
| UNIPROTKB|Q969V5 | 352 | MUL1 "Mitochondrial ubiquitin | 0.572 | 0.636 | 0.240 | 2.1e-08 |
| TAIR|locus:2014405 SPL2 "SP1-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 949 (339.1 bits), Expect = 2.0e-95, P = 2.0e-95
Identities = 195/397 (49%), Positives = 278/397 (70%)
Query: 1 MSLLEQHLASLY-QLAVSFDGAVLGVALAYTAVRSFLDFRYTSNALGKVRNAPQLKVSDL 59
MS E+ L +L +A+SFDGA+LG+ LA +AV S L + T+ AL K+++AP++ +SDL
Sbjct: 1 MSSPERALLNLLTDIALSFDGAILGLTLAVSAVGSALKYASTNAALKKIKDAPEVSISDL 60
Query: 60 RALL--DEKQSQPSDQEQNS--RLVIVRGQVEAKSAVDGINWKNLMYSNDILVS-ESGDK 114
R+LL E +S+ +D +++ R+V+VRG V+ K + D +KN N++L+S E+GDK
Sbjct: 61 RSLLPASEDKSETNDNRKSNDQRIVVVRGVVKPKISGDE-GYKN----NNVLISPETGDK 115
Query: 115 AVILEQRKAFLYNEWRDLFGWTPDIRAIFGRSLKTSEPSSLRTVPFILVEGDRWPQSDYI 174
A+I+++ + ++Y+ W+ LF T R + RSL+ RTVPF++V D+ S ++
Sbjct: 116 ALIIQRTQTYVYSGWKRLFQSTGH-RFMLERSLRKHGADFTRTVPFVIVGKDQQSNSSFV 174
Query: 175 IVNMDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVG 234
VNMDGSRQPLPLTT Y RL+ N S FLQA P+G+L EKILP GKDI+AVG
Sbjct: 175 AVNMDGSRQPLPLTTVYNRLQPINSS---FLQAFLYPDYPVGLLDIEKILPPGKDITAVG 231
Query: 235 ICNFKNGIPEIKSCKDLPYFLSEKTKDQMVVDLVNRSKILFWSGIVLGSLSIGILGYAIV 294
I +F NG+PEIKSC+DLPYFLSE TKD+M+ DL+ ++ +F ++LG +S+GIL YA V
Sbjct: 232 IYSFNNGVPEIKSCQDLPYFLSEMTKDKMIEDLMEQTNFIFLGSVILGIVSVGILSYAAV 291
Query: 295 RNWNRWKDRQQRMSRQLTETPSDDADSQIGSDEEVAGDIPDGQLCVVCLTRRRISAFNPC 354
R WN+WK Q R+L + P+D S + + E A +IPDG+LCV+C++RRR+ AF PC
Sbjct: 292 RTWNKWK--QWNHQRELPQRPND---SVVDDEPEDADEIPDGELCVICVSRRRVPAFIPC 346
Query: 355 GHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS 391
GH+VCCRRCA +VERE +PKCPVC ++R SMR+Y+S
Sbjct: 347 GHVVCCRRCASTVERELNPKCPVCLQSIRGSMRVYYS 383
|
|
| TAIR|locus:2202882 ZCF61 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BGD5 MUL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915600 Mul1 "mitochondrial ubiquitin ligase activator of NFKB 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-236 mul1b "mitochondrial E3 ubiquitin ligase 1b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1309944 Mul1 "mitochondrial E3 ubiquitin protein ligase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4515103444 AT4G24204 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LH19 MUL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBI8 MUL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q969V5 MUL1 "Mitochondrial ubiquitin ligase activator of NFKB 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00034079001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (391 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 391 | |||
| pfam12483 | 154 | pfam12483, GIDE, E3 Ubiquitin ligase | 7e-32 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 4e-14 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-07 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 3e-07 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 3e-04 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 0.002 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 0.003 |
| >gnl|CDD|221597 pfam12483, GIDE, E3 Ubiquitin ligase | Back alignment and domain information |
|---|
Score = 117 bits (295), Expect = 7e-32
Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 7/150 (4%)
Query: 140 RAIFGRSLKTSEPSSLRTVPFILVEGDRWPQSDYIIVNMDGSRQPLPLTTAYQRLELANV 199
+ R S+ R VPF L +G + ++V MD S + L T R E +
Sbjct: 10 GSGSWRRRSELVASNEREVPFYLRDG-----TGRVLVVMDPSGAEIELVTVLDRFEPSEG 64
Query: 200 SPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVG-ICNFKNGIPEIKSCKDL-PYFLSE 257
S F+ L F +G E++LP+G ++ VG ++G I+ P+F+S
Sbjct: 65 SLFSLLFGFFSGDVTLGYRYIERVLPVGTRLTVVGEAVRDEDGTLRIQKPSKGGPFFIST 124
Query: 258 KTKDQMVVDLVNRSKILFWSGIVLGSLSIG 287
K++++++ L + ++ LF+ I LG + IG
Sbjct: 125 KSEEELIESLASSARTLFYGSIGLGVVGIG 154
|
This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length. There is a single completely conserved residue E that may be functionally important. GIDE is an E3 ubiquitin ligase which is involved in inducing apoptosis. Length = 154 |
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 391 | |||
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| PF12483 | 160 | GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 Thi | 99.94 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.39 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.28 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.23 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.07 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.88 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.81 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.72 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.69 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.68 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.67 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.55 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.49 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.46 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.45 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.39 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.35 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.34 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.33 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.32 