Citrus Sinensis ID: 016340

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-

MSSNTVRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQLETQRQYYESLLAEAKSKRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGGTVLPVSYQQSSPTNTRRHKKSSRRKN

ccEEEEEEcccccEEEEEEEEccHHHHHHHHHHHcccccccccccEEEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccEEEEEccEEEcccccccHHHHHHHHccccEEEEccccEEEEcccccEEEcccccccccHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccccccccccccccc

cccEEEEEccccccEEEEEEEccHHHHHHHHHHHccccccccccccEEEEEEEEEEEEcccccccccccccccccccccEEEcccccccEEEEEEccccccHHHHHHcccccccEEEEEcccccccccccccccccEEEEEEEcccccccccccHHHHHHHHcccEEEEEccccEEEEccccccEEEEEEEccccEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccccccccccccc

mssntvrndamEDRYSVLIKLVDQLTADEfysnlngkrfspaeAEVCHMLFMLSVEYTELaeiastppagftelptcpiclerldpdtsgilsticdhsfqcsctakwtvlscqvcrfchqqderptcsvcgtvenLWVCLICGfvgcgrykeghavrhwkdtqhwysldLRTQQIWDYVGDNYVHRLNqskadgklvemnspcmsheahcgtcecsedsgisgalfnSKVEAIVDEYNRLLATQLETQRQYYESLLAEAKSKRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTnmtdsdgikggtvlpvsyqqssptntrrhkkssrrkn

mssntvrndamedRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQLETQRQYYESLLAEakskresliPETVEKAVASKMQDIQNELDICEEAKKAVAdvnskliknqeimrkkfkeieereitslrlrdatilDLEEQIRDLTVYIEAQKTltnmtdsdgiKGGTvlpvsyqqssptntrrhkkssrrkn

MSSNTVRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQLETQRQYYESLLAEAKSKRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQeimrkkfkeieereiTSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGGTVLPVSYQQSSPTNTRRHKKSSRRKN

*************RYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQLETQRQYYESLL*****************************LDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNM***********************************

*SSNTVRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEY**************TELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLV*********************SGISGALFNSKVEAIVDEYNRLLATQLETQRQYYES*********************************************************************************EEQIRDLTVY*********************************************

********DAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQLETQRQYYESLLAEAKSKRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGGTVLPVSY*******************

*SSNTVRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSP*********************ALFNSKVEAIVDEYNRLLATQLETQRQYYESLLAEAKSKRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGGTVLPVS********************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSNTVRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLxxxxxxxxxxxxxxxxxxxxxRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGGTVLPVSYQQSSPTNTRRHKKSSRRKN

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		391	2.2.26 [Sep-21-2011]
Q7Z569		592	BRCA1-associated protein	yes	no	0.841	0.555	0.359	9e-63
Q99MP8		591	BRCA1-associated protein	yes	no	0.925	0.612	0.334	3e-61
O13747		547	RING finger protein ETP1	yes	no	0.869	0.621	0.349	3e-58
P38748		585	RING finger protein ETP1	yes	no	0.895	0.598	0.334	5e-55
Q95QN6		590	Uncharacterized RING fing	yes	no	0.874	0.579	0.321	5e-53
Q0V9G5		652	Ubiquitin carboxyl-termin	no	no	0.148	0.088	0.431	6e-09
Q5XGZ2		690	Ubiquitin carboxyl-termin	N/A	no	0.148	0.084	0.431	8e-09
Q6NTR6		690	Ubiquitin carboxyl-termin	N/A	no	0.148	0.084	0.431	8e-09
Q9H0E7		712	Ubiquitin carboxyl-termin	no	no	0.217	0.119	0.367	1e-08
D2HBJ8		711	Ubiquitin carboxyl-termin	no	no	0.219	0.120	0.348	2e-08

>sp\|Q7Z569\|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2	Back alignment and function desciption

 Score =  241 bits (614), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 134/373 (35%), Positives = 205/373 (54%), Gaps = 44/373 (11%)

Query: 9   DAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPP 68
           D+  ++Y VLIK   Q  AD FY   NG++F+  E +VC ++++   E  +  + AS P 
Sbjct: 196 DSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPV 255

Query: 69  AGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQD--ERP 126
              TELP C +CLER+D   +GIL+T+C+HSF   C  +W   +C VCR+C   +  E  
Sbjct: 256 MDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEEN 315

Query: 127 TCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVH 186
            C  CG  ENLW+CLICG +GCGRY   HA +H+++TQH Y++ L   ++WDY GDNYVH
Sbjct: 316 KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVH 375

Query: 187 RLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQL 246
           RL  SK DGK+V+       +E    TC+              K++A+  EY+ LL +QL
Sbjct: 376 RLVASKTDGKIVQ-------YECEGDTCQ------------EEKIDALQLEYSYLLTSQL 416

Query: 247 ETQRQYYESLL-------AEAKSKRESLIPETVEKA--VASKMQDIQNELDI----CEEA 293
           E+QR Y+E+ +       AE  +  ++   ET+EK   +  K+ D+  E       C + 
Sbjct: 417 ESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQL 476

Query: 294 KKAVA----------DVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDL 343
              VA          ++N  L  NQ +++ K KE E     +   +D  I +++EQ+RD+
Sbjct: 477 NTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDV 536

Query: 344 TVYIEAQKTLTNM 356
             Y+E Q+ + ++
Sbjct: 537 MFYLETQQKINHL 549

Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a cytoplasmic retention protein with a role in regulating nuclear transport.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q99MP8\|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1	Back alignment and function description

>sp\|O13747\|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1	Back alignment and function description

>sp\|P38748\|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1	Back alignment and function description

