Citrus Sinensis ID: 016420
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 390 | ||||||
| 255567196 | 389 | ubiquitin-protein ligase, putative [Rici | 0.997 | 1.0 | 0.687 | 1e-153 | |
| 224140835 | 374 | predicted protein [Populus trichocarpa] | 0.902 | 0.941 | 0.660 | 1e-128 | |
| 18397984 | 395 | F-box/LRR-repeat protein 12 [Arabidopsis | 0.982 | 0.969 | 0.606 | 1e-127 | |
| 297829306 | 394 | F-box family protein [Arabidopsis lyrata | 0.979 | 0.969 | 0.608 | 1e-127 | |
| 356520324 | 388 | PREDICTED: F-box/LRR-repeat protein 12-l | 0.969 | 0.974 | 0.604 | 1e-122 | |
| 125533996 | 381 | hypothetical protein OsI_35725 [Oryza sa | 0.923 | 0.944 | 0.462 | 6e-90 | |
| 115485015 | 381 | Os11g0264200 [Oryza sativa Japonica Grou | 0.923 | 0.944 | 0.462 | 6e-90 | |
| 357156953 | 381 | PREDICTED: F-box/LRR-repeat protein 12-l | 0.920 | 0.942 | 0.455 | 5e-89 | |
| 242070489 | 386 | hypothetical protein SORBIDRAFT_05g00653 | 0.935 | 0.945 | 0.437 | 7e-82 | |
| 40850582 | 313 | F-box-like protein [Musa acuminata] | 0.723 | 0.900 | 0.531 | 8e-81 |
| >gi|255567196|ref|XP_002524579.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223536132|gb|EEF37787.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 547 bits (1409), Expect = e-153, Method: Compositional matrix adjust.
Identities = 268/390 (68%), Positives = 316/390 (81%), Gaps = 1/390 (0%)
Query: 1 MEGSSGDGKTSIMDLPDDCLCFIFQWLDCGTDCESFGLTCHRWLDIQNLCRRSVQFQCSF 60
M S DG TSIM L DDCL IFQWLDC +D ESFGLTC R LDIQN+ RRS+QFQCSF
Sbjct: 1 MVDHSSDGPTSIMHLSDDCLSIIFQWLDCNSDRESFGLTCRRLLDIQNINRRSLQFQCSF 60
Query: 61 TLITCSSLSQPIIDIRSFHVGRLLTRFQHLNWLSLSGCTELPDSGLNQLQNYGSKLQTLY 120
T+ +SL Q + I SFH+ RLLTRFQHL++LSLSGCT+LPDS L LQ YGS+L +L+
Sbjct: 61 TIFNLTSLPQRSLFINSFHIHRLLTRFQHLHFLSLSGCTDLPDSALIPLQFYGSRLHSLH 120
Query: 121 LDCCFQITDNGLSVIATGCSSLTSISLYRCNVTDVGLEILASTCSTLMRVNLAYCLHISD 180
LDCCF +TDNGLS+I +GC LT ISLYRCN+TD+GLE LA+ CS L ++NL+YC +SD
Sbjct: 121 LDCCFGLTDNGLSLITSGCPYLTVISLYRCNITDIGLETLANGCSALKQINLSYCPLVSD 180
Query: 181 CGLRALSQGCSQLTAVRTSSCRTVTGIGFNGCSPTLAYIDAESCQLGPEGIIGIVSGGGL 240
CGLR++SQ C QL AV+ S CR ++G+GF GCSPTLAYIDAESC L P+G++GIVSGGGL
Sbjct: 181 CGLRSISQACCQLQAVKISCCREISGVGFTGCSPTLAYIDAESCNLDPKGVMGIVSGGGL 240
Query: 241 EFLNVSGMSSTLNGGGLAAIGTGFATRLKTLNLRMCRNVGDESIVAIAKGCPLLEEWNLS 300
E+LNVSG+S ++ G GLAAIG+GFA RLK LNLRMCR VGDES AIAKGCPLL+EWNL+
Sbjct: 241 EYLNVSGISWSIKGDGLAAIGSGFAARLKILNLRMCRTVGDESATAIAKGCPLLQEWNLA 300
Query: 301 LCHEVRFPGWASVGLNCNNLEKLHVNRCRNLCDRGLQALRDGCKQLLILYANKKNSRVSS 360
LCH V+ GW S+G CN LEKLHVNRCRNLCDRGLQALR+GCK L +LY N K+ RVSS
Sbjct: 301 LCHGVQISGWESIGFGCNRLEKLHVNRCRNLCDRGLQALREGCKMLSVLYLN-KSCRVSS 359
Query: 361 TAWELFKMYRGNVDIKDEEVMCIGPDWIAR 390
A ELFK+YRGNV+I++EEVMCIGP R
Sbjct: 360 NAIELFKLYRGNVEIREEEVMCIGPARTFR 389
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224140835|ref|XP_002323784.1| predicted protein [Populus trichocarpa] gi|222866786|gb|EEF03917.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|18397984|ref|NP_566312.1| F-box/LRR-repeat protein 12 [Arabidopsis thaliana] gi|30680350|ref|NP_850534.1| F-box/LRR-repeat protein 12 [Arabidopsis thaliana] gi|75207381|sp|Q9SRR1.1|FBL12_ARATH RecName: Full=F-box/LRR-repeat protein 12 gi|6041850|gb|AAF02159.1|AC009853_19 unknown protein [Arabidopsis thaliana] gi|26452863|dbj|BAC43510.1| unknown protein [Arabidopsis thaliana] gi|30793809|gb|AAP40357.1| putative F-box protein family, AtFBL12 [Arabidopsis thaliana] gi|332641038|gb|AEE74559.1| F-box/LRR-repeat protein 12 [Arabidopsis thaliana] gi|332641039|gb|AEE74560.1| F-box/LRR-repeat protein 12 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297829306|ref|XP_002882535.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297328375|gb|EFH58794.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356520324|ref|XP_003528813.1| PREDICTED: F-box/LRR-repeat protein 12-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|125533996|gb|EAY80544.1| hypothetical protein OsI_35725 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|115485015|ref|NP_001067651.1| Os11g0264200 [Oryza sativa Japonica Group] gi|62733985|gb|AAX96094.1| F-box protein family, AtFBL12, putative [Oryza sativa Japonica Group] gi|77549686|gb|ABA92483.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica Group] gi|113644873|dbj|BAF28014.1| Os11g0264200 [Oryza sativa Japonica Group] gi|125576796|gb|EAZ18018.1| hypothetical protein OsJ_33566 [Oryza sativa Japonica Group] gi|215704798|dbj|BAG94826.1| unnamed protein product [Oryza sativa Japonica Group] gi|215704804|dbj|BAG94832.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|357156953|ref|XP_003577632.1| PREDICTED: F-box/LRR-repeat protein 12-like [Brachypodium distachyon] gi|357156956|ref|XP_003577633.1| PREDICTED: F-box/LRR-repeat protein 12-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|242070489|ref|XP_002450521.1| hypothetical protein SORBIDRAFT_05g006530 [Sorghum bicolor] gi|241936364|gb|EES09509.1| hypothetical protein SORBIDRAFT_05g006530 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|40850582|gb|AAR96013.1| F-box-like protein [Musa acuminata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 390 | ||||||