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.27 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.26 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.19 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.12 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.08 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.03 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.98 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.97 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.85 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 97.84 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.83 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.8 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.79 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.77 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.63 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.57 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.24 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.12 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.09 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 96.96 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.88 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 96.82 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.67 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 96.62 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.5 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.48 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.46 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.3 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.13 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.08 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.8 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 95.53 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 95.28 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.06 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 94.82 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 94.42 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.25 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 94.09 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 94.06 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 93.99 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.84 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 93.78 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 92.91 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 92.72 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 92.68 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 92.3 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 91.94 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 91.64 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 91.15 | |
| KOG1101 | 147 | consensus Apoptosis inhibitor IAP1 and related BIR | 91.1 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 90.77 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 88.71 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 87.76 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 87.03 | |
| PF05961 | 68 | Chordopox_A13L: Chordopoxvirus A13L protein; Inter | 86.77 | |
| smart00238 | 71 | BIR Baculoviral inhibition of apoptosis protein re | 86.68 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 86.36 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 84.78 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 83.3 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.26 | |
| PF04710 | 416 | Pellino: Pellino; InterPro: IPR006800 Pellino is i | 81.3 | |
| KOG3579 | 352 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.92 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 80.85 | |
| cd00022 | 69 | BIR Baculoviral inhibition of apoptosis protein re | 80.75 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 80.48 | |
| PF00653 | 70 | BIR: Inhibitor of Apoptosis domain; InterPro: IPR0 | 80.15 | |
| PHA03049 | 68 | IMV membrane protein; Provisional | 80.01 |
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.6e-43 Score=336.37 Aligned_cols=331 Identities=20% Similarity=0.338 Sum_probs=267.0
Q ss_pred HHHhhhhhhHHHHHHHHHHHHHHHHHHhhhHHhhhhhcCCCCCh-hhHHHHHhhhcCCCCCCcCCccEEEEEEEEeeccc
Q 016312 13 QLAVSFDGAVLGVALAYTAVRSFLDFRYTSNALGKVRNAPQLKV-SDLRALLDEKQSQPSDQEQNSRLVIVRGQVEAKSA 91 (391)
Q Consensus 13 ~~~l~~d~~~lG~~~~~~a~~~~~~~~~~~~~l~~l~~a~~~~i-~~L~~ll~~~~~~~~~~~~~~~~v~V~G~V~~~~~ 91 (391)
+++++.+.+++++. |..|.++.+..+..+.|+++.+ .|++...+.++.+ +++|.+|+|.+.++
T Consensus 6 ~~~~~~~~v~l~l~--------~~~~g~~~~~s~~~~~a~k~~~~~d~~~~~~~~~~~------~I~~l~~~~~~~~~-- 69 (355)
T KOG1571|consen 6 RFLLGLTNVALRLL--------FRQYGRLPRVSKVGKEAEKVLVLVDLKSSWDIAPEK------KIPYLVIRGCAIAR-- 69 (355)
T ss_pred HHHHhhhHHHHHhh--------hhhcccchhhHHHhhhccceecchhhhhhhhhcccc------chHHHHHhhccccc--
Confidence 34555555555544 6777888888888999999999 9999999999988 99999999999999
Q ss_pred cccccccccCCCCCeeeccC-CCeEEEEeeEEEEE-EEeeeccCCCcccchhhhcccccccCCcccceeceEEeeCCCCC
Q 016312 92 VDGINWKNLMYSNDILVSES-GDKAVILEQRKAFL-YNEWRDLFGWTPDIRAIFGRSLKTSEPSSLRTVPFILVEGDRWP 169 (391)
Q Consensus 92 ~~~~~~~~~~~~~pL~s~~~-~~~gVi~~~~~~~~-~~e~~~~~~w~~~~~~~~~~~~~e~~~~~~~~vPF~L~d~~~~~ 169 (391)
+.|+++..+ +..||+ +.....+ +..|+....|+...+.+ ++..|++||+|.++..