>sp\|Q95QN6\|YQOE_CAEEL Uncharacterized RING finger protein EEED8.16 OS=Caenorhabditis elegans GN=EEED8.16 PE=4 SV=1	Back alignment and function description

>sp\|Q0V9G5\|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1	Back alignment and function description

>sp\|Q5XGZ2\|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1	Back alignment and function description

>sp\|Q6NTR6\|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1	Back alignment and function description

>sp\|Q9H0E7\|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2	Back alignment and function description

>sp\|D2HBJ8\|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		391
255572491		477	brca1-associated protein, putative [Rici	0.974	0.798	0.777	1e-178
224144167		486	predicted protein [Populus trichocarpa]	0.987	0.794	0.757	1e-173
356562985		470	PREDICTED: BRCA1-associated protein-like	0.987	0.821	0.708	1e-168
225445567		470	PREDICTED: BRCA1-associated protein [Vit	0.989	0.823	0.744	1e-165
449517888		487	PREDICTED: BRCA1-associated protein-like	0.982	0.788	0.705	1e-163
449443061		487	PREDICTED: BRCA1-associated protein-like	0.982	0.788	0.705	1e-163
356548484		484	PREDICTED: BRCA1-associated protein-like	0.987	0.797	0.711	1e-162
297827885		488	zinc finger (ubiquitin-hydrolase) domain	0.984	0.788	0.681	1e-159
357478181		536	RING finger protein ETP1-like protein [M	0.956	0.697	0.700	1e-159
42569859		488	zinc finger (ubiquitin-hydrolase) domain	0.984	0.788	0.670	1e-158

>gi\|255572491\|ref\|XP_002527180.1\| brca1-associated protein, putative [Ricinus communis] gi\|223533445\|gb\|EEF35193.1\| brca1-associated protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 300/386 (77%), Positives = 332/386 (86%), Gaps = 5/386 (1%)

Query: 6   VRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIAS 65
           +RND MEDRYSVLIKL +Q+TAD FY + NGKRFSPAEAEVCH+LF +SVEYTE+AEIAS
Sbjct: 97  IRNDGMEDRYSVLIKLNNQVTADRFYESFNGKRFSPAEAEVCHILF-VSVEYTEVAEIAS 155

Query: 66  TPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDER 125
           TPP GFTELPTCPICLERLDPDTSGILST+CDHSFQCSCT+KWT LSCQVCR C QQDE+
Sbjct: 156 TPPVGFTELPTCPICLERLDPDTSGILSTLCDHSFQCSCTSKWTYLSCQVCRLCQQQDEK 215

Query: 126 PTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYV 185
           P C+VCGTVENLWVCLICGF+GCGRYKEGHA+RHW+DTQH Y LDLRTQQIWDYVGDNYV
Sbjct: 216 PACAVCGTVENLWVCLICGFIGCGRYKEGHAMRHWQDTQHCYILDLRTQQIWDYVGDNYV 275

Query: 186 HRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQ 245
           HRLNQSKAD KLV+MN    S E  CGTC CSEDSGISGALF+SKVE IVDEYN LLATQ
Sbjct: 276 HRLNQSKADAKLVDMN----SREGDCGTCGCSEDSGISGALFSSKVETIVDEYNHLLATQ 331

Query: 246 LETQRQYYESLLAEAKSKRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLI 305
           L+ QRQYYESL+ E K+KRES I E VEKAV S MQDIQN+L+ CE  K AV DVN  LI
Sbjct: 332 LKAQRQYYESLITEVKNKRESSILEAVEKAVTSTMQDIQNKLERCEMEKDAVTDVNRNLI 391

Query: 306 KNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGG 365
           KNQ+I RKK KE+EERE++SLR RD  ILDLEEQIRDLT+YIEAQKTL  MTD++ I+GG
Sbjct: 392 KNQDIWRKKVKEVEEREMSSLRSRDERILDLEEQIRDLTIYIEAQKTLNKMTDTNDIQGG 451

Query: 366 TVLPVSYQQSSPTNTRRHKKSSRRKN 391
           T+LPV  +QSSP N RRH K  RR+N
Sbjct: 452 TLLPVPSKQSSPANNRRHSKPGRRRN 477

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224144167\|ref\|XP_002325207.1\| predicted protein [Populus trichocarpa] gi\|222866641\|gb\|EEF03772.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356562985\|ref\|XP_003549748.1\| PREDICTED: BRCA1-associated protein-like [Glycine max]	Back alignment and taxonomy information

>gi\|225445567\|ref\|XP_002285333.1\| PREDICTED: BRCA1-associated protein [Vitis vinifera] gi\|297738981\|emb\|CBI28226.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449517888\|ref\|XP_004165976.1\| PREDICTED: BRCA1-associated protein-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449443061\|ref\|XP_004139299.1\| PREDICTED: BRCA1-associated protein-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356548484\|ref\|XP_003542631.1\| PREDICTED: BRCA1-associated protein-like [Glycine max]	Back alignment and taxonomy information

>gi\|297827885\|ref\|XP_002881825.1\| zinc finger (ubiquitin-hydrolase) domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297327664\|gb\|EFH58084.1\| zinc finger (ubiquitin-hydrolase) domain-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|357478181\|ref\|XP_003609376.1\| RING finger protein ETP1-like protein [Medicago truncatula] gi\|355510431\|gb\|AES91573.1\| RING finger protein ETP1-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|42569859\|ref\|NP_181746.2\| zinc finger (ubiquitin-hydrolase) domain-containing protein [Arabidopsis thaliana] gi\|312274868\|gb\|ADQ57814.1\| BRIZ1 [Arabidopsis thaliana] gi\|330254987\|gb\|AEC10081.1\| zinc finger (ubiquitin-hydrolase) domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		391
TAIR\|locus:2060045		488	BRIZ1 "AT2G42160" [Arabidopsis	0.984	0.788	0.645	5.5e-141
TAIR\|locus:2057469		479	BRIZ2 "AT2G26000" [Arabidopsis	0.987	0.805	0.460	5.9e-96
DICTYBASE\|DDB_G0270200		687	DDB_G0270200 "BRCA1-associated	0.769	0.438	0.355	6.9e-63
UNIPROTKB\|F1NJH4		556	BRAP "Uncharacterized protein"	0.971	0.683	0.323	5.4e-59
UNIPROTKB\|F1NR06		585	BRAP "Uncharacterized protein"	0.971	0.649	0.323	5.9e-57
ZFIN\|ZDB-GENE-040718-168		578	brap "BRCA1 associated protein	0.890	0.602	0.329	1.1e-55
UNIPROTKB\|A6H716		592	BRAP "BRAP protein" [Bos tauru	0.971	0.641	0.318	3.7e-55
UNIPROTKB\|J3KNN7		562	BRAP "BRCA1-associated protein	0.971	0.676	0.311	1.6e-54
UNIPROTKB\|Q7Z569		592	BRAP "BRCA1-associated protein	0.971	0.641	0.311	1.6e-54
UNIPROTKB\|F1PGI5		592	BRAP "Uncharacterized protein"	0.971	0.641	0.313	2.1e-54

TAIR\|locus:2060045 BRIZ1 "AT2G42160" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1379 (490.5 bits), Expect = 5.5e-141, P = 5.5e-141
 Identities = 249/386 (64%), Positives = 305/386 (79%)

Query:     6 VRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIAS 65
             +RND MEDRYSVLI   DQ  AD FY+NLNGK+F+P+EAEVCH+L+++SVE+TE  E+A+
Sbjct:   103 IRNDGMEDRYSVLITFSDQSEADGFYNNLNGKKFAPSEAEVCHILYVMSVEHTEFDEVAA 162

Query:    66 TPPAGFTELPTCPICLERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQDER 125
               P GFTELPTCPICLERLDPDTSGI+ST+CDHSFQCSCT+KWT LSCQVCR C QQDE 
Sbjct:   163 EAPTGFTELPTCPICLERLDPDTSGIVSTLCDHSFQCSCTSKWTYLSCQVCRLCQQQDEI 222

Query:   126 PTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYV 185
               CS+CG  EN+W CL+CGFVGCGRYKEGH++RHWK+T H YSLDLRTQQIWDYVGD+YV
Sbjct:   223 LNCSICGKTENVWACLVCGFVGCGRYKEGHSIRHWKETHHCYSLDLRTQQIWDYVGDSYV 282

Query:   186 HRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQ 245
             HRLN SK DGK VEM++ C+SH+  CG CECSED+GISGA+FNSKV++IV EYN LLA+Q
Sbjct:   283 HRLNHSKIDGKSVEMSTSCLSHQGDCGLCECSEDTGISGAIFNSKVDSIVIEYNDLLASQ 342

Query:   246 LETQRQYYESLLAEAKSKRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLI 305
             L+ QRQYYESL+ EA+SK+ES I E VE+ V + MQ++QN+++ CEE K  + +VN+KLI
Sbjct:   343 LKGQRQYYESLIVEARSKQESSIAEAVEQIVVNTMQELQNKIEKCEEEKSGITEVNTKLI 402

Query:   306 KNQXXXXXXXXXXXXXXXTSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMT-DSDGIKG 364
             K Q                 L  +D  I DL+EQIRD+TV+IEA+KTL  M+ D+DGI+ 
Sbjct:   403 KEQDTWRKKAKEIEEREAALLGSKDEMITDLQEQIRDITVFIEAKKTLKKMSSDTDGIRE 462

Query:   365 GTVLPVSYQQSSPTNTRRHKKSSRRK 390
             GTVLPV       ++ RR KKS+RRK
Sbjct:   463 GTVLPVPISPEPVSSVRRQKKSNRRK 488

GO:0003824 "catalytic activity" evidence=ISS

GO:0005737 "cytoplasm" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA

GO:0000151 "ubiquitin ligase complex" evidence=IC

GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA

GO:0010029 "regulation of seed germination" evidence=IMP

GO:0046982 "protein heterodimerization activity" evidence=IDA

TAIR\|locus:2057469 BRIZ2 "AT2G26000" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0270200 DDB_G0270200 "BRCA1-associated protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NJH4 BRAP "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NR06 BRAP "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040718-168 brap "BRCA1 associated protein" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|A6H716 BRAP "BRAP protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|J3KNN7 BRAP "BRCA1-associated protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7Z569 BRAP "BRCA1-associated protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PGI5 BRAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00016936001	SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (470 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		391
pfam02148		63	pfam02148, zf-UBP, Zn-finger in ubiquitin-hydrolas	7e-25
smart00290		50	smart00290, ZnF_UBP, Ubiquitin Carboxyl-terminal H	1e-20
pfam07576		110	pfam07576, BRAP2, BRCA1-associated protein 2	4e-19
cd12437		82	cd12437, RRM_BRAP2_like, RNA recognition motif in	6e-17
cd12717		82	cd12717, RRM_ETP1, RNA recognition motif in yeast	3e-10
cd12718		84	cd12718, RRM_BRAP2, RNA recognition motif in BRCA1	3e-09
COG5207		749	COG5207, UBP14, Isopeptidase T [Posttranslational	1e-08
COG3853		386	COG3853, TelA, Uncharacterized protein involved in	0.002

>gnl\|CDD\|216903 pfam02148, zf-UBP, Zn-finger in ubiquitin-hydrolases and other protein	Back alignment and domain information

 Score = 95.9 bits (239), Expect = 7e-25
 Identities = 32/63 (50%), Positives = 44/63 (69%)