| TAIR|locus:2079721 | 395 | AT3G07550 "AT3G07550" [Arabido | 0.982 | 0.969 | 0.606 | 1.7e-128 | |
| TAIR|locus:2166978 | 405 | AT5G23340 [Arabidopsis thalian | 0.843 | 0.812 | 0.291 | 5.4e-31 | |
| TAIR|locus:505006471 | 610 | AT4G15475 "AT4G15475" [Arabido | 0.689 | 0.440 | 0.284 | 3.3e-25 | |
| UNIPROTKB|F1NHD2 | 423 | FBXL2 "Uncharacterized protein | 0.776 | 0.716 | 0.286 | 5.3e-24 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.761 | 0.681 | 0.257 | 8.2e-23 | |
| UNIPROTKB|Q96IG2 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.761 | 0.681 | 0.257 | 8.2e-23 | |
| MGI|MGI:1919444 | 436 | Fbxl20 "F-box and leucine-rich | 0.761 | 0.681 | 0.257 | 8.2e-23 | |
| UNIPROTKB|Q17R01 | 400 | FBXL14 "F-box/LRR-repeat prote | 0.641 | 0.625 | 0.294 | 3e-22 | |
| MGI|MGI:2141676 | 400 | Fbxl14 "F-box and leucine-rich | 0.641 | 0.625 | 0.294 | 3e-22 | |
| RGD|1305523 | 400 | Fbxl14 "F-box and leucine-rich | 0.641 | 0.625 | 0.294 | 3e-22 |
| TAIR|locus:2079721 AT3G07550 "AT3G07550" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1261 (449.0 bits), Expect = 1.7e-128, P = 1.7e-128
Identities = 233/384 (60%), Positives = 302/384 (78%)
Query: 4 SSGDGKTSIMDLPDDCLCFIFQWLDCGTDCESFGLTCHRWLDIQNLCRRSVQFQCSFTLI 63
S + +TSI+ LPDDCL FIFQ LD D +SFGLTCHRWL+IQN+ RRS+QFQCSF+++
Sbjct: 7 SDNNVETSIIHLPDDCLSFIFQRLDSVADHDSFGLTCHRWLNIQNISRRSLQFQCSFSVL 66
Query: 64 TCSSLSQPIIDIRSFHVGRLLTRFQHLNWLSLSGCTELPDSGLNQLQNYGSKLQTLYLDC 123
SSLSQ D+ S H+ RLLTRFQ L LSLSGCT L DS L+ L+ G++L TLYLDC
Sbjct: 67 NPSSLSQTNPDVSSHHLHRLLTRFQWLEHLSLSGCTVLNDSSLDSLRYPGARLHTLYLDC 126
Query: 124 CFQITDNGLSVIATGCSSLTSISLYRCNVTDVGLEILASTCSTLMRVNLAYCLHISDCGL 183
CF I+D+G+S IA+ C +L+ +SLYRCN++D+GLE LA +L VNL+YC +SD G+
Sbjct: 127 CFGISDDGISTIASFCPNLSVVSLYRCNISDIGLETLARASLSLKCVNLSYCPLVSDFGI 186
Query: 184 RALSQGCSQLTAVRTSSCRTVTGIGFNGCSPTLAYIDAESCQLGPEGIIGIVSGGGLEFL 243
+ALSQ C QL +V+ S+C+++TG+GF+GCSPTL Y+DA+SCQL P+GI GI+SGGG+EFL
Sbjct: 187 KALSQACLQLESVKISNCKSITGVGFSGCSPTLGYVDADSCQLEPKGITGIISGGGIEFL 246
Query: 244 NVSGMSSTLNGGGLAAIGTGFATRLKTLNLRMCRNVGDESIVAIAKGCPLLEEWNLSLCH 303
N+SG+S + GL IG+G A++L+ LNLRMCR VGDESI AIAKGCPLL+EWNL+LCH
Sbjct: 247 NISGVSCYIRKDGLVPIGSGIASKLRILNLRMCRTVGDESIEAIAKGCPLLQEWNLALCH 306
Query: 304 EVRFPGWASVGLNCNNLEKLHVNRCRNLCDRGLQALRDGCKQLLILYANKKNSRVSSTAW 363
EV+ GW +VG C NL+KLHVNRCRNLCD+GL ALR GC L ILY N N+R++ TA
Sbjct: 307 EVKISGWEAVGKWCRNLKKLHVNRCRNLCDQGLLALRCGCMNLQILYMNG-NARLTPTAI 365
Query: 364 ELFKMYRGNVDIKDEEVMCIGPDW 387
E+F+++R ++ ++ EE+M IGPDW
Sbjct: 366 EMFRLHRADITLRTEEMMVIGPDW 389
|
|
| TAIR|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006471 AT4G15475 "AT4G15475" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q17R01 FBXL14 "F-box/LRR-repeat protein 14" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2141676 Fbxl14 "F-box and leucine-rich repeat protein 14" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305523 Fbxl14 "F-box and leucine-rich repeat protein 14" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 390 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 5e-14 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 1e-11 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 70.4 bits (173), Expect = 5e-14
Identities = 45/129 (34%), Positives = 63/129 (48%), Gaps = 6/129 (4%)
Query: 82 RLLTRFQHLNWLSLSGCTELPDSGLNQLQNYGSKLQTLYLDCCFQITDNGLSVIATGCSS 141
L+ L L L G + D GL L LQ L L C ITD+G+ +AT C
Sbjct: 46 DQLSNCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPK 105
Query: 142 LTSISLYRCN----VTDVGLEILASTCSTLMRVNLAYCLHISDCGLRALSQGCSQ-LTAV 196
L +I+L R +TDV L L C+ L V A C ++D G+ L+ GCS+ L +
Sbjct: 106 LQTINLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGC-DVTDKGVWELASGCSKSLERL 164
Query: 197 RTSSCRTVT 205
++CR +T
Sbjct: 165 SLNNCRNLT 173
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 390 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 100.0 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.95 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.88 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.71 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.65 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.64 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.58 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.55 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.55 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.51 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.45 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.37 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.37 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.32 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.22 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.22 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.16 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.15 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.99 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.88 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.86 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.81 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.77 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.68 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.66 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.63 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.56 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.53 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.51 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.46 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.41 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.39 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.37 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.31 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.27 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.2 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.15 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.99 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.92 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.89 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.83 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.66 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.64 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.63 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.36 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.36 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.35 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.28 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 97.24 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.16 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.15 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.06 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.03 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 97.01 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.97 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.56 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.54 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.33 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 96.32 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.31 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.24 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.17 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.1 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.09 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.02 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.89 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 95.83 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.58 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.43 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.25 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.17 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 94.92 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.86 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 94.81 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.58 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 93.89 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 93.11 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 91.97 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 91.19 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 90.45 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 89.44 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 89.33 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 89.26 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 87.68 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 86.4 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 85.14 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 83.1 | |
| PF09372 | 97 | PRANC: PRANC domain; InterPro: IPR018272 This pres | 80.43 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-36 Score=253.45 Aligned_cols=371 Identities=23% Similarity=0.374 Sum_probs=278.7
Q ss_pred cCCCCCHHHHHHHHhhCCCccchhHHhhhhhhhHhhccc--ccccee---eecccc-----------cccccCCCCcchh
Q 016420 11 SIMDLPDDCLCFIFQWLDCGTDCESFGLTCHRWLDIQNL--CRRSVQ---FQCSFT-----------LITCSSLSQPIID 74 (390)
Q Consensus 11 ~~~~LP~evl~~If~~L~~~~~~~~~~~vcr~w~~~~~~--~~~~~~---~~~~~~-----------~~~~~~l~~~~~~ 74 (390)
....||+|++..||++|+. ..+.+++++|+.|+..+.. .|-.+. +..+.. ...+..+..++..
T Consensus 71 ~~~~LPpEl~lkvFS~LDt-ksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG~r 149 (483)
T KOG4341|consen 71 ISRSLPPELLLKVFSMLDT-KSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRGCR 149 (483)
T ss_pred ccccCCHHHHHHHHHHHhH-HHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhccccccccccccc
Confidence 3457999999999999997 7888889999999986421 111111 111100 1112233333322
Q ss_pred -hhhhHHHHHHhhCCCccEEEecCCCCCChhHHHHHHHcCCCccEEEcCCCCCCChHHHHHHHHhCCCCCeEEeccc-cc
Q 016420 75 -IRSFHVGRLLTRFQHLNWLSLSGCTELPDSGLNQLQNYGSKLQTLYLDCCFQITDNGLSVIATGCSSLTSISLYRC-NV 152 (390)
Q Consensus 75 -~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~-~~ 152 (390)
+....+..+...+|++++|.+.+|..+++..+..+++.|++|++|++..|..+++..+..+.+.|++|+.|+++.| .+
T Consensus 150 ~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi 229 (483)
T KOG4341|consen 150 AVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQI 229 (483)
T ss_pred cCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchh
Confidence 2344555666777888888888888888877778888888888888888777788777777778888888888888 77
Q ss_pred ChHHHHHHHhcCcccceeeccCCCCCCHHHHHHHHHcCCCCCEEeccccCccCccccc---ccCCCCCeEEeeccC-CCh
Q 016420 153 TDVGLEILASTCSTLMRVNLAYCLHISDCGLRALSQGCSQLTAVRTSSCRTVTGIGFN---GCSPTLAYIDAESCQ-LGP 228 (390)
Q Consensus 153 ~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~---~~~~~L~~L~l~~~~-~~~ 228 (390)
+..+++.+.+++.+++.+...+|...+.+.+..+..+++.+..+++..|..+++..+. ..+..|+.|..+++. +.+
T Consensus 230 ~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~~d 309 (483)
T KOG4341|consen 230 SGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTDITD 309 (483)
T ss_pred hcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCCCch
Confidence 7777777777777777777777777777777777777777777777777777765542 223467888887765 666
Q ss_pred hhHHhhh-cCCCccEEEecCCccccccchhHhhhhccCCCccEEecCCCCCCChHHHHHHHhcCCCCceeecccccCCCh
Q 016420 229 EGIIGIV-SGGGLEFLNVSGMSSTLNGGGLAAIGTGFATRLKTLNLRMCRNVGDESIVAIAKGCPLLEEWNLSLCHEVRF 307 (390)
Q Consensus 229 ~~~~~l~-~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~ 307 (390)
..+..+. ..++|+.|.+.++.. .++.++..++. .++.|+.+++..|..+.+..+..+..+||.|+.|.+++|..++|
T Consensus 310 ~~l~aLg~~~~~L~~l~l~~c~~-fsd~~ft~l~r-n~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~lslshce~itD 387 (483)
T KOG4341|consen 310 EVLWALGQHCHNLQVLELSGCQQ-FSDRGFTMLGR-NCPHLERLDLEECGLITDGTLASLSRNCPRLRVLSLSHCELITD 387 (483)
T ss_pred HHHHHHhcCCCceEEEeccccch-hhhhhhhhhhc-CChhhhhhcccccceehhhhHhhhccCCchhccCChhhhhhhhh
Confidence 6666663 457888888888865 45566665554 47888889888888777777888888899999999998888888
Q ss_pred hHHHHHhh---cCCCCCeEEcccccccCchHHHHHHHcCCCCceeeccccCCcCChHHHHHHHhhcCceeEeecceeeeC
Q 016420 308 PGWASVGL---NCNNLEKLHVNRCRNLCDRGLQALRDGCKQLLILYANKKNSRVSSTAWELFKMYRGNVDIKDEEVMCIG 384 (390)
Q Consensus 308 ~~~~~l~~---~~~~L~~L~l~~~~~i~~~~~~~l~~~~~~L~~L~l~~~c~~l~~~~~~~l~~~~~~l~~~~~~~~~~~ 384 (390)
+++..+.. ....|+.+.+.+|+.+++..++.+. .|++|+.+++.+ |..++++++..++.++|++++..+......
T Consensus 388 ~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~l~-~c~~Leri~l~~-~q~vtk~~i~~~~~~lp~i~v~a~~a~~t~ 465 (483)
T KOG4341|consen 388 EGIRHLSSSSCSLEGLEVLELDNCPLITDATLEHLS-ICRNLERIELID-CQDVTKEAISRFATHLPNIKVHAYFAPVTP 465 (483)
T ss_pred hhhhhhhhccccccccceeeecCCCCchHHHHHHHh-hCcccceeeeec-hhhhhhhhhHHHHhhCccceehhhccCCCC
Confidence 88777753 3468888889999888888777776 799999999999 999999999999999999999999988887
Q ss_pred Cc
Q 016420 385 PD 386 (390)
Q Consensus 385 ~~ 386 (390)
|.
T Consensus 466 p~ 467 (483)
T KOG4341|consen 466 PG 467 (483)
T ss_pred cc
Confidence 75
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 390 | ||||
| 3ogk_B | 592 | Structure Of Coi1-Ask1 In Complex With Coronatine A | 8e-07 | ||
| 2p1m_B | 594 | Tir1-ask1 Complex Structure Length = 594 | 6e-06 |
| >pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 | Back alignment and structure |
|
| >pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 390 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 7e-42 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-30 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-29 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-09 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-39 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-31 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-29 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-06 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-36 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 5e-15 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-15 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-13 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-13 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 9e-07 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-14 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-10 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 1e-12 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-11 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 3e-12 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 8e-11 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 6e-08 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 1e-07 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 6e-11 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 1e-10 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 3e-08 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 6e-07 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 6e-04 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 6e-07 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-05 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 2e-04 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 5e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 6e-04 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
Score = 153 bits (389), Expect = 7e-42
Identities = 68/343 (19%), Positives = 123/343 (35%), Gaps = 53/343 (15%)
Query: 9 KTSIMDLPDDCLCFIFQWLDCGTDCESFGLTCHRWLDIQNLCRRSVQFQCSFTLITCSSL 68
K + P++ L +F ++ D S L C W +I+ CRR V
Sbjct: 3 KRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVF------------- 49
Query: 69 SQPIIDIRSFHVGRLLTRFQHLNWLSLSGCTELPDSGLNQLQNYGSKLQTLYLDCCFQIT 128
I + + ++ RF + + L G D L D
Sbjct: 50 ---IGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLV-------------PDGWGGYV 93
Query: 129 DNGLSVIATGCSSLTSISLYRCNVTDVGLEILASTCSTLMRVNLAYCLHISDCGLRALSQ 188
+ +++ + L I L R VTD LE++A + + L+ C S GL A++
Sbjct: 94 YPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAA 153
Query: 189 GCSQLTAVRTSSCRTVTGIGFNGCSPTLAYIDAESCQLGPEGIIGIVSGGGLEFLNVSGM 248
C L + V + + L++ ++ L LN+S +
Sbjct: 154 TCRNLKELDLRESD-VDDVSGHW----LSHF-PDTY-------------TSLVSLNISCL 194
Query: 249 SSTLNGGGLAAIGTGFATRLKTLNLRMCRNVGDESIVAIAKGCPLLEEWNLSLC-HEVRF 307
+S ++ L + T LK+L L V E + + + P LEE EVR
Sbjct: 195 ASEVSFSALERLVTRC-PNLKSLKLNRA--VPLEKLATLLQRAPQLEELGTGGYTAEVRP 251
Query: 308 PGWASVGLNCNNLEKL-HVNRCRNLCDRGLQALRDGCKQLLIL 349
++ + + + ++L ++ + L A+ C +L L
Sbjct: 252 DVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTL 294
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 390 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 100.0 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 100.0 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.97 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.92 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.92 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.87 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.86 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.79 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.79 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.76 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.71 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.71 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.7 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.69 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.62 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.62 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.6 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.6 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.58 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.57 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.57 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.56 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.54 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.53 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.53 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.52 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.52 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.51 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.51 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.5 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.5 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.5 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.5 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.49 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.49 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.49 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.49 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.48 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.47 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.46 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.46 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.46 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.44 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.44 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.44 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.43 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.43 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.41 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.41 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.41 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.41 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.41 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.41 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.4 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.4 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.4 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.39 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.39 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.39 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.39 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.38 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.37 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.37 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.37 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.37 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.36 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.35 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.34 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.34 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.34 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.33 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.33 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.32 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.32 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.31 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.31 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.3 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.3 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.26 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.25 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.24 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.23 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.22 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.21 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.18 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.15 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.15 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.14 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.12 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.08 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.08 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.08 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.07 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.03 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.02 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.02 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.0 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.0 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.0 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.97 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.97 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.95 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.9 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.87 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.87 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.87 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.85 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.84 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.81 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.8 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.78 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.75 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.75 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.68 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.59 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.59 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.58 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.58 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.57 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.57 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.57 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.55 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.5 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.5 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.48 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.47 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.46 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.45 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.44 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.44 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.41 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.34 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.26 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.25 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.24 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.23 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.09 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.01 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.01 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.95 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 97.91 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.89 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.88 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.86 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.82 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.81 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.79 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.58 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.43 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.42 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.41 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.34 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.25 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.2 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.2 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.19 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.14 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.89 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.2 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.16 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 94.89 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 93.24 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 89.56 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 87.24 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 84.26 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 81.62 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.7e-33 Score=265.27 Aligned_cols=362 Identities=18% Similarity=0.287 Sum_probs=214.0
Q ss_pred CCCcCCCCCHHHHHHHHhhCCCccchhHHhhhhhhhHhhccccccceeeeccccc---------ccccCCCCcc------
Q 016420 8 GKTSIMDLPDDCLCFIFQWLDCGTDCESFGLTCHRWLDIQNLCRRSVQFQCSFTL---------ITCSSLSQPI------ 72 (390)
Q Consensus 8 ~~~~~~~LP~evl~~If~~L~~~~~~~~~~~vcr~w~~~~~~~~~~~~~~~~~~~---------~~~~~l~~~~------ 72 (390)
+.+.|+.||+|||.+||+||+..+|+.++++|||+|+++....+..+.+...... .++..+....
T Consensus 2 ~~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~ 81 (594)
T 2p1m_B 2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFAD 81 (594)
T ss_dssp --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSCHHHHHHHCTTCCEEEEECSCGGGG
T ss_pred cccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccCHHHHHhhCCCceEEeccCCCchhh
Confidence 4688999999999999999994489999999999999986555555544321100 0111111000
Q ss_pred --------hhhhhhHHHHHHhhCCCccEEEecCCCCCChhHHHHHHHcCCCccEEEcCCCCCCChHHHHHHHHhCCCCCe
Q 016420 73 --------IDIRSFHVGRLLTRFQHLNWLSLSGCTELPDSGLNQLQNYGSKLQTLYLDCCFQITDNGLSVIATGCSSLTS 144 (390)
Q Consensus 73 --------~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~ 144 (390)
.......+..+...+++|++|+++++. +++..+..+...+++|++|++++|..+++.++..+...|++|++
T Consensus 82 ~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~-~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~ 160 (594)
T 2p1m_B 82 FNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMV-VTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKE 160 (594)
T ss_dssp GTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCB-CCHHHHHHHHHHCTTCCEEEEESCEEEEHHHHHHHHHHCTTCCE
T ss_pred cccccccccchhhHHHHHHHHhCCCCCeEEeeCcE-EcHHHHHHHHHhCCCCcEEeCCCcCCCCHHHHHHHHHhCCCCCE
Confidence 011122345566777888888888753 66666777766678888888888766777777777777888888
Q ss_pred EEecccccChHH---HHHHHhcCcccceeeccCCC-CCCHHHHHHHHHcCCCCCEEeccccCccCc-ccccccCCCCCeE
Q 016420 145 ISLYRCNVTDVG---LEILASTCSTLMRVNLAYCL-HISDCGLRALSQGCSQLTAVRTSSCRTVTG-IGFNGCSPTLAYI 219 (390)
Q Consensus 145 L~l~~~~~~~~~---~~~l~~~~~~L~~L~l~~~~-~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~-~~~~~~~~~L~~L 219 (390)
|++++|.+++.+ +..+...+++|++|+++++. .++...+..+...+|+|++|++.+|..... ..+....++|++|
T Consensus 161 L~L~~~~i~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~l~~~~~~~~~L~~L 240 (594)
T 2p1m_B 161 LDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEEL 240 (594)
T ss_dssp EECTTCEEECCCGGGGGGSCTTCCCCCEEECTTCCSCCCHHHHHHHHHHCTTCCEEECCTTSCHHHHHHHHHHCTTCSEE
T ss_pred EeCcCCccCCcchHHHHHHhhcCCcCcEEEecccCCcCCHHHHHHHHHhCCCCcEEecCCCCcHHHHHHHHhcCCcceEc
Confidence 888877554433 33344456788888887764 466677777777788888888887743332 1222345677777
Q ss_pred EeeccC--CCh---------------------------hhHHhh-hcCCCccEEEecCCccccccchhHhhhhccCCCcc
Q 016420 220 DAESCQ--LGP---------------------------EGIIGI-VSGGGLEFLNVSGMSSTLNGGGLAAIGTGFATRLK 269 (390)
Q Consensus 220 ~l~~~~--~~~---------------------------~~~~~l-~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~L~ 269 (390)
++..+. +.. ..+..+ ..+++|++|+++++. ..+.++..+ ...+++|+
T Consensus 241 ~l~~~~~~~~~~~~~~l~~~l~~~~~L~~Ls~~~~~~~~~l~~~~~~~~~L~~L~L~~~~--l~~~~l~~~-~~~~~~L~ 317 (594)
T 2p1m_B 241 GTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYAT--VQSYDLVKL-LCQCPKLQ 317 (594)
T ss_dssp ECSBCCCCCCHHHHHHHHHHHHTCTTCCEEECCBTCCGGGGGGGHHHHTTCCEEECTTCC--CCHHHHHHH-HTTCTTCC
T ss_pred ccccccCccchhhHHHHHHHHhcCCCcccccCCcccchhhHHHHHHhhCCCCEEEccCCC--CCHHHHHHH-HhcCCCcC
Confidence 765442 111 111111 134556666665554 222222222 12356666
Q ss_pred EEecCCCCCCChHHHHHHHhcCCCCceeec--------ccccCCChhHHHHHhhcCCCCCeEEcccccccCchHHHHHHH
Q 016420 270 TLNLRMCRNVGDESIVAIAKGCPLLEEWNL--------SLCHEVRFPGWASVGLNCNNLEKLHVNRCRNLCDRGLQALRD 341 (390)
Q Consensus 270 ~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l--------~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~i~~~~~~~l~~ 341 (390)
+|++.+| +++.++..+...+++|+.|++ ..+..+++.++..+...|++|+.|.++. ..+++.++..+..
T Consensus 318 ~L~l~~~--~~~~~l~~l~~~~~~L~~L~L~~~~~~g~~~~~~l~~~~l~~l~~~~~~L~~L~~~~-~~l~~~~~~~l~~ 394 (594)
T 2p1m_B 318 RLWVLDY--IEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFC-RQMTNAALITIAR 394 (594)
T ss_dssp EEEEEGG--GHHHHHHHHHHHCTTCCEEEEECSCTTCSSCSSCCCHHHHHHHHHHCTTCCEEEEEE-SCCCHHHHHHHHH
T ss_pred EEeCcCc--cCHHHHHHHHHhCCCCCEEEEecCcccccccCCCCCHHHHHHHHHhchhHHHHHHhc-CCcCHHHHHHHHh
Confidence 6666655 445555555555666666666 2334556666666665566666664443 3566666666665
Q ss_pred cCCCCceeecc-----ccCCcCC----hHHHHHHHhhcCceeEee
Q 016420 342 GCKQLLILYAN-----KKNSRVS----STAWELFKMYRGNVDIKD 377 (390)
Q Consensus 342 ~~~~L~~L~l~-----~~c~~l~----~~~~~~l~~~~~~l~~~~ 377 (390)
.|++|+.|+++ + |+.++ +.++..+...+++++.-.
T Consensus 395 ~~~~L~~L~L~~~~~~~-~~~l~~~~~~~~~~~l~~~~~~L~~L~ 438 (594)
T 2p1m_B 395 NRPNMTRFRLCIIEPKA-PDYLTLEPLDIGFGAIVEHCKDLRRLS 438 (594)
T ss_dssp HCTTCCEEEEEESSTTC-CCTTTCCCTHHHHHHHHHHCTTCCEEE
T ss_pred hCCCcceeEeecccCCC-cccccCCchhhHHHHHHhhCCCccEEe
Confidence 66667777666 5 66666 566666655666554433
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 390 | ||||
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 9e-07 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 5e-04 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 0.003 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 47.8 bits (112), Expect = 9e-07
Identities = 51/269 (18%), Positives = 91/269 (33%), Gaps = 32/269 (11%)
Query: 80 VGRLLTRFQHLNWLSLSGCTELPDSGLNQLQNYGSKLQTLYLDCCFQITDNGLSVIATGC 139
GRLL++ S + + ++Q + L I + L I + C
Sbjct: 17 TGRLLSQGVIAFRCPRSFMDQPLAEHFSPF-----RVQHMDLSNS-VIEVSTLHGILSQC 70
Query: 140 SSLTSISLYRCNVTDVGLEILASTCSTLMRVNLAYCLHISDCGLRALSQGCSQLTAVRTS 199
S L ++SL ++D + LA S L+R+NL+ C S+ L+ L CS+L + S
Sbjct: 71 SKLQNLSLEGLRLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLS 129
Query: 200 SCRTVTGIGFNGCSPTLAYIDAESCQLGPEGIIGIVSGGGLEFLNVSGMSSTLNGGGLAA 259
C T ++ + G +
Sbjct: 130 WCFDFTEKHVQVAVAHVSETITQLNLSG---------------------YRKNLQKSDLS 168
Query: 260 IGTGFATRLKTLNLRMCRNVGDESIVAIAKGCPLLEEWNLSLCHEVRFPGWASVGLNCNN 319
L L+L + ++ + L+ +LS C+++ +G
Sbjct: 169 TLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-LNYLQHLSLSRCYDIIPETLLELG-EIPT 226
Query: 320 LEKLHVNRCRNLCDRGLQALRDGCKQLLI 348
L+ L V + D LQ L++ L I
Sbjct: 227 LKTLQVFGI--VPDGTLQLLKEALPHLQI 253
|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 390 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.93 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.88 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.77 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.65 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.63 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.6 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.2 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.15 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.14 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.13 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.07 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.06 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.99 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.97 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.97 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.95 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.9 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.89 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.78 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.76 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.75 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.75 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.73 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.72 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.71 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.69 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.64 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.63 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.62 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.56 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.47 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.36 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.28 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.23 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.2 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.14 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.07 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.94 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.9 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.88 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.86 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.19 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.09 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.06 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.88 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=1.3e-24 Score=184.89 Aligned_cols=216 Identities=24% Similarity=0.307 Sum_probs=165.2
Q ss_pred CCccEEEcCCCCCCChHHHHHHHHhCCCCCeEEecccccChHHHHHHHhcCcccceeeccCCCCCCHHHHHHHHHcCCCC
Q 016420 114 SKLQTLYLDCCFQITDNGLSVIATGCSSLTSISLYRCNVTDVGLEILASTCSTLMRVNLAYCLHISDCGLRALSQGCSQL 193 (390)
Q Consensus 114 ~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~l~~l~~~~~~L 193 (390)
.+|++|++++|. +++..+..+...|++|++|++.+|.+++..+..+.+ +++|++|++++|..+++.++..+.+.||+|
T Consensus 46 ~~L~~LdLs~~~-i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L 123 (284)
T d2astb2 46 FRVQHMDLSNSV-IEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRL 123 (284)
T ss_dssp BCCCEEECTTCE-ECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHHHHHHHCTTC
T ss_pred CCCCEEECCCCc-cCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhc-CCCCcCccccccccccccccchhhHHHHhc
Confidence 578888888764 777777777778888888888888777777777654 788888888887778888888877778888
Q ss_pred CEEeccccCccCcccccccCCCCCeEEeeccCCChhhHHhhhcCCCccEEEecCCccccccchhHhhhhccCCCccEEec
Q 016420 194 TAVRTSSCRTVTGIGFNGCSPTLAYIDAESCQLGPEGIIGIVSGGGLEFLNVSGMSSTLNGGGLAAIGTGFATRLKTLNL 273 (390)
Q Consensus 194 ~~L~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l 273 (390)
++|++++|..+.+.+ +.......+++|++|++
T Consensus 124 ~~L~ls~c~~~~~~~------------------------------------------------~~~~~~~~~~~L~~L~l 155 (284)
T d2astb2 124 DELNLSWCFDFTEKH------------------------------------------------VQVAVAHVSETITQLNL 155 (284)
T ss_dssp CEEECCCCTTCCHHH------------------------------------------------HHHHHHHSCTTCCEEEC
T ss_pred ccccccccccccccc------------------------------------------------chhhhcccccccchhhh
Confidence 888877765433221 11112223677888888
Q ss_pred CCCC-CCChHHHHHHHhcCCCCceeecccccCCChhHHHHHhhcCCCCCeEEcccccccCchHHHHHHHcCCCCceeecc
Q 016420 274 RMCR-NVGDESIVAIAKGCPLLEEWNLSLCHEVRFPGWASVGLNCNNLEKLHVNRCRNLCDRGLQALRDGCKQLLILYAN 352 (390)
Q Consensus 274 ~~~~-~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~i~~~~~~~l~~~~~~L~~L~l~ 352 (390)
+++. .+++.++..+...||+|+.|++++|..+++.++..+. .+++|++|++++|..+++.++..+. .+|+|+.|+++
T Consensus 156 ~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~-~~~~L~~L~L~~C~~i~~~~l~~L~-~~~~L~~L~l~ 233 (284)
T d2astb2 156 SGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-QLNYLQHLSLSRCYDIIPETLLELG-EIPTLKTLQVF 233 (284)
T ss_dssp CSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTCTTCCGGGGGGGG-GCTTCCEEECT
T ss_pred cccccccccccccccccccccccccccccccCCCchhhhhhc-ccCcCCEEECCCCCCCChHHHHHHh-cCCCCCEEeee
Confidence 8763 4778888888888999999999988888888877776 4789999999998888888887765 68999999998
Q ss_pred ccCCcCChHHHHHHHhhcCceeEeecceeeeC
Q 016420 353 KKNSRVSSTAWELFKMYRGNVDIKDEEVMCIG 384 (390)
Q Consensus 353 ~~c~~l~~~~~~~l~~~~~~l~~~~~~~~~~~ 384 (390)
+ | +++.++..+...+|++++.......++
T Consensus 234 ~-~--~~d~~l~~l~~~lp~L~i~~~~ls~~~ 262 (284)
T d2astb2 234 G-I--VPDGTLQLLKEALPHLQINCSHFTTIA 262 (284)
T ss_dssp T-S--SCTTCHHHHHHHSTTSEESCCCSCCTT
T ss_pred C-C--CCHHHHHHHHHhCccccccCccCCCCC
Confidence 8 7 888888888888998888665554443
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|