T Consensus 70 -----------~~~~~~~~v~~v~gvv-~~~~~~~~~~~~~~~~~~~~~~k~~---------~~~~~~~~~~l~~q~~-- 126 (355)
T KOG1571|consen 70 -----------KETLRSLCVSNVPGVV-QALTLEEPKGRRDGGGHWNANSKIF---------HEGGNEVPFFLRSQTT-- 126 (355)
T ss_pred -----------ccchHHhhcccCCceE-EEeeeccceeeeccceeeccceeec---------cCCCcccceeeccCCc--
Confidence 688888888 779999 6666666 66666334499999888 9999999999998841
Q ss_pred CCCcEEEEecCCC--CCCCceeeeeeeEeCC-CcccchhhhhcCCceeeeeeeeeeeecCCceeeeee-eeeecCCccee
Q 016312 170 QSDYIIVNMDGSR--QPLPLTTAYQRLELAN-VSPFTFLQAMFGLKCPIGVLAEEKILPLGKDISAVG-ICNFKNGIPEI 245 (391)
Q Consensus 170 ~t~~v~V~v~~~~--~~l~l~~v~~~f~p~~-~s~~~~~~~~~~g~~~~G~~~~E~~L~~G~~lt~vG-l~~~~~g~~rI 245 (391)
.-...|+++.++ ..++++++|+.|+|+. .++.+..+++++|.++.|++++|++||+|+.+|++| ++.+..+..|+
T Consensus 127 -~~~~~~~~s~~~~~~~l~l~~~~d~f~~s~p~s~~~~~~~~~sg~~~~~~~~~~~~l~~~~~~t~l~e~v~d~~~~~r~ 205 (355)
T KOG1571|consen 127 -GFACEVRVSKTLGRLFLPLNVVYDLFEPSDPCSLVDVGGGYHSGVRRGGFRETERVLPLGTRLTALGELVRDGYCGVRV 205 (355)
T ss_pred -ceeeeeeeecceeeeeecceeeeccccccCcceeeecccccccceeeecccceEEeeccccceeeeehheecCCCceEe
Confidence 113457777766 8899999999999999 599999999999999999999999999999999999 87888678899
Q ss_pred ecCCCCCeeecccCHHHHHHHHhhhhhhhhhhhccccceeeeeehhhhhhhhHH--HHHHHHHhhHhhccCCCC-cc---
Q 016312 246 KSCKDLPYFLSEKTKDQMVVDLVNRSKILFWSGIVLGSLSIGILGYAIVRNWNR--WKDRQQRMSRQLTETPSD-DA--- 319 (391)
Q Consensus 246 q~p~g~pf~Ls~~s~d~Li~~L~~~~r~~~~~~iv~g~~gv~ll~~~~lr~w~~--~k~~~~~~~~~~~e~~~~-~~--- 319 (391)
++|+..|+|++....|+||.++..+.+.++|.++++++.+++++.+....++.. +++.++. .+.++.+.. ++
T Consensus 206 ~~~~~g~~~v~~s~~d~LIsr~g~~s~~~kv~~~~~~~~~~ills~~~~d~~led~r~~r~~l--~k~~~~~~~~rae~~ 283 (355)
T KOG1571|consen 206 QPPMQGPLYVTKSAADRLISREGDLSFFVKVNGMVFGTLGVILLSFIVKDNYLEDDRRQRREL--VKRVEDLATVRAELL 283 (355)
T ss_pred cCCccCcceeeccchhhHHHhhccceeeeeecceeeeeeeEEeehHHHHHHHHHHHHHHHHHH--HHhhhhhhhheeeee
Confidence 988744544444449999999999999999999999999999999999998887 5555444 222222221 11
Q ss_pred -c-----ccCCCCccccCCCCccccccccccccceeEEecCCCccccHHhHHHHhhcCCCCcccccccccceEEeeeC
Q 016312 320 -D-----SQIGSDEEVAGDIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS 391 (391)
Q Consensus 320 -~-----~~~~~~~~~~~~~~~~~~C~IC~~~~~~~v~lpCGH~~~C~~C~~~~~~~~~~~CPiCR~~I~~~~~iy~s 391 (391)
+ +.+. +.....+.+-...|+||.+++.+++|+||||+|||..|+..+. .||+||+.|...+++|.+
T Consensus 284 s~g~~gtr~~~-~~~~~~~~~~p~lcVVcl~e~~~~~fvpcGh~ccct~cs~~l~-----~CPvCR~rI~~~~k~y~~ 355 (355)
T KOG1571|consen 284 SRGVRGTRIQN-ENGTFRELPQPDLCVVCLDEPKSAVFVPCGHVCCCTLCSKHLP-----QCPVCRQRIRLVRKRYRS 355 (355)
T ss_pred ccccccccccc-ccCcccccCCCCceEEecCCccceeeecCCcEEEchHHHhhCC-----CCchhHHHHHHHHHHhcC
Confidence 0 1222 1112333444569999999999999999999999999999986 699999999999999975
|
|
| >PF12483 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG1101 consensus Apoptosis inhibitor IAP1 and related BIR domain proteins [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF05961 Chordopox_A13L: Chordopoxvirus A13L protein; InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses | Back alignment and domain information |
|---|
| >smart00238 BIR Baculoviral inhibition of apoptosis protein repeat | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] | Back alignment and domain information |
|---|
| >KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF00653 BIR: Inhibitor of Apoptosis domain; InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >PHA03049 IMV membrane protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 391 | ||||
| 4ic2_A | 74 | Crystal Structure Of The Xiap Ring Domain Length = | 2e-07 | ||
| 3eb5_A | 74 | Structure Of The Ciap2 Ring Domain Length = 74 | 2e-07 | ||
| 2ecg_A | 75 | Solution Structure Of The Ring Domain Of The Baculo | 2e-07 | ||
| 3t6p_A | 345 | Iap Antagonist-Induced Conformational Change In Cia | 7e-07 | ||
| 4ic3_A | 74 | Crystal Structure Of The F495l Mutant Xiap Ring Dom | 7e-07 | ||
| 2yhn_A | 79 | The Idol-Ube2d Complex Mediates Sterol-Dependent De | 8e-07 |
| >pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 | Back alignment and structure |
|
| >pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 | Back alignment and structure |
| >pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 | Back alignment and structure |
| >pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 | Back alignment and structure |
| >pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 | Back alignment and structure |
| >pdb|2YHN|A Chain A, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 79 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Score = 85.2 bits (211), Expect = 5e-21
Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 5/78 (6%)
Query: 314 TPSDDADSQIGSDEEVAGDIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASP 373
+ S + + S EE + + +LC +C+ R F PCGHLV C++CA +V+
Sbjct: 3 SGSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVD----- 57
Query: 374 KCPVCRMTVRSSMRIYFS 391
KCP+C + +I+ S
Sbjct: 58 KCPMCYTVITFKQKIFMS 75
|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 391 | |||
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.48 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.48 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.47 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 99.38 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.38 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.36 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.35 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.06 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.03 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.02 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.0 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.0 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.0 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.99 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.98 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.95 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.94 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.94 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.93 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.93 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.92 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.91 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.91 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.91 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.9 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.88 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.88 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.87 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.86 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.86 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.86 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.84 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.83 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.82 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.81 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.8 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.78 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.76 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.76 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.76 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.75 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.74 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.74 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.73 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.73 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.72 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.71 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.69 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.68 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.66 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.65 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.64 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.61 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.56 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.51 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.47 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.47 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.46 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.44 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.42 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.36 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.24 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.04 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.95 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.92 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.88 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.86 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 97.42 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 96.7 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 96.26 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 95.93 | |
| 2i3h_A | 133 | Baculoviral IAP repeat-containing protein 7; zinc | 95.55 | |
| 1i4o_C | 141 | X-linked IAP, baculoviral IAP repeat-containing pr | 95.51 | |
| 1jd5_A | 124 | DIAP1, apoptosis 1 inhibitor; IAP, caspase activat | 95.29 | |
| 2poi_A | 94 | Baculoviral IAP repeat-containing protein 4; zinc | 95.16 | |
| 2vm5_A | 106 | Baculoviral IAP repeat-containing protein 1; apopt | 94.99 | |
| 2qra_D | 111 | XIAP, baculoviral IAP repeat-containing protein 4, | 94.93 | |
| 1se0_A | 116 | Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspas | 94.39 | |
| 3m1d_A | 85 | Baculoviral IAP repeat-containing protein 2; BIR, | 94.2 | |
| 3mup_A | 122 | Baculoviral IAP repeat-containing protein 2; zinc- | 94.13 | |
| 1g73_C | 121 | Inhibitors of apoptosis-like protein ILP; helix bu | 94.07 | |
| 3d9t_A | 97 | Baculoviral IAP repeat-containing protein 2; zinc | 94.04 | |
| 3hl5_A | 95 | Baculoviral IAP repeat-containing protein 4; BIR, | 93.26 | |
| 3siq_A | 136 | Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; | 93.21 | |
| 2qfa_A | 142 | Baculoviral IAP repeat-containing protein 5; three | 92.55 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 92.11 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 90.46 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 88.44 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 81.74 |
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.48 E-value=1.2e-14 Score=110.13 Aligned_cols=55 Identities=27% Similarity=0.573 Sum_probs=48.9
Q ss_pred CCCccccccccccccceeEEecCCCccccHHhHHHHhhcCCCCcccccccccceEEeeeC
Q 016312 332 DIPDGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIYFS 391 (391)
Q Consensus 332 ~~~~~~~C~IC~~~~~~~v~lpCGH~~~C~~C~~~~~~~~~~~CPiCR~~I~~~~~iy~s 391 (391)
...+...|+||++++++++++||||.++|..|+..+ ..||+||++|..++++|.+
T Consensus 11 ~~~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~-----~~CP~CR~~i~~~~~i~~~ 65 (68)
T 2ea5_A 11 SEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYF-----QQCPMCRQFVQESFALSGP 65 (68)
T ss_dssp SCCCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHC-----SSCTTTCCCCCCEECCCSS
T ss_pred cCCCCCCCCCcCcCCCCEEEECCCChhhhHHHHhcC-----CCCCCCCcchhceEEeecC
Confidence 344566999999999999999999999999999875 3899999999999999963
|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A* | Back alignment and structure |
|---|
| >1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A | Back alignment and structure |
|---|
| >1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A | Back alignment and structure |
|---|
| >2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B | Back alignment and structure |
|---|
| >2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E | Back alignment and structure |
|---|
| >3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D | Back alignment and structure |
|---|
| >3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} SCOP: g.52.1.1 PDB: 3oz1_A* 4eb9_A* | Back alignment and structure |
|---|
| >1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A | Back alignment and structure |
|---|
| >3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A | Back alignment and structure |
|---|
| >3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A | Back alignment and structure |
|---|
| >3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ... | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 391 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 1e-10 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 1e-06 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 8e-06 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-04 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 0.001 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 0.001 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 55.4 bits (133), Expect = 1e-10
Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 1/55 (1%)
Query: 335 DGQLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIY 389
QLC +C + PCGH + C C S + CP CR ++ + I
Sbjct: 22 TFQLCKICAENDKDVKIEPCGH-LMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 391 | |||
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.0 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.95 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.92 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.89 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.86 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.8 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.8 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.79 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.73 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.64 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.5 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.47 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.47 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.31 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.19 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.42 | |
| d2vsla1 | 96 | BIR domains of XIAP {Human (Homo sapiens) [TaxId: | 94.96 | |
| d2i3ha1 | 90 | BIR-containing protein 7 (ML-IAP, livin) {Human (H | 94.65 | |
| d3d9ta1 | 87 | 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} | 94.15 | |
| d1i3oe_ | 111 | BIR domains of XIAP {Human (Homo sapiens) [TaxId: | 94.1 | |
| d1jd5a_ | 105 | BIR domains of DIAP1 {Fruit fly (Drosophila melano | 94.04 | |
| d1se0a_ | 97 | BIR domains of DIAP1 {Fruit fly (Drosophila melano | 92.55 | |
| d2qfaa1 | 137 | Anti-apoptotic protein survivin {Human (Homo sapie | 92.4 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 90.68 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.17 E-value=5.4e-12 Score=96.44 Aligned_cols=52 Identities=33% Similarity=0.820 Sum_probs=45.3
Q ss_pred ccccccccccceeEEecCCCccccHHhHHHHhhcCCCCcccccccccceEEee
Q 016312 337 QLCVVCLTRRRISAFNPCGHLVCCRRCAISVEREASPKCPVCRMTVRSSMRIY 389 (391)
Q Consensus 337 ~~C~IC~~~~~~~v~lpCGH~~~C~~C~~~~~~~~~~~CPiCR~~I~~~~~iy 389 (391)
..|+||++...+++++||||. ||..|+..|......+||+||..|.+...+.
T Consensus 24 ~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~ 75 (79)
T d1fbva4 24 QLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75 (79)
T ss_dssp TBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred CCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence 479999999999999999999 8999999987655567999999998876553
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d9ta1 g.52.1.1 (A:260-346) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i3oe_ g.52.1.1 (E:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jd5a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1se0a_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2qfaa1 g.52.1.1 (A:5-141) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|