Query: 128 CSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHR 187
           CS CG+ ENLW+CL CG VGCGRY  GHA++H+++T H  ++ L T ++W Y  D+YVH 
Sbjct: 1   CSECGSTENLWLCLTCGHVGCGRYSNGHALKHYEETGHPLAVSLETGRVWCYACDDYVHD 60

Query: 188 LNQ 190
              
Sbjct: 61  PVL 63

Length = 63

>gnl\|CDD\|197632 smart00290, ZnF_UBP, Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger	Back alignment and domain information

>gnl\|CDD\|191791 pfam07576, BRAP2, BRCA1-associated protein 2	Back alignment and domain information

>gnl\|CDD\|240883 cd12437, RRM_BRAP2_like, RNA recognition motif in BRCA1-associated protein (BRAP2) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241161 cd12717, RRM_ETP1, RNA recognition motif in yeast RING finger protein ETP1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241162 cd12718, RRM_BRAP2, RNA recognition motif in BRCA1-associated protein (BRAP2)	Back alignment and domain information

>gnl\|CDD\|227532 COG5207, UBP14, Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|226371 COG3853, TelA, Uncharacterized protein involved in tellurite resistance [Inorganic ion transport and metabolism]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		391
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	100.0
PF07576		110	BRAP2: BRCA1-associated protein 2; InterPro: IPR01	99.89
PF02148		63	zf-UBP: Zn-finger in ubiquitin-hydrolases and othe	99.63
KOG0944		763	consensus Ubiquitin-specific protease UBP14 [Postt	99.33
COG5207		749	UBP14 Isopeptidase T [Posttranslational modificati	99.24
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	99.13
smart00290		50	ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like	99.07
cd02669		440	Peptidase_C19M A subfamily of Peptidase C19. Pepti	98.88
KOG1873		877	consensus Ubiquitin-specific protease [Posttransla	98.71
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.66
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.61
PHA02929		238	N1R/p28-like protein; Provisional	98.26
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.25
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	98.19
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	98.18
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.11
PHA02926		242	zinc finger-like protein; Provisional	98.06
PF14634		44	zf-RING_5: zinc-RING finger domain	98.03
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	98.02
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	97.99
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	97.96
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	97.93
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	97.89
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	97.88
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	97.88
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	97.83
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	97.78
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	97.75
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	97.73
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	97.7
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	97.69
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	97.67
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	97.49
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	97.46
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	97.43
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	97.38
KOG0825		1134	consensus PHD Zn-finger protein [General function	97.13
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	96.93
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	96.83
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	96.81
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	96.79
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	96.71
PF00038		312	Filament: Intermediate filament protein; InterPro:	96.59
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	96.13
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	95.9
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	95.89
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	95.89
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	95.83
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	95.83
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	95.76
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	95.76
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	95.42
PF07227		446	DUF1423: Protein of unknown function (DUF1423); In	95.04
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	95.02
PF00038		312	Filament: Intermediate filament protein; InterPro:	94.9
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	94.78
KOG4367		699	consensus Predicted Zn-finger protein [Function un	94.28
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	94.18
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	94.11
KOG0297		391	consensus TNF receptor-associated factor [Signal t	94.1
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	93.53
COG5219		1525	Uncharacterized conserved protein, contains RING Z	93.36
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	93.09
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	93.02
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	92.31
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	92.27
COG5152		259	Uncharacterized conserved protein, contains RING a	92.25
KOG2660		331	consensus Locus-specific chromosome binding protei	92.08
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	92.07
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	91.73
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	91.61
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	90.86
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	90.79
PRK09039		343	hypothetical protein; Validated	90.46
KOG1940		276	consensus Zn-finger protein [General function pred	90.28
KOG3002		299	consensus Zn finger protein [General function pred	90.13
KOG1941		518	consensus Acetylcholine receptor-associated protei	89.96
KOG1655		218	consensus Protein involved in vacuolar protein sor	89.89
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	89.85
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	89.66
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	89.4
KOG3759		621	consensus Uncharacterized RUN domain protein [Sign	89.17
COG5222		427	Uncharacterized conserved protein, contains RING Z	89.09
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	89.02
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	89.01
KOG4445		368	consensus Uncharacterized conserved protein, conta	88.9
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	88.8
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	88.76
PF04641		260	Rtf2: Rtf2 RING-finger	88.7
PF10211		189	Ax_dynein_light: Axonemal dynein light chain; Inte	88.62
KOG4739		233	consensus Uncharacterized protein involved in syna	88.62
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	88.41
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	88.35
TIGR03825		255	FliH_bacil flagellar assembly protein FliH. This b	88.22
PF09731		582	Mitofilin: Mitochondrial inner membrane protein; I	87.78
KOG3039		303	consensus Uncharacterized conserved protein [Funct	87.53
COG5175		480	MOT2 Transcriptional repressor [Transcription]	87.46
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	87.42
PHA02562		562	46 endonuclease subunit; Provisional	87.39
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	86.11
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	85.79
KOG0579		1187	consensus Ste20-like serine/threonine protein kina	85.73
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	85.69
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	85.51
KOG1001		674	consensus Helicase-like transcription factor HLTF/	85.26
COG4026		290	Uncharacterized protein containing TOPRIM domain,	85.21
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	85.16
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	85.15
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	84.53
PRK11637		428	AmiB activator; Provisional	84.47
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	84.43
TIGR02449		65	conserved hypothetical protein TIGR02449. Members	84.41
KOG1103		561	consensus Predicted coiled-coil protein [Function	84.21
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	84.16
PRK00409		782	recombination and DNA strand exchange inhibitor pr	84.11
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	84.01
KOG1002		791	consensus Nucleotide excision repair protein RAD16	83.97
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	83.93
KOG4005		292	consensus Transcription factor XBP-1 [Transcriptio	83.77
PRK08476		141	F0F1 ATP synthase subunit B'; Validated	83.73
COG3937		108	Uncharacterized conserved protein [Function unknow	83.55
KOG0971		1243	consensus Microtubule-associated protein dynactin	83.49
PF11068		131	YlqD: YlqD protein; InterPro: IPR021297 This bacte	83.44
PRK12704		520	phosphodiesterase; Provisional	83.38
TIGR03752		472	conj_TIGR03752 integrating conjugative element pro	83.18
PRK09039		343	hypothetical protein; Validated	83.07
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	82.9
PRK10361		475	DNA recombination protein RmuC; Provisional	82.72
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	82.51
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	82.38
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	82.21
KOG3161		861	consensus Predicted E3 ubiquitin ligase [Posttrans	81.99
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	81.73
COG5185		622	HEC1 Protein involved in chromosome segregation, i	81.72
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	81.61
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	81.46
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	81.31
KOG0964		1200	consensus Structural maintenance of chromosome pro	80.75
COG2433		652	Uncharacterized conserved protein [Function unknow	80.66
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	80.51
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	80.38
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	80.33
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	80.07

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=2.7e-106  Score=796.55  Aligned_cols=367  Identities=51%  Similarity=0.903  Sum_probs=326.3

Q ss_pred             ccceeecCCCCCceEEEEecCChhhHHHHHHHhcCcccCCCCcccceEEEEeEEEEeecccccCCCCCCCCCCCcccccc
Q 016340            2 SSNTVRNDAMEDRYSVLIKLVDQLTADEFYSNLNGKRFSPAEAEVCHMLFMLSVEYTELAEIASTPPAGFTELPTCPICL   81 (391)
Q Consensus         2 ~~r~ir~d~~~~~y~vLlkF~~~~~A~~f~~~~ng~~f~s~e~e~C~v~~v~~v~~~~~~~~~~~~~~~~~E~~tCpiCl   81 (391)
                      .+|||| |++||||||||||+++.+|+.||.+|||++||++||++|||+||.+|+|+.+.+.+++++++++|+|||||||
T Consensus       104 ~irivR-d~~pnrymvLIkFr~q~da~~Fy~efNGk~Fn~le~e~Chll~V~~ve~~~s~d~as~~~~~~tELPTCpVCL  182 (493)
T KOG0804|consen  104 DIRIVR-DGMPNRYMVLIKFRDQADADTFYEEFNGKQFNSLEPEVCHLLYVDRVEVTESEDGASEPPTGLTELPTCPVCL  182 (493)
T ss_pred             eeEEee-cCCCceEEEEEEeccchhHHHHHHHcCCCcCCCCCccceeEEEEEEEEEEecccCCCCCCCCcccCCCcchhH
Confidence            489999 8999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCCCCCCceeecCCCcccchhhhccccccCCCccccccC--CCCCcccccCcccceeeecccccccccCCCCcccccc
Q 016340           82 ERLDPDTSGILSTICDHSFQCSCTAKWTVLSCQVCRFCHQQ--DERPTCSVCGTVENLWVCLICGFVGCGRYKEGHAVRH  159 (391)
Q Consensus        82 e~ld~~~~g~it~~C~H~F~~~Cl~~w~~~~CP~Cr~~~~~--~~~~~C~~C~~~~~lwiCL~CG~vgCgr~~~~HA~~H  159 (391)
                      ||||++++||+++.|+|+||+.|+.+|.+++||+||+++.|  .+...|.+|+..++||+||+||++|||||..+||.+|
T Consensus       183 ERMD~s~~gi~t~~c~Hsfh~~cl~~w~~~scpvcR~~q~p~~ve~~~c~~c~~~~~LwicliCg~vgcgrY~eghA~rH  262 (493)
T KOG0804|consen  183 ERMDSSTTGILTILCNHSFHCSCLMKWWDSSCPVCRYCQSPSVVESSLCLACGCTEDLWICLICGNVGCGRYKEGHARRH  262 (493)
T ss_pred             hhcCccccceeeeecccccchHHHhhcccCcChhhhhhcCcchhhhhhhhhhcccccEEEEEEccceecccccchhHHHH
Confidence            99999999999999999999999999999999999998863  1467999999999999999999999999999999999


Q ss_pred             cCCCCCcccccCCCceeEecCCchhhhhhhcccccCCeecccCCCCCcCCCCCCCcCCCCCCccchhhhhhHHHHHHHHH
Q 016340          160 WKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYN  239 (391)
Q Consensus       160 ~~~t~H~~~~~l~t~~vwcy~cd~~Vhrl~~~k~dgklve~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K~e~~~~Ey~  239 (391)
                      |++|+|+|+|+|+|++||||+||+|||||+++++|||+|++...+.+.                   ...+.+.+.+||+
T Consensus       263 weet~H~yalel~tqrVWDYAGDnYVhRl~~~~~dGklve~~~~~~~~-------------------~~~~~~~~~~~~s  323 (493)
T KOG0804|consen  263 WEETGHCYALELETQRVWDYAGDNYVHRLPQSKTDGKLVESSTEGDDS-------------------RKDDCDSLELEYS  323 (493)
T ss_pred             HHhhcceEEEeecceeeeecccchhhhhccccCCCCceEEeccccccc-------------------cccCcceEEeecc
Confidence            999999999999999999999999999999999999999987765321                   1234455667777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH-h-------------------hhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 016340          240 RLLATQLETQRQYYESLLAEAKS-K-------------------RESLIPETVEKAVASKMQDIQNELDICEEAKKAVAD  299 (391)
Q Consensus       240 ~ll~sqLesQR~yyE~~l~~~~~-~-------------------~~~~~~~~~~~~~~~~~~~l~~~l~~~~~e~~~~~~  299 (391)
                      .||+|||||||.|||..+.++.+ +                   .+....++.++.++.++++++.+++++.+|++++++
T Consensus       324 ~ll~sqleSqr~y~e~~~~e~~qsqlen~k~~~e~~~~e~~~l~~~~~~~e~~kk~~e~k~~q~q~k~~k~~kel~~~~E  403 (493)
T KOG0804|consen  324 PLLTSQLESQRKYYEQIMSEYEQSQLENQKQYYELLITEADSLKQESSDLEAEKKIVERKLQQLQTKLKKCQKELKEERE  403 (493)
T ss_pred             hhhhhhhhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            77777777777777766666554 2                   222233445566788999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhHhHhhhhHHHhhccCCCCCcCCcEEeecCCCCCCCCC
Q 016340          300 VNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGGTVLPVSYQQSSPTN  379 (391)
Q Consensus       300 ln~~L~~nq~~~~~~~~~le~~~~~~~~~~~~~i~dL~EQ~rDlmf~le~q~ki~~~~~~~ei~~g~i~~~~~~~~~~~~  379 (391)
                      +|+.|.+||..|+.+++++++++++++..++++|+||+||||||||||++|+||+  ++.+||++|||++++..++++++
T Consensus       404 ~n~~l~knq~vw~~kl~~~~e~~~~~~~s~d~~I~dLqEQlrDlmf~le~qqklk--~dt~eIqegtI~~~~~s~~~~~~  481 (493)
T KOG0804|consen  404 ENKKLIKNQDVWRGKLKELEEREKEALGSKDEKITDLQEQLRDLMFFLEAQQKLK--SDTDEIQEGTILITQISPSSSSS  481 (493)
T ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHheehhhhhhhh--cchhhhcCceeeccCCCCCcccc
Confidence            9999999999999999999999999999999999999999999999999999998  34569999999987766666665


Q ss_pred             ccCCCCcCCCC
Q 016340          380 TRRHKKSSRRK  390 (391)
Q Consensus       380 ~~~~~k~~~~~  390 (391)
                      -+++||+|||+
T Consensus       482 ~~~kkk~nrrk  492 (493)
T KOG0804|consen  482 VKSKKKSNRRK  492 (493)
T ss_pred             ccchhhhcccC
Confidence            56666667665

>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening []	Back alignment and domain information

>PF02148 zf-UBP: Zn-finger in ubiquitin-hydrolases and other protein; InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger	Back alignment and domain information

>cd02669 Peptidase_C19M A subfamily of Peptidase C19	Back alignment and domain information

>KOG1873 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp []	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG1940 consensus Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>KOG1655 consensus Protein involved in vacuolar protein sorting [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG3759 consensus Uncharacterized RUN domain protein [Signal transduction mechanisms]	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility	Back alignment and domain information

>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR03825 FliH_bacil flagellar assembly protein FliH	Back alignment and domain information

>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>TIGR02449 conserved hypothetical protein TIGR02449	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>KOG4005 consensus Transcription factor XBP-1 [Transcription]	Back alignment and domain information

>PRK08476 F0F1 ATP synthase subunit B'; Validated	Back alignment and domain information

>COG3937 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF11068 YlqD: YlqD protein; InterPro: IPR021297 This bacterial family of proteins has no known function	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		391
3c5k_A		109	Crystal Structure Of Human Hdac6 Zinc Finger Domain		8e-07
3gv4_A		107	Crystal Structure Of Human Hdac6 Zinc Finger Domain		8e-07
2uzg_A		97	Zf-Ubp Domain Of Vdu1 Length = 97		4e-04

>pdb|3C5K|A Chain A, Crystal Structure Of Human Hdac6 Zinc Finger Domain Length = 109

Back alignment and structure

Iteration: 1
 Score = 51.6 bits (122), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 30/59 (50%)
Query: 128 CSVCGTVENLWVCLICGFVGCGRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVH 186
           C  CGT++  WVCL C  V CGRY  GH ++H  ++ H   L       W Y    YVH
Sbjct: 27  CGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVH 85

PyMOL of 3c5k

>pdb|3GV4|A Chain A, Crystal Structure Of Human Hdac6 Zinc Finger Domain And Ubiquitin C-Terminal Peptide Rlrgg Length = 107

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		391
2i50_A		126	Ubiquitin carboxyl-terminal hydrolase 16; alpha/be	1e-28
3c5k_A		109	HD6, histone deacetylase 6; HDAC6, zinc finger, ac	1e-26
2uzg_A		97	Ubiquitin carboxyl-terminal hydrolase 33; UBL conj	9e-22
2g45_A		129	Ubiquitin carboxyl-terminal hydrolase 5; zinc fing	8e-20
2ida_A		102	Hypothetical protein; zinc binding protein, struct	4e-18
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	7e-11
3mhs_A		476	Ubiquitin carboxyl-terminal hydrolase 8; multi-pro	4e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-05
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	1e-04
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	3e-04
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	4e-04
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	5e-04

>2i50_A Ubiquitin carboxyl-terminal hydrolase 16; alpha/beta zinc-finger, ring-finger, ZNF-UBP, metalloprotein, ubiquitin-binding protein, USP; NMR {Homo sapiens} Length = 126	Back alignment and structure

 Score =  107 bits (269), Expect = 1e-28
 Identities = 30/127 (23%), Positives = 50/127 (39%), Gaps = 11/127 (8%)

Query: 90  GILSTICDHSFQCSCTAKWTVL----SCQVCRFCHQQ--DERPTCSVCGTVENLWVCLIC 143
           G    +C H  +                 +C+ C      +           ++W+CL C
Sbjct: 1   GSHMPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKC 60

Query: 144 GFVGCGRY-KEGHAVRHW---KDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVE 199
           G  GCGR  +E HA++H+   +   H   L L    +W YV DN V   + ++  G++V+
Sbjct: 61  GHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQ-LGQVVD 119

Query: 200 MNSPCMS 206
                 S
Sbjct: 120 YVRKQAS 126

PyMOL of 2i50

>3c5k_A HD6, histone deacetylase 6; HDAC6, zinc finger, actin-binding, chromatin regulator, cytoplasm, hydrolase, metal-binding, nucleus, phosphoprotein; 1.55A {Homo sapiens} PDB: 3gv4_A 3phd_A Length = 109	Back alignment and structure

>2g45_A Ubiquitin carboxyl-terminal hydrolase 5; zinc finger, hydrolase; 1.99A {Homo sapiens} SCOP: g.44.1.5 PDB: 2g43_A 2l80_A Length = 129	Back alignment and structure

>2ida_A Hypothetical protein; zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} SCOP: g.44.1.5 Length = 102	Back alignment and structure

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854	Back alignment and structure

>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 3m99_A Length = 476	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		391
2i50_A		126	Ubiquitin carboxyl-terminal hydrolase 16; alpha/be	99.82
2g45_A		129	Ubiquitin carboxyl-terminal hydrolase 5; zinc fing	99.81
3c5k_A		109	HD6, histone deacetylase 6; HDAC6, zinc finger, ac	99.76
2uzg_A		97	Ubiquitin carboxyl-terminal hydrolase 33; UBL conj	99.7
2ida_A		102	Hypothetical protein; zinc binding protein, struct	99.69
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	99.66
3mhs_A		476	Ubiquitin carboxyl-terminal hydrolase 8; multi-pro	99.19
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.81
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	98.76
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.75
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	98.74
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	98.73
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	98.73
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	98.73
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	98.72
2ect_A		78	Ring finger protein 126; metal binding protein, st	98.72
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	98.71
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	98.7
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	98.7
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.69
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	98.69
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	98.68
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.66
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.66
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	98.66
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	98.66
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.65
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	98.65
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	98.63
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	98.62
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.62
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	98.61
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	98.6
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.59
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	98.58
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	98.58
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	98.58
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	98.57
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	98.57
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.57
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	98.56
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	98.56
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	98.51
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	98.5
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	98.49
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	98.48
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	98.44
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.42
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.4
1z6u_A		150	NP95-like ring finger protein isoform B; structura	98.4
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	98.4
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	98.39
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.38
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	98.38
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	98.36
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.36
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	98.3
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.3
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.29
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	98.26
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	98.14
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.05
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.04
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	98.04
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.01
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	97.93
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	97.92
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	97.92
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	97.92
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	97.81
2ea5_A		68	Cell growth regulator with ring finger domain prot	97.73
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	97.69
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	97.65
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	97.55
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	97.24
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	97.1
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	96.92
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	96.17
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	95.43
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	94.09
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	94.03
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	93.3
3nw0_A		238	Non-structural maintenance of chromosomes element	92.89
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	92.11
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	91.34
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	91.33
3bas_A		89	Myosin heavy chain, striated muscle/general contro	90.98
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	90.18
2w83_C		77	C-JUN-amino-terminal kinase-interacting protein 4;	89.72
3mq9_A		471	Bone marrow stromal antigen 2 fused to maltose-BI	89.25
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	89.23
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	88.33
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	86.73
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	86.62
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	84.79
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	84.03
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	82.49
2kwj_A		114	Zinc finger protein DPF3; acetyl-lysine, transcrip	81.1
4h22_A		103	Leucine-rich repeat flightless-interacting protei;	80.93
3s4r_A		93	Vimentin; alpha-helix, cytoskeleton, intermediate	80.66

>2i50_A Ubiquitin carboxyl-terminal hydrolase 16; alpha/beta zinc-finger, ring-finger, ZNF-UBP, metalloprotein, ubiquitin-binding protein, USP; NMR {Homo sapiens}	Back alignment and structure

Probab=99.82  E-value=3.6e-22  Score=171.30  Aligned_cols=108  Identities=28%  Similarity=0.520  Sum_probs=89.4

Q ss_pred             eeecCCCcccchhhhccc-------cccCCCccccccCCCCCcccccCcccceeeecccccccccCC-CCcccccccCC-
Q 016340           92 LSTICDHSFQCSCTAKWT-------VLSCQVCRFCHQQDERPTCSVCGTVENLWVCLICGFVGCGRY-KEGHAVRHWKD-  162 (391)
Q Consensus        92 it~~C~H~F~~~Cl~~w~-------~~~CP~Cr~~~~~~~~~~C~~C~~~~~lwiCL~CG~vgCgr~-~~~HA~~H~~~-  162 (391)
                      +...|.|.++..++..|.       ...|+.|+... ......+.+|....++|+||+||+|||||+ .++||..||++ 
T Consensus         3 ~~~~C~H~~~~~~l~~~~~~~~~~~~~~C~~C~~~~-~~~~~~~~~~~~~~~Lw~CL~CG~vgCgr~~~~~Ha~~H~~~~   81 (126)
T 2i50_A            3 HMPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDN-KVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTP   81 (126)
T ss_dssp             --CCCSCHHHHCCHHHHHHHHSSCCSSSCHHHHTCT-TSSCSSCTTTCCCCCEEEETTTCCEEECTTSSSCHHHHHHHSC
T ss_pred             CCCCCcChhhccccccccccccCCCCCcCccccccc-cccccccccccccccceeeeeCCccccCCCCcchHHHHHHhCc
Confidence            466799999988886663       25799998753 222344668888999999999999999998 58999999999 


Q ss_pred             --CCCcccccCCCceeEecCCchhhhhhhcccccCCeeccc
Q 016340          163 --TQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMN  201 (391)
Q Consensus       163 --t~H~~~~~l~t~~vwcy~cd~~Vhrl~~~k~dgklve~~  201 (391)
                        ++|+++++++|++||||.||+||+ ..+.+.++++|++.
T Consensus        82 ~~t~H~l~~~l~t~~vwCY~cd~~V~-~~~~~~l~~~v~~~  121 (126)
T 2i50_A           82 RSEPHCLVLSLDNWSVWCYVCDNEVQ-YCSSNQLGQVVDYV  121 (126)
T ss_dssp             CSSCCCEEEETTTCCEEETTTTEEEC-CCTTSHHHHHHHHH
T ss_pred             CCCCCcEEEECCCCeEEeCCCCcEEE-cCcchhHHHHHHHH
Confidence              899999999999999999999998 56678888888764

PyMOL of 2i50

>2g45_A Ubiquitin carboxyl-terminal hydrolase 5; zinc finger, hydrolase; 1.99A {Homo sapiens} SCOP: g.44.1.5 PDB: 2g43_A 2l80_A	Back alignment and structure

>3c5k_A HD6, histone deacetylase 6; HDAC6, zinc finger, actin-binding, chromatin regulator, cytoplasm, hydrolase, metal-binding, nucleus, phosphoprotein; 1.55A {Homo sapiens} PDB: 3gv4_A 3phd_A	Back alignment and structure

>2ida_A Hypothetical protein; zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} SCOP: g.44.1.5	Back alignment and structure

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens}	Back alignment and structure

>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens}	Back alignment and structure

>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli}	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A*	Back alignment and structure

>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens}	Back alignment and structure

>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		391
d2uzga1		95	g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hy	3e-20
d2g45a1		113	g.44.1.5 (A:173-285) Ubiquitin carboxyl-terminal h	4e-18
d2idaa1		102	g.44.1.5 (A:1-102) Hypothetical protein RPA1320 {R	4e-15
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	5e-05
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	6e-05
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	0.001
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	0.001
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	0.002
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	0.003
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	0.003

>d2uzga1 g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {Human (Homo sapiens) [TaxId: 9606]} Length = 95	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Zf-UBP
domain: Ubiquitin carboxyl-terminal hydrolase 33, UBP33
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 82.3 bits (203), Expect = 3e-20
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 113 CQVCRFCHQQDERPTCSVCG-TVENLWVCL--ICGFVGCGRYKEGHAVRHWKDTQHWYSL 169
            ++ +    Q    TC  C     NLW CL   C +VGCG  +  H+  H ++T+H+ ++
Sbjct: 11  GEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTV 70

Query: 170 DLRTQQIWDYVGDNYVH 186
           +L T ++W Y     V 
Sbjct: 71  NLTTLRVWCYACSKEVF 87

PyMOL of d2uzga1

>d2g45a1 g.44.1.5 (A:173-285) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 113	Back information, alignment and structure

>d2idaa1 g.44.1.5 (A:1-102) Hypothetical protein RPA1320 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 102	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		391
d2g45a1		113	Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Hum	99.7
d2uzga1		95	Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {H	99.7
d2idaa1		102	Hypothetical protein RPA1320 {Rhodopseudomonas pal	99.58
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	98.91
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.79
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.75
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.72
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.69
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	98.67
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	98.65
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.61
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	98.59
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	98.51
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	98.47
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	98.36
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.32
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.29
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.14
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	97.78
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	97.18
d1gs9a_		144	Apolipoprotein E {Human (Homo sapiens), E4 [TaxId:	83.42
d1wila_		89	Hypothetical protein KIAA1045 {Human (Homo sapiens	82.02

>d2g45a1 g.44.1.5 (A:173-285) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Zf-UBP
domain: Ubiquitin carboxyl-terminal hydrolase 5, UBP5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.70  E-value=6.9e-19  Score=145.83  Aligned_cols=65  Identities=34%  Similarity=0.571  Sum_probs=59.6

Q ss_pred             CCCCCcccccCcccceeeecccccccccCCC------CcccccccCCCCCcccccCCC-----ceeEecCCchhhh
Q 016340          122 QDERPTCSVCGTVENLWVCLICGFVGCGRYK------EGHAVRHWKDTQHWYSLDLRT-----QQIWDYVGDNYVH  186 (391)
Q Consensus       122 ~~~~~~C~~C~~~~~lwiCL~CG~vgCgr~~------~~HA~~H~~~t~H~~~~~l~t-----~~vwcy~cd~~Vh  186 (391)
                      +|..++|.+|+...++|+||+||++|||||.      ++||..||++++|++++.+.|     .+||||.||+||.
T Consensus        21 ~p~~~~C~~C~~~~~lWlCL~CG~vgCgR~~~~~~~~~~HA~~H~~~t~H~l~v~l~t~~~~~~~vwCY~cd~~V~   96 (113)
T d2g45a1          21 PPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVL   96 (113)
T ss_dssp             CCCBCCCSSSSCCSSEEEETTTCCEEECCBCTTSCBCCSHHHHHHHHHCCCEEEETTCCBTTBCCEEETTTTEEEE
T ss_pred             CCCCCcccCCCCcCCEEEEecCCCCccCcccccCCCCChHHHHHHHhcCCCEEEEecCCCCCCceEEEecCCCEEE
Confidence            4567899999999999999999999999985      789999999999999999876     5799999999995

PyMOL of d2g45a1

>d2uzga1 g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2idaa1 g.44.1.5 (A:1-102) Hypothetical protein RPA1320 {Rhodopseudomonas palustris [TaxId: 1076]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]}	Back information, alignment and structure

>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure