Citrus Sinensis ID: 016418


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MASGFWELRPLLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQFFLVETVESAPRKDQESSGLKKAVNVLDRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQSISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLSCACMLDTEENSTNDEREDIEEPLISHT
cccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHccccccccccccccccHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc
masgfwelRPLLHLLLPLCVHWVAEAMTVSVLVDVVTnalcpgqptcseAIYISGLQQTVVGVFKMVVLPLLGQladeygrkpllLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQFFLVEtvesaprkdqessglKKAVNVLDRRYKSMRDAALMvvssptlrgiSFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKasglnnqgkaqgFIAGVQSISSLlsplamspltswflstdapfnckgFSIIVASICLMVSLSCAcmldteenstnderedieeplisht
MASGFWELRPLLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQFFLVETVesaprkdqessglkkavnvLDRRYKSMRDAALmvvssptlrgISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQSISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLSCACMLDTeenstnderedieeplisht
MASGFWElrpllhlllplCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQFFLVETVESAPRKDQESSGLKKAVNVLDRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQsissllsplamspltsWFLSTDAPFNCKGFSIIVASICLMVSLSCACMLDTEENSTNDEREDIEEPLISHT
***GFWELRPLLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQFFLVETV****************VNVLDRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQSISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLSCACMLD*********************
**********LLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQFFLVETVESAPRKDQESSGLKKAVNV**********AALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKAS****QGKAQGFIAGVQSISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLSCA*************************
MASGFWELRPLLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQFFLVETVE************KKAVNVLDRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQSISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLSCACMLDT********************
**SGFWELRPLLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQFFLVETVESAPRKDQESSGLKKAVNVLDRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQSISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLSCACMLDTE*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASGFWELRPLLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQFFLVETVESAPRKDQESSGLKKAVNVLDRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQSISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLSCACMLDTEENSTNDEREDIEEPLISHT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query390 2.2.26 [Sep-21-2011]
Q5SR56506 Hippocampus abundant tran yes no 0.682 0.525 0.244 3e-10
B2RYH9507 Hippocampus abundant tran yes no 0.682 0.524 0.244 4e-10
A4IF94502 Hippocampus abundant tran yes no 0.664 0.515 0.245 5e-10
Q8CIA9507 Hippocampus abundant tran yes no 0.684 0.526 0.248 7e-10
P70187490 Hippocampus abundant tran no no 0.671 0.534 0.232 1e-08
Q96MC6490 Hippocampus abundant tran no no 0.671 0.534 0.232 2e-08
>sp|Q5SR56|HIAL1_HUMAN Hippocampus abundant transcript-like protein 1 OS=Homo sapiens GN=HIATL1 PE=2 SV=3 Back     alignment and function desciption
 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 134/323 (41%), Gaps = 57/323 (17%)

Query: 53  ISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLL------------- 99
           ++GL Q V G+   +  PL+G L+D +GRKP LL TV  T  P  L+             
Sbjct: 81  MNGLIQGVKGLLSFLSAPLIGALSDVWGRKPFLLGTVFFTCFPIPLMRISPWWYFAMISV 140

Query: 100 --AFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYAVSIALLIFVPVYMQ--------- 148
              F+ +   ++AY    T  +  S  +   ++  +A S+     +  Y+          
Sbjct: 141 SGVFSVTFSVIFAYVADVTQEHERST-AYGWVSATFAASLVSSPAIGAYLSASYGDSLVV 199

Query: 149 ------------FFLVETVESAPRKDQESS-GLK---KAVNVLDRRYKSMRDAALMVVSS 192
                       F LV   ES P K +  S G +   K  +      K  +D+ +++   
Sbjct: 200 LVATVVALLDICFILVAVPESLPEKMRPVSWGAQISWKQADPFASLKKVGKDSTVLL--- 256

Query: 193 PTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQ-----I 247
                I    F   L  +G  +    YL+ V GF   + +  + MVGI SIV+Q     I
Sbjct: 257 -----ICITVFLSYLPEAGQYSSFFLYLRQVIGFGSVKIAAFIAMVGILSIVAQTAFLSI 311

Query: 248 LVLPLLNPFVALLA---SIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKASG 304
           L+  L N    LL     +    +YG    +W+ + + +   +  +  P+  A++S+ + 
Sbjct: 312 LMRSLGNKNTVLLGLGFQMLQLAWYGFGSQAWMMWAAGTVAAMSSITFPAISALVSRNAE 371

Query: 305 LNNQGKAQGFIAGVQSISSLLSP 327
            + QG AQG I G++ + + L P
Sbjct: 372 SDQQGVAQGIITGIRGLCNGLGP 394





Homo sapiens (taxid: 9606)
>sp|B2RYH9|HIAL1_RAT Hippocampus abundant transcript-like protein 1 OS=Rattus norvegicus GN=Hiatl1 PE=2 SV=1 Back     alignment and function description
>sp|A4IF94|HIAL1_BOVIN Hippocampus abundant transcript-like protein 1 OS=Bos taurus GN=HIATL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8CIA9|HIAL1_MOUSE Hippocampus abundant transcript-like protein 1 OS=Mus musculus GN=Hiatl1 PE=2 SV=3 Back     alignment and function description
>sp|P70187|HIAT1_MOUSE Hippocampus abundant transcript 1 protein OS=Mus musculus GN=Hiat1 PE=2 SV=3 Back     alignment and function description
>sp|Q96MC6|HIAT1_HUMAN Hippocampus abundant transcript 1 protein OS=Homo sapiens GN=HIAT1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
255568024443 Hippocampus abundant transcript 1 protei 0.992 0.873 0.707 1e-163
357442989441 Hippocampus abundant transcript-like pro 0.994 0.879 0.649 1e-156
357442987442 Hippocampus abundant transcript-like pro 0.994 0.877 0.623 1e-149
388504394442 unknown [Medicago truncatula] 0.994 0.877 0.621 1e-149
449446460444 PREDICTED: hippocampus abundant transcri 0.987 0.867 0.605 1e-146
449525958444 PREDICTED: hippocampus abundant transcri 0.987 0.867 0.603 1e-145
224097628413 predicted protein [Populus trichocarpa] 0.933 0.881 0.673 1e-145
356533921442 PREDICTED: hippocampus abundant transcri 0.951 0.839 0.646 1e-145
225464128435 PREDICTED: uncharacterized LOC100260232 0.943 0.845 0.652 1e-144
255568022442 Hippocampus abundant transcript 1 protei 0.905 0.798 0.661 1e-142
>gi|255568024|ref|XP_002524989.1| Hippocampus abundant transcript 1 protein, putative [Ricinus communis] gi|223535733|gb|EEF37396.1| Hippocampus abundant transcript 1 protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 309/437 (70%), Positives = 345/437 (78%), Gaps = 50/437 (11%)

Query: 3   SGFWELRPLLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVG 62
           SGF ELRPL+HLLLPL VHWVAE MTVSVLVDVVT ALCPGQ TC++AIYISGLQQ VVG
Sbjct: 8   SGFRELRPLVHLLLPLSVHWVAEQMTVSVLVDVVTAALCPGQSTCAQAIYISGLQQVVVG 67

Query: 63  VFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQSQEFVYAYYVLRTISYIIS 122
           +FKMVVLPLLGQLADEYGRKP LL+TVST+I PF LLA++QS+ FVYAYYVLRTISYI+S
Sbjct: 68  IFKMVVLPLLGQLADEYGRKPFLLLTVSTSIFPFALLAYDQSRGFVYAYYVLRTISYILS 127

Query: 123 QGSIFCIAVAYA-----------------------------------------VSIALLI 141
           QGSIFCI+VAYA                                         VSIALLI
Sbjct: 128 QGSIFCISVAYAADFVQEDKRAAVFSWMTGLFSASHVLGNILARFLPEKYIFLVSIALLI 187

Query: 142 FVPVYMQFFLVETVESAPRKDQESSGLKKAVNVLDRRYKSMRDAALMVVSSPTLRGISFV 201
           F P+YMQFFLVETVE A RKDQ S+ L K + V   RYKSMRDAA++V SSPTLRGISFV
Sbjct: 188 FGPIYMQFFLVETVERAQRKDQNSTFLTKIIKVFHTRYKSMRDAAIIVFSSPTLRGISFV 247

Query: 202 SFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPLLNPF----- 256
           SFFY+LGMSGI+AVLLFYLK+VFGFNKNQ+SEIL+MVGIG I SQIL+LPL+NP      
Sbjct: 248 SFFYELGMSGINAVLLFYLKSVFGFNKNQYSEILLMVGIGEIFSQILLLPLVNPLVGEKV 307

Query: 257 ---VALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKASGLNNQGKAQG 313
              +ALLASIAYA FYGLAWASWVPYLSASFG I+VLV PSTYAIISKAS   NQGKAQG
Sbjct: 308 ILCLALLASIAYAFFYGLAWASWVPYLSASFGAIFVLVTPSTYAIISKASSSMNQGKAQG 367

Query: 314 FIAGVQSISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASICLMVSLSCACMLDTEEN 373
           F+AGVQSI+SLLSPLAMSPLTSWFLS++APF+CKGFSIIVAS+C+MV+   ACML  E+ 
Sbjct: 368 FVAGVQSIASLLSPLAMSPLTSWFLSSNAPFDCKGFSIIVASLCMMVAFCYACMLKPEQE 427

Query: 374 STNDEREDIEEPLISHT 390
           + N E EDIE PLI+  
Sbjct: 428 TKNLE-EDIEAPLITDN 443




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357442989|ref|XP_003591772.1| Hippocampus abundant transcript-like protein [Medicago truncatula] gi|355480820|gb|AES62023.1| Hippocampus abundant transcript-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357442987|ref|XP_003591771.1| Hippocampus abundant transcript-like protein [Medicago truncatula] gi|355480819|gb|AES62022.1| Hippocampus abundant transcript-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388504394|gb|AFK40263.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449446460|ref|XP_004140989.1| PREDICTED: hippocampus abundant transcript-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449525958|ref|XP_004169983.1| PREDICTED: hippocampus abundant transcript-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224097628|ref|XP_002311018.1| predicted protein [Populus trichocarpa] gi|222850838|gb|EEE88385.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356533921|ref|XP_003535506.1| PREDICTED: hippocampus abundant transcript-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|225464128|ref|XP_002266084.1| PREDICTED: uncharacterized LOC100260232 [Vitis vinifera] gi|296087966|emb|CBI35249.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568022|ref|XP_002524988.1| Hippocampus abundant transcript 1 protein, putative [Ricinus communis] gi|223535732|gb|EEF37395.1| Hippocampus abundant transcript 1 protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
TAIR|locus:2039430446 MEE15 "maternal effect embryo 0.520 0.455 0.316 4.2e-46
TAIR|locus:2039440461 AT2G16980 [Arabidopsis thalian 0.476 0.403 0.338 1.3e-45
TAIR|locus:2039450456 AT2G16990 "AT2G16990" [Arabido 0.474 0.405 0.324 1.4e-44
TAIR|locus:2157592282 AT5G42210 "AT5G42210" [Arabido 0.502 0.695 0.328 7.3e-27
UNIPROTKB|I3LSQ8496 HIATL1 "Uncharacterized protei 0.476 0.375 0.246 3.3e-12
UNIPROTKB|E1C047431 E1C047 "Uncharacterized protei 0.458 0.415 0.257 4.7e-12
UNIPROTKB|F1PC94418 HIAT1 "Uncharacterized protein 0.458 0.428 0.252 4.5e-11
UNIPROTKB|F1S559462 LOC100622510 "Uncharacterized 0.458 0.387 0.252 6.2e-11
ZFIN|ZDB-GENE-030131-834493 hiat1a "hippocampus abundant t 0.464 0.367 0.275 6.3e-11
UNIPROTKB|A6QLP5490 HIAT1 "Uncharacterized protein 0.458 0.365 0.252 7.4e-11
TAIR|locus:2039430 MEE15 "maternal effect embryo arrest 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 283 (104.7 bits), Expect = 4.2e-46, Sum P(3) = 4.2e-46
 Identities = 67/212 (31%), Positives = 105/212 (49%)

Query:   174 VLDRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSE 233
             VL+ +Y S++D   ++ +S  L     V+FF     SG+ +  L++LKA FGFNKN F+E
Sbjct:   224 VLNTKYSSLKDMVSLIKNSTILVQTLVVTFFATFAQSGMQSAFLYFLKARFGFNKNDFAE 283

Query:   234 ILMMVGIGSIVSQILVLPLLNPFVA--------LLASIAYALFYGLAWASWVPYLSASFG 285
             ++++V I   +SQ+ +LP L   +         LL     A    ++W++WVPY +    
Sbjct:   284 LILLVTIIGSISQLFILPKLVSAIGERRVLSTGLLMDSVNAACLSVSWSAWVPYATTVLV 343

Query:   286 VIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQXXXXXXXXXXXXXXXXWFLSTDAPFN 345
              + + V PS   I S+  G   QGK QG I+GV+                 FLS  APF 
Sbjct:   344 PVTMFVMPSVCGIASRQVGPGEQGKVQGCISGVKSFSGVVAPFIYSPLTALFLSEKAPFY 403

Query:   346 CKGFSIIVASICLMVSLSCACML-DTEENSTN 376
               GFS++  +  LM+    + ++ D    S N
Sbjct:   404 FPGFSLLCVTFSLMIGFFLSLLIRDVPSPSMN 435


GO:0005215 "transporter activity" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0008493 "tetracycline transporter activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP
TAIR|locus:2039440 AT2G16980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039450 AT2G16990 "AT2G16990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157592 AT5G42210 "AT5G42210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSQ8 HIATL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C047 E1C047 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PC94 HIAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S559 LOC100622510 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-834 hiat1a "hippocampus abundant transcript 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLP5 HIAT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 3e-06
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 7e-05
pfam13347425 pfam13347, MFS_2, MFS/sugar transport protein 2e-04
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
 Score = 48.5 bits (116), Expect = 3e-06
 Identities = 30/154 (19%), Positives = 52/154 (33%), Gaps = 9/154 (5%)

Query: 193 PTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSIVSQILVLPL 252
             L  ++   F    G  G+   L  YL+ V G +  +   +L + G+G I+  +L   L
Sbjct: 175 RLLLLLALAFFLLSFGYYGLLTYLPLYLQEVLGLSAAEAGLLLSLFGLGGILGALLGGLL 234

Query: 253 LN---------PFVALLASIAYALFYGLAWASWVPYLSASFGVIYVLVKPSTYAIISKAS 303
            +             LLA++   L       + +       G       P+   + S+ +
Sbjct: 235 SDRLGRRRLLLLIGLLLAALGLLLLALAPSLALLLVALLLLGFGLGFAFPALLTLASELA 294

Query: 304 GLNNQGKAQGFIAGVQSISSLLSPLAMSPLTSWF 337
               +G A G      S+   L PL    L    
Sbjct: 295 PPEARGTASGLFNTFGSLGGALGPLLAGLLLDTG 328


MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated. Length = 352

>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|222060 pfam13347, MFS_2, MFS/sugar transport protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 390
PRK03545390 putative arabinose transporter; Provisional 99.97
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.97
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.97
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.96
PRK10489417 enterobactin exporter EntS; Provisional 99.96
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.96
PRK11663434 regulatory protein UhpC; Provisional 99.96
PRK11646400 multidrug resistance protein MdtH; Provisional 99.96
PRK05122399 major facilitator superfamily transporter; Provisi 99.96
PRK09874408 drug efflux system protein MdtG; Provisional 99.96
PRK03633381 putative MFS family transporter protein; Provision 99.96
TIGR00900365 2A0121 H+ Antiporter protein. 99.96
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.96
PRK09705393 cynX putative cyanate transporter; Provisional 99.96
PRK10642490 proline/glycine betaine transporter; Provisional 99.96
PRK10504471 putative transporter; Provisional 99.96
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.95
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.95
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.95
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.95
TIGR00893399 2A0114 d-galactonate transporter. 99.95
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.95
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.95
PRK12382392 putative transporter; Provisional 99.95
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.95
PRK11195393 lysophospholipid transporter LplT; Provisional 99.95
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.95
PRK10054395 putative transporter; Provisional 99.95
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.95
PRK12307426 putative sialic acid transporter; Provisional 99.95
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.95
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.95
PRK09952438 shikimate transporter; Provisional 99.95
TIGR00891405 2A0112 putative sialic acid transporter. 99.95
PRK11652394 emrD multidrug resistance protein D; Provisional 99.95
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.95
PRK10091382 MFS transport protein AraJ; Provisional 99.95
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.95
TIGR00897402 2A0118 polyol permease family. This family of prot 99.95
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.95
PRK03699394 putative transporter; Provisional 99.95
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.95
PRK09528420 lacY galactoside permease; Reviewed 99.94
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.94
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.94
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.94
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.94
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.94
TIGR00898505 2A0119 cation transport protein. 99.94
PLN00028476 nitrate transmembrane transporter; Provisional 99.93
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.93
KOG2615451 consensus Permease of the major facilitator superf 99.93
PRK15075434 citrate-proton symporter; Provisional 99.93
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.93
PRK15011393 sugar efflux transporter B; Provisional 99.93
TIGR00895398 2A0115 benzoate transport. 99.93
PRK03893496 putative sialic acid transporter; Provisional 99.93
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.93
PRK10133438 L-fucose transporter; Provisional 99.93
PRK11043401 putative transporter; Provisional 99.93
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.93
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.93
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.92
KOG2532466 consensus Permease of the major facilitator superf 99.92
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.92
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.92
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.92
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.92
PRK11010491 ampG muropeptide transporter; Validated 99.92
TIGR00896355 CynX cyanate transporter. This family of proteins 99.92
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.92
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.92
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.91
KOG1330493 consensus Sugar transporter/spinster transmembrane 99.91
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.91
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.91
PRK11902402 ampG muropeptide transporter; Reviewed 99.91
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.9
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.9
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.89
KOG0569485 consensus Permease of the major facilitator superf 99.89
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.88
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 99.88
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.88
COG0738422 FucP Fucose permease [Carbohydrate transport and m 99.87
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.87
PRK09848448 glucuronide transporter; Provisional 99.87
COG2270438 Permeases of the major facilitator superfamily [Ge 99.86
KOG3764464 consensus Vesicular amine transporter [Intracellul 99.86
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 99.86
PRK09669444 putative symporter YagG; Provisional 99.86
TIGR00901356 2A0125 AmpG-related permease. 99.86
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.86
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.85
PRK10429473 melibiose:sodium symporter; Provisional 99.85
PRK10207489 dipeptide/tripeptide permease B; Provisional 99.83
KOG2533495 consensus Permease of the major facilitator superf 99.82
COG2211467 MelB Na+/melibiose symporter and related transport 99.81
PF13347428 MFS_2: MFS/sugar transport protein 99.8
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.79
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 99.79
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 99.78
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 99.78
PRK11462460 putative transporter; Provisional 99.78
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 99.77
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.77
KOG0254513 consensus Predicted transporter (major facilitator 99.76
KOG2816463 consensus Predicted transporter ADD1 (major facili 99.76
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.74
TIGR00805 633 oat sodium-independent organic anion transporter. 99.74
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.68
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.68
KOG2325488 consensus Predicted transporter/transmembrane prot 99.68
PTZ00207591 hypothetical protein; Provisional 99.66
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 99.64
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.56
PRK10054 395 putative transporter; Provisional 99.54
KOG3762618 consensus Predicted transporter [General function 99.52
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.51
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.5
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.46
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.45
PRK10489 417 enterobactin exporter EntS; Provisional 99.44
TIGR00900 365 2A0121 H+ Antiporter protein. 99.43
KOG2563480 consensus Permease of the major facilitator superf 99.41
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.38
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.38
PRK03545 390 putative arabinose transporter; Provisional 99.37
PRK11663 434 regulatory protein UhpC; Provisional 99.37
PRK12382 392 putative transporter; Provisional 99.36
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 99.36
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.35
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.35
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.35
PRK05122 399 major facilitator superfamily transporter; Provisi 99.34
PRK03633 381 putative MFS family transporter protein; Provision 99.34
PRK10091 382 MFS transport protein AraJ; Provisional 99.34
PRK10504 471 putative transporter; Provisional 99.34
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.34
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.33
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.32
TIGR00891 405 2A0112 putative sialic acid transporter. 99.32
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.32
TIGR00893 399 2A0114 d-galactonate transporter. 99.32
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.32
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.31
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.31
PRK03699 394 putative transporter; Provisional 99.31
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.29
TIGR00895 398 2A0115 benzoate transport. 99.28
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.28
PRK11043 401 putative transporter; Provisional 99.28
PLN00028 476 nitrate transmembrane transporter; Provisional 99.27
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.27
PRK15011 393 sugar efflux transporter B; Provisional 99.27
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.25
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.24
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.24
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.24
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.23
PRK09874 408 drug efflux system protein MdtG; Provisional 99.23
PRK12307 426 putative sialic acid transporter; Provisional 99.22
PRK09528 420 lacY galactoside permease; Reviewed 99.22
PRK09705 393 cynX putative cyanate transporter; Provisional 99.21
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.21
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.2
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.2
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.2
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 99.19
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 99.19
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.19
PRK03893 496 putative sialic acid transporter; Provisional 99.19
KOG3764 464 consensus Vesicular amine transporter [Intracellul 99.18
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.18
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.18
KOG3626 735 consensus Organic anion transporter [Secondary met 99.16
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.14
KOG1330 493 consensus Sugar transporter/spinster transmembrane 99.13
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.13
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.13
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.13
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.12
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.1
PRK11902 402 ampG muropeptide transporter; Reviewed 99.1
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.1
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.08
PRK10133 438 L-fucose transporter; Provisional 99.06
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 99.06
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.06
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 99.05
PRK11010 491 ampG muropeptide transporter; Validated 99.05
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.05
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.01
TIGR00805 633 oat sodium-independent organic anion transporter. 98.98
TIGR00901 356 2A0125 AmpG-related permease. 98.98
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 98.97
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.97
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.97
PRK09952 438 shikimate transporter; Provisional 98.97
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.97
PRK10406 432 alpha-ketoglutarate transporter; Provisional 98.95
PRK15075 434 citrate-proton symporter; Provisional 98.94
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.92
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 98.88
PRK10642 490 proline/glycine betaine transporter; Provisional 98.86
PTZ00207 591 hypothetical protein; Provisional 98.85
TIGR00896 355 CynX cyanate transporter. This family of proteins 98.85
PRK10077 479 xylE D-xylose transporter XylE; Provisional 98.85
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.85
KOG2615 451 consensus Permease of the major facilitator superf 98.82
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.79
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.78
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 98.76
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 98.74
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 98.74
KOG4332454 consensus Predicted sugar transporter [Carbohydrat 98.74
TIGR00898 505 2A0119 cation transport protein. 98.72
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 98.71
PRK10429 473 melibiose:sodium symporter; Provisional 98.7
KOG3098461 consensus Uncharacterized conserved protein [Funct 98.69
KOG2532 466 consensus Permease of the major facilitator superf 98.68
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.67
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.67
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.61
PRK09669 444 putative symporter YagG; Provisional 98.59
KOG0637498 consensus Sucrose transporter and related proteins 98.57
PF13347 428 MFS_2: MFS/sugar transport protein 98.53
PF1283277 MFS_1_like: MFS_1 like family 98.49
PRK11462 460 putative transporter; Provisional 98.48
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.44
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.42
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.39
KOG0569 485 consensus Permease of the major facilitator superf 98.36
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 98.33
KOG3574510 consensus Acetyl-CoA transporter [Inorganic ion tr 98.31
TIGR00769472 AAA ADP/ATP carrier protein family. These proteins 98.27
COG2211 467 MelB Na+/melibiose symporter and related transport 98.25
KOG0254 513 consensus Predicted transporter (major facilitator 98.23
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 98.23
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.19
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 98.16
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 98.14
KOG3810433 consensus Micronutrient transporters (folate trans 98.11
KOG2533 495 consensus Permease of the major facilitator superf 98.11
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 98.11
COG2270438 Permeases of the major facilitator superfamily [Ge 98.08
PRK09848 448 glucuronide transporter; Provisional 98.0
KOG2325 488 consensus Predicted transporter/transmembrane prot 97.98
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.93
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 97.91
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 97.86
TIGR01272310 gluP glucose/galactose transporter. Disruption of 97.81
KOG0252 538 consensus Inorganic phosphate transporter [Inorgan 97.72
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.67
KOG2816 463 consensus Predicted transporter ADD1 (major facili 97.59
KOG0253 528 consensus Synaptic vesicle transporter SV2 (major 97.56
PF13000544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 97.54
COG0477338 ProP Permeases of the major facilitator superfamil 97.49
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 97.48
KOG2563 480 consensus Permease of the major facilitator superf 97.34
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 97.22
PF1283277 MFS_1_like: MFS_1 like family 97.2
KOG3880409 consensus Predicted small molecule transporter inv 97.18
KOG3762618 consensus Predicted transporter [General function 97.17
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 96.99
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 96.97
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 96.89
KOG1479406 consensus Nucleoside transporter [Nucleotide trans 96.84
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 96.68
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 96.67
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 96.62
PRK03612 521 spermidine synthase; Provisional 96.61
KOG4830412 consensus Predicted sugar transporter [Carbohydrat 96.6
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 96.6
KOG3626 735 consensus Organic anion transporter [Secondary met 96.41
KOG3574 510 consensus Acetyl-CoA transporter [Inorganic ion tr 96.32
PF03219491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 96.19
COG0477 338 ProP Permeases of the major facilitator superfamil 96.1
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 95.92
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 95.38
COG3202509 ATP/ADP translocase [Energy production and convers 95.15
KOG1237571 consensus H+/oligopeptide symporter [Amino acid tr 95.11
KOG2601 503 consensus Iron transporter [Inorganic ion transpor 94.73
KOG0637 498 consensus Sucrose transporter and related proteins 93.53
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 92.07
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 88.43
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 88.27
KOG3098 461 consensus Uncharacterized conserved protein [Funct 87.95
PRK11588506 hypothetical protein; Provisional 86.69
TIGR03644404 marine_trans_1 probable ammonium transporter, mari 85.92
PF0861197 DUF1774: Fungal protein of unknown function (DUF17 85.68
COG5336116 Uncharacterized protein conserved in bacteria [Fun 81.3
KOG4332 454 consensus Predicted sugar transporter [Carbohydrat 80.55
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 80.49
COG5336116 Uncharacterized protein conserved in bacteria [Fun 80.28
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
Probab=99.97  E-value=8e-28  Score=218.38  Aligned_cols=319  Identities=14%  Similarity=0.111  Sum_probs=220.3

Q ss_pred             chhHhHHHHHHHHHHHHHHHHhHHHHHHhhcCCCCCCcchhHHHHHHHHHHHHHHHHhHhhhhcccccccCCchHHHHHH
Q 016418           10 PLLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITV   89 (390)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~g~~~~~~~~~~~g~~~~~~~~~~~~~~~~~G~l~Dr~Grk~~l~~~~   89 (390)
                      .++.+.++.++.........+.+|.+.++.   |.     +..+.|++.+.+.++..+++++.|+++||+|||+++..+.
T Consensus        10 ~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~---~~-----s~~~~g~~~~~~~~~~~~~~~~~g~l~dr~g~r~~~~~~~   81 (390)
T PRK03545         10 RVVTLALAAFIFNTTEFVPVGLLSDIAQSF---HM-----QTAQVGLMLTIYAWVVALMSLPLMLLTSNVERRKLLIGLF   81 (390)
T ss_pred             HHHHHHHHHHHHHhHHHHHHcchHHHHhHc---CC-----CHHHHHHHHHHHHHHHHHHHHHHHHHHcCCChHHHHHHHH
Confidence            344445555554444455666778776443   43     3466699999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhccCchhhHHHHHHHHHHhhcccchHHHHHHHHH-----------------------------------
Q 016418           90 STTIVPFTLLAFNQSQEFVYAYYVLRTISYIISQGSIFCIAVAYA-----------------------------------  134 (390)
Q Consensus        90 ~~~~i~~~~~~~~~~~~~~~~l~~~r~l~G~~~~g~~~~~~~~~i-----------------------------------  134 (390)
                      ++..++.+.+++++|   ++.+++.|+++|+ +.+...+...+++                                   
T Consensus        82 ~~~~~~~~~~~~~~~---~~~l~~~r~~~G~-~~~~~~~~~~~~i~~~~~~~~r~~~~g~~~~~~~~g~~ig~~l~~~l~  157 (390)
T PRK03545         82 VLFIASHVLSALAWN---FTVLLISRIGIAF-AHAIFWSITASLAIRVAPAGKKAQALSLLATGTALAMVLGLPLGRVIG  157 (390)
T ss_pred             HHHHHHHHHHHHhcc---HHHHHHHHHHHHH-HHHHHHHHHHHHHHHhCChhhhhhHHHHHHHHHHHHHHHHhhHHHHHH
Confidence            999999999999999   9999999999999 5466666666665                                   


Q ss_pred             ----------HHHHHHHHHHHHHHHhcccCCCCCcccccccccccccccccccccccHHHHHHhhhcCcchhHHHHHHHH
Q 016418          135 ----------VSIALLIFVPVYMQFFLVETVESAPRKDQESSGLKKAVNVLDRRYKSMRDAALMVVSSPTLRGISFVSFF  204 (390)
Q Consensus       135 ----------~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  204 (390)
                                +.+++.++..+.....+||++++++  +                  +. +..++.+|+|.++......++
T Consensus       158 ~~~gw~~~f~~~~~~~~l~~~~~~~~~~~~~~~~~--~------------------~~-~~~~~~~~~~~~~~~~~~~~~  216 (390)
T PRK03545        158 QYLGWRTTFLAIGGGALITLLLLIKLLPLLPSEHS--G------------------SL-KSLPLLFRRPALVSLYLLTVV  216 (390)
T ss_pred             HHhcHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCc--c------------------hH-HHHHHHHhCcHHHHHHHHHHH
Confidence                      2222233333333334454322100  0                  11 113456678888776666666


Q ss_pred             HHHHhhhHHHHHHHHHhhhcCCCchhHHHHHHHHHHHH---HHHHHHHHhhHHHHH---HHHHHHHHHH-hHhcccchhH
Q 016418          205 YKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGS---IVSQILVLPLLNPFV---ALLASIAYAL-FYGLAWASWV  277 (390)
Q Consensus       205 ~~~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~---~~~~~~~~~~~~~~~---~~~~~~~~~~-~~~~~~~~~~  277 (390)
                      .........++.+.++++..|.++.+.+.+....++.+   ....+++.||.+||.   +......... .....++.+.
T Consensus       217 ~~~~~~~~~~~~~~~l~~~~g~s~~~~~~~~~~~~~~~~~g~~~~g~l~dr~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  296 (390)
T PRK03545        217 VVTAHFTAYSYIEPFVQQVAGLSENFATLLLLLFGGAGIIGSVLFSRLGNRHPSGFLLIAIALLLVCLLLLLPAANSEWH  296 (390)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCCccHHHHHHHHHHHHHHHHHHHHHHHhhccchhHHHHHHHHHHHHHHHHHHHhchHHH
Confidence            66666666778888888878999988888766555443   345578889988776   3232333322 2233444444


Q ss_pred             HH-HHHHHHHHHhhhHHHHHHHHhhccCCCchhhHHHHHHHHHHHHHhhhhhhhhhhhcccccCCCCCCCCchHHHHHHH
Q 016418          278 PY-LSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQSISSLLSPLAMSPLTSWFLSTDAPFNCKGFSIIVASI  356 (390)
Q Consensus       278 ~~-~~~~~g~~~~~~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~~~~~~g~~~~g~l~~~~~~~~~~~~~~~~~~~~~~~  356 (390)
                      .+ ..++.|++.....+...+.+.+..| +++++++|+.+...++|..+||.++|.++|.. +++.       .+.+.+.
T Consensus       297 ~~~~~~l~g~~~~~~~~~~~~~~~~~~~-~~~~~~~g~~~~~~~~g~~~G~~~~G~~~~~~-g~~~-------~~~~~~~  367 (390)
T PRK03545        297 LSVLSIFWGIAIMCIGLAMQVKVLKLAP-DATDVAMALFSGIFNIGIGAGALLGNQVSLHL-GLSS-------IGYVGAA  367 (390)
T ss_pred             HHHHHHHHHHHHhcchHHHHHHHHHhCC-CcHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc-ChhH-------HHHHHHH
Confidence            44 5567788777777777788888877 68899999999999999999999999999987 6665       3355556


Q ss_pred             HHHHHHHhhhcccc
Q 016418          357 CLMVSLSCACMLDT  370 (390)
Q Consensus       357 ~~~~~~~~~~~~~~  370 (390)
                      +.+++.+......+
T Consensus       368 ~~~~~~~~~~~~~~  381 (390)
T PRK03545        368 LALAALVWSILIFR  381 (390)
T ss_pred             HHHHHHHHHHHHcc
Confidence            66665555544443



>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG3810 consensus Micronutrient transporters (folate transporter family) [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG3880 consensus Predicted small molecule transporter involved in cellular pH homeostasis (Batten disease protein in human) [General function prediction only] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG1479 consensus Nucleoside transporter [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG4830 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>KOG1237 consensus H+/oligopeptide symporter [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2601 consensus Iron transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03644 marine_trans_1 probable ammonium transporter, marine subtype Back     alignment and domain information
>PF08611 DUF1774: Fungal protein of unknown function (DUF1774); InterPro: IPR013920 This is a fungal protein of unknown function Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 100.0
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.97
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.96
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.96
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.95
2cfq_A417 Lactose permease; transport, transport mechanism, 99.94
2xut_A 524 Proton/peptide symporter family protein; transport 99.89
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.52
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.51
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.49
2xut_A 524 Proton/peptide symporter family protein; transport 99.45
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.43
2cfq_A 417 Lactose permease; transport, transport mechanism, 98.87
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 98.78
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=100.00  E-value=5.5e-31  Score=242.81  Aligned_cols=337  Identities=13%  Similarity=0.058  Sum_probs=241.0

Q ss_pred             chhHhHHHHHHHHHHHHHHHHhHHHHHHhhcCCCCCCcchhHHHHHHHHHHHHHHHHhHhhhhcccccccCCchHHHHHH
Q 016418           10 PLLHLLLPLCVHWVAEAMTVSVLVDVVTNALCPGQPTCSEAIYISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITV   89 (390)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~g~~~~~~~~~~~g~~~~~~~~~~~~~~~~~G~l~Dr~Grk~~l~~~~   89 (390)
                      .+..+....+...+..+...+.+|.+.++        . .+..+.|++.+++.++..++++++|+++||+|||+++..+.
T Consensus        29 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~-~s~~~~g~~~~~~~~~~~~~~~~~G~l~dr~g~r~~l~~~~   99 (451)
T 1pw4_A           29 IFLGIFFGYAAYYLVRKNFALAMPYLVEQ--------G-FSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGL   99 (451)
T ss_dssp             HHHHHHHHHHHHHHHHTSHHHHHHHTTSS--------T-TCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------h-ccHhHHHHHHHHHHHHHHHHHHhHHHHHHhcCchHHHHHHH
Confidence            34455566666666767777888866522        2 33455699999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHh----ccCchhhHHHHHHHHHHhhcccchHHHHHHHHH-------------------------------
Q 016418           90 STTIVPFTLLAF----NQSQEFVYAYYVLRTISYIISQGSIFCIAVAYA-------------------------------  134 (390)
Q Consensus        90 ~~~~i~~~~~~~----~~~~~~~~~l~~~r~l~G~~~~g~~~~~~~~~i-------------------------------  134 (390)
                      ++.+++.+++++    +++   ++.++++|+++|+ +.+...+...+++                               
T Consensus       100 ~~~~~~~~~~~~~~~~~~~---~~~l~~~~~l~G~-~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~~g~~~~  175 (451)
T 1pw4_A          100 ILAAAVMLFMGFVPWATSS---IAVMFVLLFLCGW-FQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLF  175 (451)
T ss_dssp             HHHHHHHHHHHHCHHHHSS---SSHHHHHHHHHHH-HHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHH
T ss_pred             HHHHHHHHHHHhhhhcccc---HHHHHHHHHHHHH-HhhhccchHHHHHHHHCCchhhhHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999    899   9999999999999 5566667777777                               


Q ss_pred             ---------------HHHHHHHHHHHHHHHhcccCCCCCccccccccccc--ccccccccccccHHHH-HHhhhcCcchh
Q 016418          135 ---------------VSIALLIFVPVYMQFFLVETVESAPRKDQESSGLK--KAVNVLDRRYKSMRDA-ALMVVSSPTLR  196 (390)
Q Consensus       135 ---------------~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~-~~~~~~~~~~~  196 (390)
                                     +.+++.++..++.++.+||++++.+.++.++.+++  .+.++..+++.+.++. .+..+++|.++
T Consensus       176 ~~l~~~~g~w~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  255 (451)
T 1pw4_A          176 LLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLW  255 (451)
T ss_dssp             HHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSSTTTCCCSCTTTCCC-------------CCTHHHHHHTSSCHHHH
T ss_pred             HHHHHHhccHHHHHHHHHHHHHHHHHHHHhhccCCHhhcCCCChhhhcccccccchhhhhcccccccchHHHHHcCHHHH
Confidence                           23334444445555677887655332211111110  0000011111122222 36677899999


Q ss_pred             HHHHHHHHHHHHhhhHHHHHHHHHhhhcCCCchhHHHHHHHHHHHHH---HHHHHHHhhH--HHHH----HHHHHH-HHH
Q 016418          197 GISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMVGIGSI---VSQILVLPLL--NPFV----ALLASI-AYA  266 (390)
Q Consensus       197 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~---~~~~~~~~~~--~~~~----~~~~~~-~~~  266 (390)
                      ...+..++..........+.|.|+++.+|+++.+.+.+....++...   +..+++.||+  +||.    +..+.. ++.
T Consensus       256 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~~~  335 (451)
T 1pw4_A          256 YIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIAT  335 (451)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHBTTBSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCchhHHHHHHHHHHHHH
Confidence            99999999999999999999999999889999988888766655444   4558899998  8777    222322 455


Q ss_pred             HhHhccc--chhHHH-HHHHHHHHHhhhHHHHHHHHhhccCCCchhhHHHHHHHHHHH-HHhhhhhhhhhhhcccccCCC
Q 016418          267 LFYGLAW--ASWVPY-LSASFGVIYVLVKPSTYAIISKASGLNNQGKAQGFIAGVQSI-SSLLSPLAMSPLTSWFLSTDA  342 (390)
Q Consensus       267 ~~~~~~~--~~~~~~-~~~~~g~~~~~~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~~-~~~~g~~~~g~l~~~~~~~~~  342 (390)
                      +.+...+  +.+... ..++.|++.+...+...++..|..|+++||+++|+.+...++ |..++|.+.|.+.+.. ++..
T Consensus       336 ~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~~~~~~~g~l~~~~-g~~~  414 (451)
T 1pw4_A          336 IVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFF-GWDG  414 (451)
T ss_dssp             HHTTSCCTTCHHHHHHHHHHHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSS-CSHH
T ss_pred             HHHHHhcccCHHHHHHHHHHHHHHHhchHHHHHHHHHHHhchhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhc-CcHH
Confidence            5555543  344443 556778888888888899999999999999999999999999 9999999999999976 5444


Q ss_pred             CCCCCchHHHHHHHHHHHHHHhhhc
Q 016418          343 PFNCKGFSIIVASICLMVSLSCACM  367 (390)
Q Consensus       343 ~~~~~~~~~~~~~~~~~~~~~~~~~  367 (390)
                             .+.+.+++.+++.+....
T Consensus       415 -------~~~~~~~~~~~~~~~~~~  432 (451)
T 1pw4_A          415 -------GFMVMIGGSILAVILLIV  432 (451)
T ss_dssp             -------HHHHHHHHHHHHHHHHHH
T ss_pred             -------HHHHHHHHHHHHHHHHHH
Confidence                   345555555555544443



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.97
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.96
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.44
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.09
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.97  E-value=1.2e-29  Score=231.26  Aligned_cols=286  Identities=14%  Similarity=0.044  Sum_probs=203.2

Q ss_pred             HHHHHHHHHHHHHHHhHhhhhcccccccCCchHHHHHHHHHHHHHHHHHhcc----CchhhHHHHHHHHHHhhcccchHH
Q 016418           52 YISGLQQTVVGVFKMVVLPLLGQLADEYGRKPLLLITVSTTIVPFTLLAFNQ----SQEFVYAYYVLRTISYIISQGSIF  127 (390)
Q Consensus        52 ~~~g~~~~~~~~~~~~~~~~~G~l~Dr~Grk~~l~~~~~~~~i~~~~~~~~~----~~~~~~~l~~~r~l~G~~~~g~~~  127 (390)
                      .+.|++.+++.++..++++++|+++||+|||+++..+.++.+++.+++++++    +   ++.+++.|++.|+ +.+...
T Consensus        59 ~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~g~-~~~~~~  134 (447)
T d1pw4a_          59 GDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSS---IAVMFVLLFLCGW-FQGMGW  134 (447)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSS---SSHHHHHHHHHHH-HHHHTH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhhhh---HHHHHHHHHHHHH-hhhhhh
Confidence            4459999999999999999999999999999999999999999998888764    5   7889999999999 546666


Q ss_pred             HHHHHHH----------------------------------------------HHHHHHHHHHHHHHHhcccCCCCCccc
Q 016418          128 CIAVAYA----------------------------------------------VSIALLIFVPVYMQFFLVETVESAPRK  161 (390)
Q Consensus       128 ~~~~~~i----------------------------------------------~~~~~~~~~~~~~~~~~~e~~~~~~~~  161 (390)
                      +...+++                                              +.+.+..+..++.+...+|++++....
T Consensus       135 ~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  214 (447)
T d1pw4a_         135 PPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQSCGLP  214 (447)
T ss_dssp             HHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSSTTTCCC
T ss_pred             hHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcccchhhcccc
Confidence            6666666                                              444555555566666677765544332


Q ss_pred             cccccccc---ccccccccccccHHHHHHhhhcCcchhHHHHHHHHHHHHhhhHHHHHHHHHhhhcCCCchhHHHHHHHH
Q 016418          162 DQESSGLK---KAVNVLDRRYKSMRDAALMVVSSPTLRGISFVSFFYKLGMSGISAVLLFYLKAVFGFNKNQFSEILMMV  238 (390)
Q Consensus       162 ~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~~~  238 (390)
                      +.++.+++   +..++..++....+...+..+++|.++......++..........+.+.|+++.++.+..+.+......
T Consensus       215 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  294 (447)
T d1pw4a_         215 PIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLY  294 (447)
T ss_dssp             SCTTTCCC-------------CCTHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHBTTBSCCCHHHHHHHHHHH
T ss_pred             hhhhhhhhcccchhhccccccchhhHHHHHHHcCchHHHHHHHhhhhhhhhhcchhhhhhhcccccccccchhhhhhhcc
Confidence            22111111   111111112223333456778899999999888998888899999999999999899998888776555


Q ss_pred             HHH---HHHHHHHHHhhHHHHH----H---HHHHHHHHHhHhc--ccchhHHH-HHHHHHHHHhhhHHHHHHHHhhccCC
Q 016418          239 GIG---SIVSQILVLPLLNPFV----A---LLASIAYALFYGL--AWASWVPY-LSASFGVIYVLVKPSTYAIISKASGL  305 (390)
Q Consensus       239 ~~~---~~~~~~~~~~~~~~~~----~---~~~~~~~~~~~~~--~~~~~~~~-~~~~~g~~~~~~~~~~~~~~~~~~~~  305 (390)
                      .+.   +.+..+++.||.+|+.    .   .............  ..+.+... ..++.|++.+...+....+..|..|+
T Consensus       295 ~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~p~  374 (447)
T d1pw4a_         295 EYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPK  374 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHHHHTTSCCTTCHHHHHHHHHHHHHHHTHHHHHHHHHHHHTSCT
T ss_pred             hhhhhhhhhhhhhhhhhccccccccccchhHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCH
Confidence            443   4456688899887654    1   1111222222222  22344443 45667777778888888999999999


Q ss_pred             CchhhHHHHHHHHHHH-HHhhhhhhhhhhhcccccCCC
Q 016418          306 NNQGKAQGFIAGVQSI-SSLLSPLAMSPLTSWFLSTDA  342 (390)
Q Consensus       306 ~~~g~~~g~~~~~~~~-~~~~g~~~~g~l~~~~~~~~~  342 (390)
                      +.||++.|+.+...++ |..++|.+.|.+.|.. ++..
T Consensus       375 ~~~g~~~g~~~~~~~~~g~~~~~~~~g~~~~~~-g~~~  411 (447)
T d1pw4a_         375 KAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFF-GWDG  411 (447)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSS-CSHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh-ChHH
Confidence            9999999999998887 5667899999999976 5443



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure