Citrus Sinensis ID: 016489

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39

MGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM

cccccccccccEEccccEEEEcEEEEcccccHHHHHHHHHcccccccccccccEEEEEEEEEEEccccccccccEEEEEccccccccccEEEEEEEcccEEEEEEEEEcccccccccHHHHHHHHHccccHHHHHccccEEEEcEEEEcccccccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccEEEEEEEcccccEEEEEEcccccccccccccccccccEEEccccccccccccc

cccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHcccccccccccccEEEEEHEEHEccHHHccccEEEEEccccccccccccEEEEEccccEEEEEEEEEccccccccccHHHHHHHcccHHHHHHHccccHHHHHHHHHHHccccccccccccccEEEEcccccccccHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHcccccEEcccccccHHHHccHHHcccccccccccEEEEccccEEEEEccccccccccEEEEccccccccccHHHHcccccccccccEEEEEEccccccEEEEEccccEEEcccccccccccEEEEccccccccccccc

mgiakdgskkenfQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEvweidegkhnpgeilhtlgwpldqktyggsfLYHMNDRQIALGLVVALNyhnpflnpyeefqkfkhhpaikplleggtvvQYGARtlnegglqsipypvfpggaiigcaagflnvpkikgtHTAMKSGMLAAEAgfgvlhedsnmeIYWDTLQKSWVWQELQRArnyrpafeygllpglaicglehyilrgkspytlkhgkpdheatdaarlhspieypkpdgvlsfdvptslhrsntnhehdqpahlrlrdpkipelvnlpeyagpesrycparvyeyvpdeKNQLKLQINAqnclhckacdikdpkqnikwtvpeggggpgysvm

mgiakdgskkenfqrgveLRGRitllaegcrgslSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHrsntnhehdqpahlrlrdpkipELVNLpeyagpesrYCPARVYEYVPDEKNQLKLQINAQNCLHCKACdikdpkqnikwtvpeggggpgysvm

****************VELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYT*************************************************************LVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTV************

MGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKP********RLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGP*YSV*

*********KENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHR***********HLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM

***********NFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGG******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		388	2.2.26 [Sep-21-2011]
Q16134		617	Electron transfer flavopr	yes	no	0.994	0.625	0.561	1e-128
Q5RDD3		617	Electron transfer flavopr	yes	no	0.994	0.625	0.561	1e-128
Q6UPE1		616	Electron transfer flavopr	yes	no	0.994	0.626	0.561	1e-128
Q2KIG0		617	Electron transfer flavopr	yes	no	0.994	0.625	0.551	1e-127
Q921G7		616	Electron transfer flavopr	yes	no	0.994	0.626	0.558	1e-127
P55931		617	Electron transfer flavopr	yes	no	0.994	0.625	0.553	1e-126
Q54XM6		606	Electron transfer flavopr	yes	no	0.994	0.636	0.544	1e-126
Q11190		597	Electron transfer flavopr	yes	no	0.989	0.643	0.523	1e-117
Q08822		631	Probable electron transfe	yes	no	0.989	0.608	0.492	1e-110
Q9HZP5		551	Electron transfer flavopr	yes	no	0.994	0.700	0.507	1e-109

>sp\|Q16134\|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2	Back alignment and function desciption

 Score =  457 bits (1177), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/401 (56%), Positives = 288/401 (71%), Gaps = 15/401 (3%)

Query: 1   MGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIK 60
           +GI KDG+ K  F+RG+EL  ++T+ AEGC G L+++L K F LR  ++ + QTY +G+K
Sbjct: 219 VGIQKDGAPKATFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLR--ANCEPQTYGIGLK 276

Query: 61  EVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQ--IALGLVVALNYHNPFLNP 118
           E+W IDE    PG + HT+GWPLD+ TYGGSFLYH+N+ +  +ALGLVV L+Y NP+L+P
Sbjct: 277 ELWVIDEKNWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSP 336

Query: 119 YEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPK 178
           + EFQ++KHHP+I+P LEGG  + YGAR LNEGG QSIP   FPGG +IGC+ GF+NVPK
Sbjct: 337 FREFQRWKHHPSIRPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPK 396

Query: 179 IKGTHTAMKSGMLAAEAGFGVLHEDS--------NMEIYWDTLQKSWVWQELQRARNYRP 230
           IKGTHTAMKSG+LAAE+ F  L  ++        ++  Y D L+ SWVW+EL   RN RP
Sbjct: 397 IKGTHTAMKSGILAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRP 456

Query: 231 AFE--YGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSF 288
           +     G+  G+   G+ ++ILRG  P+TLKH   D E    A+  +PIEYPKPDG +SF
Sbjct: 457 SCHGVLGVYGGMIYTGIFYWILRGMEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISF 516

Query: 289 DVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEK-NQ 347
           D+ +S+  S TNHEHDQPAHL LRD  IP   NL  Y GPE R+CPA VYE+VP E+ + 
Sbjct: 517 DLLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDG 576

Query: 348 LKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM 388
            +LQINAQNC+HCK CDIKDP QNI W VPEGGGGP Y+ M
Sbjct: 577 FRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM 617

Accepts electrons from ETF and reduces ubiquinone.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 5EC: .EC: 5EC: .EC: 1

>sp\|Q5RDD3\|ETFD_PONAB Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Pongo abelii GN=ETFDH PE=2 SV=1	Back alignment and function description

>sp\|Q6UPE1\|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=2 SV=1	Back alignment and function description

>sp\|Q2KIG0\|ETFD_BOVIN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Bos taurus GN=ETFDH PE=2 SV=1	Back alignment and function description

>sp\|Q921G7\|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus GN=Etfdh PE=1 SV=1	Back alignment and function description

>sp\|P55931\|ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa GN=ETFDH PE=1 SV=2	Back alignment and function description

>sp\|Q54XM6\|ETFD_DICDI Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Dictyostelium discoideum GN=etfdh PE=3 SV=1	Back alignment and function description

>sp\|Q11190\|ETFD_CAEEL Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Caenorhabditis elegans GN=let-721 PE=1 SV=2	Back alignment and function description

>sp\|Q08822\|ETFD_YEAST Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIR2 PE=1 SV=1	Back alignment and function description

>sp\|Q9HZP5\|ETFD_PSEAE Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2953 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		388
224132778		424	predicted protein [Populus trichocarpa]	1.0	0.915	0.847	0.0
225433976		676	PREDICTED: electron transfer flavoprotei	1.0	0.573	0.835	0.0
297743836		536	unnamed protein product [Vitis vinifera]	1.0	0.723	0.835	0.0
449459846		659	PREDICTED: electron transfer flavoprotei	1.0	0.588	0.837	0.0
255577195		609	electron transfer flavoprotein-ubiquinon	1.0	0.637	0.827	0.0
356557362		617	PREDICTED: electron transfer flavoprotei	1.0	0.628	0.819	0.0
15224277		633	electron-transferring-flavoprotein dehyd	1.0	0.612	0.832	0.0
449498831		668	PREDICTED: electron transfer flavoprotei	1.0	0.580	0.813	0.0
297824323		629	electron-transfer flavoprotein:ubiquinon	1.0	0.616	0.827	0.0
357454495		606	Electron transfer flavoprotein-ubiquinon	1.0	0.640	0.799	0.0

>gi\|224132778\|ref\|XP_002327878.1\| predicted protein [Populus trichocarpa] gi\|222837287\|gb\|EEE75666.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/388 (84%), Positives = 365/388 (94%)

Query: 1   MGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIK 60
           MGIAKDGSKK+ FQRGVEL+GR+TLLAEGCRGSLSEKLIK +KLREK HAQHQTYALGIK
Sbjct: 37  MGIAKDGSKKDTFQRGVELKGRVTLLAEGCRGSLSEKLIKKYKLREKGHAQHQTYALGIK 96

Query: 61  EVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYE 120
           EVWEIDE KH PG +LHT+GWPLDQKTYGGSFLYHM DRQ+++GLVVALNYHNP+LNPYE
Sbjct: 97  EVWEIDESKHKPGAVLHTIGWPLDQKTYGGSFLYHMKDRQVSIGLVVALNYHNPYLNPYE 156

Query: 121 EFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIK 180
           EFQKFKHHPAI+PLLEGGTV+QYGARTLNEGG+QSIPYPVF GGAIIGC+AGFLNVPKIK
Sbjct: 157 EFQKFKHHPAIRPLLEGGTVIQYGARTLNEGGIQSIPYPVFSGGAIIGCSAGFLNVPKIK 216

Query: 181 GTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGL 240
           GTHTAMKSGMLAAEA FG L E ++++ YW+TL+ SW+W EL +ARNYRPAFEYG++PG+
Sbjct: 217 GTHTAMKSGMLAAEAAFGSLREGTSLKSYWETLRSSWIWDELHQARNYRPAFEYGVIPGM 276

Query: 241 AICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTN 300
           AI  LE YIL+G+SP+TLKHGKPDHE+T+AARLHSPIEYPKPDGV SFDVPTSLHRSNTN
Sbjct: 277 AISALERYILKGRSPFTLKHGKPDHESTNAARLHSPIEYPKPDGVFSFDVPTSLHRSNTN 336

Query: 301 HEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHC 360
           H+HDQPAHLRL+DPKIPE +NLPEYAGPESRYCPARVYEY+ DE +QLKLQINAQNCLHC
Sbjct: 337 HDHDQPAHLRLKDPKIPETLNLPEYAGPESRYCPARVYEYISDENSQLKLQINAQNCLHC 396

Query: 361 KACDIKDPKQNIKWTVPEGGGGPGYSVM 388
           KACDIKDPKQNI+WTVPEGGGGPGYSVM
Sbjct: 397 KACDIKDPKQNIEWTVPEGGGGPGYSVM 424

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225433976\|ref\|XP_002270682.1\| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297743836\|emb\|CBI36719.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449459846\|ref\|XP_004147657.1\| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255577195\|ref\|XP_002529480.1\| electron transfer flavoprotein-ubiquinone oxidoreductase, putative [Ricinus communis] gi\|223531038\|gb\|EEF32890.1\| electron transfer flavoprotein-ubiquinone oxidoreductase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356557362\|ref\|XP_003546985.1\| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|15224277\|ref\|NP_181868.1\| electron-transferring-flavoprotein dehydrogenase [Arabidopsis thaliana] gi\|2288999\|gb\|AAB64328.1\| putative electron transfer flavoprotein ubiquinone oxidoreductase [Arabidopsis thaliana] gi\|330255167\|gb\|AEC10261.1\| electron-transferring-flavoprotein dehydrogenase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449498831\|ref\|XP_004160647.1\| PREDICTED: electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297824323\|ref\|XP_002880044.1\| electron-transfer flavoprotein:ubiquinone oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi\|297325883\|gb\|EFH56303.1\| electron-transfer flavoprotein:ubiquinone oxidoreductase [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|357454495\|ref\|XP_003597528.1\| Electron transfer flavoprotein-ubiquinone oxidoreductase [Medicago truncatula] gi\|355486576\|gb\|AES67779.1\| Electron transfer flavoprotein-ubiquinone oxidoreductase [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		388
TAIR\|locus:2058183		633	ETFQO "AT2G43400" [Arabidopsis	1.0	0.612	0.832	5.6e-187
ZFIN\|ZDB-GENE-040912-168		617	etfdh "electron-transferring-f	0.992	0.623	0.562	2.1e-123
UNIPROTKB\|J3KND9		570	ETFDH "Electron transfer flavo	0.994	0.677	0.561	1.3e-121
UNIPROTKB\|Q16134		617	ETFDH "Electron transfer flavo	0.994	0.625	0.561	1.3e-121
RGD\|735052		616	Etfdh "electron-transferring-f	0.994	0.626	0.561	5.8e-121
UNIPROTKB\|Q2KIG0		617	ETFDH "Electron transfer flavo	0.994	0.625	0.551	9.5e-121
UNIPROTKB\|F1RW89		616	ETFDH "Electron transfer flavo	0.994	0.626	0.553	1.2e-120
UNIPROTKB\|P55931		617	ETFDH "Electron transfer flavo	0.994	0.625	0.553	2e-120
MGI\|MGI:106100		616	Etfdh "electron transferring f	0.994	0.626	0.558	2e-120
UNIPROTKB\|F6V7P2		617	ETFDH "Uncharacterized protein	0.994	0.625	0.556	3.2e-120

TAIR\|locus:2058183 ETFQO "AT2G43400" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1813 (643.3 bits), Expect = 5.6e-187, P = 5.6e-187
 Identities = 323/388 (83%), Positives = 354/388 (91%)

Query:     1 MGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIK 60
             MGI+KDGSKKENFQ GV+++GR+TL AEGCRGSLSE++IK +KLRE+ +AQHQTYALGIK
Sbjct:   246 MGISKDGSKKENFQPGVDIKGRVTLFAEGCRGSLSERIIKKYKLREEVNAQHQTYALGIK 305

Query:    61 EVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYE 120
             EVWEIDE KHNPGE++HTLGWPLD KTYGGSFLYHMNDRQ+ALGLVVALNYHNPFLNPYE
Sbjct:   306 EVWEIDESKHNPGEVIHTLGWPLDPKTYGGSFLYHMNDRQVALGLVVALNYHNPFLNPYE 365

Query:   121 EFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPKIK 180
             EFQK KHHPAIK +LEGGTV+QYGARTLNEGG QSIPYPVFPGGAIIGC+AGFLNVPKIK
Sbjct:   366 EFQKLKHHPAIKGILEGGTVLQYGARTLNEGGFQSIPYPVFPGGAIIGCSAGFLNVPKIK 425

Query:   181 GTHTAMKSGMLAAEAGFGVLHEDSNMEIYWDTLQKSWVWQELQRARNYRPAFEYGLLPGL 240
             GTHTAMKSGMLAAEA FG LHE  NM  YWD L+ SWVW+EL  ARNYRPAFEYGLLPGL
Sbjct:   426 GTHTAMKSGMLAAEAAFGALHEGLNMNTYWDNLRDSWVWKELYAARNYRPAFEYGLLPGL 485

Query:   241 AICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTN 300
             AI  +EHY+L+GK P+TLKHGK DHEATD AR  +PI YPKPDGVLSFDVPTSL+RSNTN
Sbjct:   486 AISAMEHYVLKGKVPFTLKHGKADHEATDLARKWTPIVYPKPDGVLSFDVPTSLYRSNTN 545

Query:   301 HEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQLKLQINAQNCLHC 360
             H+HDQP+HLRLRDPKIPE VN PEYA PESRYCPARVYEY+ DE+ + KLQINAQNCLHC
Sbjct:   546 HDHDQPSHLRLRDPKIPEKVNFPEYAAPESRYCPARVYEYIEDEEGKPKLQINAQNCLHC 605

Query:   361 KACDIKDPKQNIKWTVPEGGGGPGYSVM 388
             KACDIKDPKQNI+WTVPEGGGGP YS+M
Sbjct:   606 KACDIKDPKQNIEWTVPEGGGGPAYSLM 633

GO:0003824 "catalytic activity" evidence=ISS

GO:0004174 "electron-transferring-flavoprotein dehydrogenase activity" evidence=IEA

GO:0005739 "mitochondrion" evidence=ISM;IDA

GO:0005740 "mitochondrial envelope" evidence=ISS

GO:0009055 "electron carrier activity" evidence=ISS

GO:0009228 "thiamine biosynthetic process" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009646 "response to absence of light" evidence=IEP

GO:0006552 "leucine catabolic process" evidence=IMP

GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA

ZFIN\|ZDB-GENE-040912-168 etfdh "electron-transferring-flavoprotein dehydrogenase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|J3KND9 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q16134 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|735052 Etfdh "electron-transferring-flavoprotein dehydrogenase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2KIG0 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RW89 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|P55931 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:106100 Etfdh "electron transferring flavoprotein, dehydrogenase" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F6V7P2 ETFDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q16134	ETFD_HUMAN	1, ., 5, ., 5, ., 1	0.5610	0.9948	0.6256	yes	no
P55931	ETFD_PIG	1, ., 5, ., 5, ., 1	0.5536	0.9948	0.6256	yes	no
Q6UPE1	ETFD_RAT	1, ., 5, ., 5, ., 1	0.5610	0.9948	0.6266	yes	no
Q11190	ETFD_CAEEL	1, ., 5, ., 5, ., 1	0.5236	0.9896	0.6432	yes	no
Q9HZP5	ETFD_PSEAE	1, ., 5, ., 5, ., 1	0.5076	0.9948	0.7005	yes	no
Q54XM6	ETFD_DICDI	1, ., 5, ., 5, ., 1	0.5445	0.9948	0.6369	yes	no
Q2KIG0	ETFD_BOVIN	1, ., 5, ., 5, ., 1	0.5511	0.9948	0.6256	yes	no
Q5RDD3	ETFD_PONAB	1, ., 5, ., 5, ., 1	0.5610	0.9948	0.6256	yes	no
Q921G7	ETFD_MOUSE	1, ., 5, ., 5, ., 1	0.5586	0.9948	0.6266	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		388
pfam05187		110	pfam05187, ETF_QO, Electron transfer flavoprotein-	9e-63
COG0644		396	COG0644, FixC, Dehydrogenases (flavoproteins) [Ene	7e-47
PRK10015		429	PRK10015, PRK10015, oxidoreductase; Provisional	1e-17
PRK10157		428	PRK10157, PRK10157, putative oxidoreductase FixC;	5e-15
COG2440		99	COG2440, FixX, Ferredoxin-like protein [Energy pro	7e-06
pfam12838		48	pfam12838, Fer4_7, 4Fe-4S dicluster domain	3e-04

>gnl\|CDD\|218485 pfam05187, ETF_QO, Electron transfer flavoprotein-ubiquinone oxidoreductase	Back alignment and domain information

 Score =  196 bits (500), Expect = 9e-63
 Identities = 71/110 (64%), Positives = 82/110 (74%)

Query: 235 GLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSL 294
           GL  GLA  GL+ +ILRGKSP+TLKH KPDH A   A    PI+YPKPDG L+FD  +S+
Sbjct: 1   GLWLGLAYAGLDQWILRGKSPWTLKHHKPDHAALKPASECKPIDYPKPDGKLTFDRLSSV 60

Query: 295 HRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDE 344
             SNTNHE DQP HL+L+DP +P  VNLP+YAGPE RYCPA VYE V DE
Sbjct: 61  FLSNTNHEEDQPCHLKLKDPSVPIAVNLPKYAGPEQRYCPAGVYEIVEDE 110

Electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane. The two redox centres in the protein, FAD and a [4Fe4S] cluster, are present in a 64-kDa monomer. Length = 110

>gnl\|CDD\|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|182194 PRK10015, PRK10015, oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional	Back alignment and domain information

>gnl\|CDD\|225289 COG2440, FixX, Ferredoxin-like protein [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|221801 pfam12838, Fer4_7, 4Fe-4S dicluster domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		388
KOG2415		621	consensus Electron transfer flavoprotein ubiquinon	100.0
PRK10015		429	oxidoreductase; Provisional	100.0
PF05187		110	ETF_QO: Electron transfer flavoprotein-ubiquinone	100.0
PRK10157		428	putative oxidoreductase FixC; Provisional	100.0
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	100.0
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	99.93
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	99.93
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	99.9
COG2440		99	FixX Ferredoxin-like protein [Energy production an	99.89
PRK15449		95	ferredoxin-like protein FixX; Provisional	99.81
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	99.76
PLN02697		529	lycopene epsilon cyclase	99.65
PRK11445		351	putative oxidoreductase; Provisional	99.63
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	99.6
PLN02463		447	lycopene beta cyclase	99.56
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	99.55
PRK09126		392	hypothetical protein; Provisional	99.44
PRK07045		388	putative monooxygenase; Reviewed	99.41
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	99.38
PRK06753		373	hypothetical protein; Provisional	99.37
PRK06185		407	hypothetical protein; Provisional	99.37
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	99.35
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	99.29
PRK07538		413	hypothetical protein; Provisional	99.29
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.28
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	99.27
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	99.27
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	99.22
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	99.21
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.21
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	99.2
PRK07588		391	hypothetical protein; Provisional	99.19
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	99.18
PRK08163		396	salicylate hydroxylase; Provisional	99.17
PRK08244		493	hypothetical protein; Provisional	99.15
PRK08013		400	oxidoreductase; Provisional	99.13
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	99.12
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	99.1
PRK05868		372	hypothetical protein; Validated	99.09
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.08
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	99.07
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	99.07
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.05
PTZ00367		567	squalene epoxidase; Provisional	99.04
PF08491		276	SE: Squalene epoxidase; InterPro: IPR013698 This d	98.98
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	98.98
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	98.93
PRK06847		375	hypothetical protein; Provisional	98.89
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	98.89
COG1142		165	HycB Fe-S-cluster-containing hydrogenase component	98.86
PLN02985		514	squalene monooxygenase	98.86
PRK06996		398	hypothetical protein; Provisional	98.85
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	98.85
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	98.84
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	98.8
PF13247		98	Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX	98.78
PRK06475		400	salicylate hydroxylase; Provisional	98.77
PRK08132		547	FAD-dependent oxidoreductase; Provisional	98.77
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	98.76
PRK07236		386	hypothetical protein; Provisional	98.73
COG1146		68	Ferredoxin [Energy production and conversion]	98.68
PRK06184		502	hypothetical protein; Provisional	98.67
PRK08294		634	phenol 2-monooxygenase; Provisional	98.66
PRK06834		488	hypothetical protein; Provisional	98.65
PRK07190		487	hypothetical protein; Provisional	98.6
PRK06126		545	hypothetical protein; Provisional	98.55
COG1144		91	Pyruvate:ferredoxin oxidoreductase and related 2-o	98.54
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	98.53
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	98.45
TIGR03478		321	DMSO_red_II_bet DMSO reductase family type II enzy	98.44
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	98.44
CHL00065		81	psaC photosystem I subunit VII	98.43
PF13237		52	Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A.	98.42
COG0437		203	HybA Fe-S-cluster-containing hydrogenase component	98.4
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	98.39
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	98.38
TIGR02060		132	aprB adenosine phosphosulphate reductase, beta sub	98.38
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	98.37
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	98.36
PRK09623		105	vorD 2-ketoisovalerate ferredoxin oxidoreductase s	98.35
TIGR01660		492	narH nitrate reductase, beta subunit. The Nitrate	98.34
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	98.34
TIGR01582		283	FDH-beta formate dehydrogenase, beta subunit, Fe-S	98.34
PLN00071		81	photosystem I subunit VII; Provisional	98.32
PRK08222		181	hydrogenase 4 subunit H; Validated	98.31
TIGR01944		165	rnfB electron transport complex, RnfABCDGE type, B	98.3
KOG2614		420	consensus Kynurenine 3-monooxygenase and related f	98.3
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	98.3
PRK05888		164	NADH dehydrogenase subunit I; Provisional	98.3
TIGR02179		78	PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta	98.28
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	98.27
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	98.26
PRK02651		81	photosystem I subunit VII; Provisional	98.24
PRK06273		165	ferredoxin; Provisional	98.21
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	98.21
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	98.21
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	98.17
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	98.16
TIGR02163		255	napH_ ferredoxin-type protein, NapH/MauN family. M	98.13
PRK05113		191	electron transport complex protein RnfB; Provision	98.12
KOG3256		212	consensus NADH:ubiquinone oxidoreductase, NDUFS8/2	98.11
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	98.09
COG1145		99	NapF Ferredoxin [Energy production and conversion]	98.09
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	98.08
PRK14993		244	tetrathionate reductase subunit B; Provisional	98.08
PRK08764		135	ferredoxin; Provisional	98.06
PRK06991		270	ferredoxin; Provisional	98.06
PRK07118		280	ferredoxin; Validated	98.04
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	98.04
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	98.03
PRK10194		163	ferredoxin-type protein; Provisional	98.01
TIGR03224		411	benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p	98.01
PF00037		24	Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T	98.0
PRK09898		208	hypothetical protein; Provisional	97.99
TIGR02066		341	dsrB sulfite reductase, dissimilatory-type beta su	97.98
PRK09477		271	napH quinol dehydrogenase membrane component; Prov	97.98
PRK13409		590	putative ATPase RIL; Provisional	97.96
COG1149		284	MinD superfamily P-loop ATPase containing an inser	97.92
TIGR02951		161	DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi	97.92
TIGR02700		234	flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T	97.92
PRK10882		328	hydrogenase 2 protein HybA; Provisional	97.91
TIGR02912		314	sulfite_red_C sulfite reductase, subunit C. Member	97.89
PF12837		24	Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450	97.89
COG2768		354	Uncharacterized Fe-S center protein [General funct	97.84
CHL00014		167	ndhI NADH dehydrogenase subunit I	97.83
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	97.83
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	97.8
TIGR02512		374	Fe_only_hydrog hydrogenases, Fe-only. This model d	97.79
PRK14028		312	pyruvate ferredoxin oxidoreductase subunit gamma/d	97.78
PRK09476		254	napG quinol dehydrogenase periplasmic component; P	97.77
COG2221		317	DsrA Dissimilatory sulfite reductase (desulfovirid	97.73
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	97.7
PRK13795		636	hypothetical protein; Provisional	97.68
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	97.68
PRK10194		163	ferredoxin-type protein; Provisional	97.67
KOG1298		509	consensus Squalene monooxygenase [Lipid transport	97.64
cd07030		259	RNAP_D D subunit of Archaeal RNA polymerase. The D	97.63
PRK09898		208	hypothetical protein; Provisional	97.62
TIGR03287		391	methan_mark_16 putative methanogenesis marker 16 m	97.61
TIGR03294		228	FrhG coenzyme F420 hydrogenase, subunit gamma. Thi	97.6
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	97.59
PRK13984		604	putative oxidoreductase; Provisional	97.57
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	97.56
PRK00783		263	DNA-directed RNA polymerase subunit D; Provisional	97.56
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	97.48
PRK07569		234	bidirectional hydrogenase complex protein HoxU; Va	97.47
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	97.44
PF12797		22	Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450	97.42
PRK07118		280	ferredoxin; Validated	97.41
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	97.38
PF13484		67	Fer4_16: 4Fe-4S double cluster binding domain	97.37
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	97.3
PRK09326		341	F420H2 dehydrogenase subunit F; Provisional	97.3
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	97.3
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	97.25
TIGR03478		321	DMSO_red_II_bet DMSO reductase family type II enzy	97.24
KOG3855		481	consensus Monooxygenase involved in coenzyme Q (ub	97.21
PF13247		98	Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX	97.19
PRK14993		244	tetrathionate reductase subunit B; Provisional	97.19
TIGR02064		402	dsrA sulfite reductase, dissimilatory-type alpha s	97.16
PRK10882		328	hydrogenase 2 protein HybA; Provisional	97.15
PRK09476		254	napG quinol dehydrogenase periplasmic component; P	97.15
TIGR02951		161	DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi	97.12
PRK08493		819	NADH dehydrogenase subunit G; Validated	97.08
TIGR03336		595	IOR_alpha indolepyruvate ferredoxin oxidoreductase	97.0
TIGR01582		283	FDH-beta formate dehydrogenase, beta subunit, Fe-S	96.97
COG2878		198	Predicted NADH:ubiquinone oxidoreductase, subunit	96.9
COG0437		203	HybA Fe-S-cluster-containing hydrogenase component	96.88
COG3383		978	Uncharacterized anaerobic dehydrogenase [General f	96.84
COG4231		640	Indolepyruvate ferredoxin oxidoreductase, alpha an	96.74
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	96.71
PF12800		17	Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450	96.64
TIGR02163		255	napH_ ferredoxin-type protein, NapH/MauN family. M	96.63
TIGR02486		314	RDH reductive dehalogenase. This model represents	96.51
TIGR02745		434	ccoG_rdxA_fixG cytochrome c oxidase accessory prot	96.49
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	96.46
PRK09477		271	napH quinol dehydrogenase membrane component; Prov	96.43
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	96.42
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	96.4
TIGR01973		603	NuoG NADH-quinone oxidoreductase, chain G. This mo	96.37
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	96.3
PRK05035		695	electron transport complex protein RnfC; Provision	96.29
KOG0063		592	consensus RNAse L inhibitor, ABC superfamily [RNA	96.25
PF12798		15	Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450	96.21
TIGR01660		492	narH nitrate reductase, beta subunit. The Nitrate	96.13
PRK07860		797	NADH dehydrogenase subunit G; Validated	95.94
TIGR01945		435	rnfC electron transport complex, RnfABCDGE type, C	95.87
PRK09129		776	NADH dehydrogenase subunit G; Validated	95.85
COG1142		165	HycB Fe-S-cluster-containing hydrogenase component	95.64
PRK08166		847	NADH dehydrogenase subunit G; Validated	95.64
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	95.47
PF13237		52	Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A.	95.45
PRK08222		181	hydrogenase 4 subunit H; Validated	95.31
PRK13984		604	putative oxidoreductase; Provisional	95.25
PF12837		24	Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450	95.19
TIGR00314		784	cdhA CO dehydrogenase/acetyl-CoA synthase complex,	95.11
COG1941		247	FrhG Coenzyme F420-reducing hydrogenase, gamma sub	95.03
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	95.01
PRK09130		687	NADH dehydrogenase subunit G; Validated	94.96
COG1145		99	NapF Ferredoxin [Energy production and conversion]	94.92
TIGR00273		432	iron-sulfur cluster-binding protein. Members of th	94.87
TIGR02179		78	PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta	94.82
COG2221		317	DsrA Dissimilatory sulfite reductase (desulfovirid	94.8
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	94.69
PRK12814		652	putative NADPH-dependent glutamate synthase small	94.67
PTZ00305		297	NADH:ubiquinone oxidoreductase; Provisional	94.66
PRK09193		1165	indolepyruvate ferredoxin oxidoreductase; Validate	94.64
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	94.63
TIGR00276		282	iron-sulfur cluster binding protein, putative. Thi	94.6
PF00037		24	Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T	94.57
COG1144		91	Pyruvate:ferredoxin oxidoreductase and related 2-o	94.55
PRK15033		389	tricarballylate utilization protein B; Provisional	94.53
PRK13030		1159	2-oxoacid ferredoxin oxidoreductase; Provisional	94.49
COG1034		693	NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc	94.4
PRK00941		781	acetyl-CoA decarbonylase/synthase complex subunit	94.26
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	94.15
PRK06273		165	ferredoxin; Provisional	94.1
COG1139		459	Uncharacterized conserved protein containing a fer	94.06
COG1600		337	Uncharacterized Fe-S protein [Energy production an	94.02
cd01916		731	ACS_1 Acetyl-CoA synthase (ACS), also known as ace	94.02
PRK13029		1186	2-oxoacid ferredoxin oxidoreductase; Provisional	93.86
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	93.76
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	93.71
COG4656		529	RnfC Predicted NADH:ubiquinone oxidoreductase, sub	93.68
TIGR02745		434	ccoG_rdxA_fixG cytochrome c oxidase accessory prot	93.67
TIGR00384		220	dhsB succinate dehydrogenase and fumarate reductas	93.64
PRK07570		250	succinate dehydrogenase/fumarate reductase iron-su	93.46
PLN00071		81	photosystem I subunit VII; Provisional	93.44
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	93.39
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	93.19
PRK14028		312	pyruvate ferredoxin oxidoreductase subunit gamma/d	93.16
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	93.14
COG1140		513	NarY Nitrate reductase beta subunit [Energy produc	93.1
TIGR03290		144	CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s	93.05
PRK09623		105	vorD 2-ketoisovalerate ferredoxin oxidoreductase s	93.04
PRK05888		164	NADH dehydrogenase subunit I; Provisional	92.96
COG1149		284	MinD superfamily P-loop ATPase containing an inser	92.91
CHL00065		81	psaC photosystem I subunit VII	92.84
TIGR03379		397	glycerol3P_GlpC glycerol-3-phosphate dehydrogenase	92.76
PF13484		67	Fer4_16: 4Fe-4S double cluster binding domain	92.55
PRK05352		448	Na(+)-translocating NADH-quinone reductase subunit	92.41
PRK11168		396	glpC sn-glycerol-3-phosphate dehydrogenase subunit	92.19
COG1146		68	Ferredoxin [Energy production and conversion]	92.18
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	92.09
PF13370		58	Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A	92.0
COG1141		68	Fer Ferredoxin [Energy production and conversion]	91.99
PRK12576		279	succinate dehydrogenase iron-sulfur subunit; Provi	91.68
PF13534		61	Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9	91.56
TIGR02910		334	sulfite_red_A sulfite reductase, subunit A. Member	91.54
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	91.43
CHL00014		167	ndhI NADH dehydrogenase subunit I	91.24
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	91.11
PF13183		57	Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_	91.07
PRK02651		81	photosystem I subunit VII; Provisional	91.05
PRK06991		270	ferredoxin; Provisional	90.71
TIGR01944		165	rnfB electron transport complex, RnfABCDGE type, B	90.67
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	90.62
PRK12385		244	fumarate reductase iron-sulfur subunit; Provisiona	90.54
PRK15055		344	anaerobic sulfite reductase subunit A; Provisional	90.47
TIGR02484		372	CitB CitB domain protein. CobZ is essential for co	90.28
TIGR01936		447	nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo	90.16
PF13459		65	Fer4_15: 4Fe-4S single cluster domain	90.12
PRK11274		407	glcF glycolate oxidase iron-sulfur subunit; Provis	89.88
PRK05113		191	electron transport complex protein RnfB; Provision	89.62
KOG3256		212	consensus NADH:ubiquinone oxidoreductase, NDUFS8/2	89.45
PF12797		22	Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450	89.27
TIGR02700		234	flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T	89.08
COG0348		386	NapH Polyferredoxin [Energy production and convers	88.9
TIGR03294		228	FrhG coenzyme F420 hydrogenase, subunit gamma. Thi	88.87
COG1152		772	CdhA CO dehydrogenase/acetyl-CoA synthase alpha su	88.81
PRK12577		329	succinate dehydrogenase iron-sulfur subunit; Provi	88.8
COG1141		68	Fer Ferredoxin [Energy production and conversion]	87.32
PRK12386		251	fumarate reductase iron-sulfur subunit; Provisiona	87.29
COG1150		195	HdrC Heterodisulfide reductase, subunit C [Energy	87.16
PRK08640		249	sdhB succinate dehydrogenase iron-sulfur subunit;	86.9
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	86.7
PF13746		69	Fer4_18: 4Fe-4S dicluster domain	86.2
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	86.17
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	85.65
PRK05950		232	sdhB succinate dehydrogenase iron-sulfur subunit;	85.59
PRK00783		263	DNA-directed RNA polymerase subunit D; Provisional	85.47
PF13459		65	Fer4_15: 4Fe-4S single cluster domain	85.07
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	84.75
PRK06259		486	succinate dehydrogenase/fumarate reductase iron-su	84.63
PLN03000		881	amine oxidase	84.44
COG1035		332	FrhB Coenzyme F420-reducing hydrogenase, beta subu	84.29
COG2878		198	Predicted NADH:ubiquinone oxidoreductase, subunit	83.95
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	83.8
PRK13795		636	hypothetical protein; Provisional	83.6
TIGR03287		391	methan_mark_16 putative methanogenesis marker 16 m	83.5
PRK12575		235	succinate dehydrogenase iron-sulfur subunit; Provi	83.45
PRK08764		135	ferredoxin; Provisional	83.38
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	82.47
PF13370		58	Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A	80.94
COG1941		247	FrhG Coenzyme F420-reducing hydrogenase, gamma sub	80.91
TIGR02912		314	sulfite_red_C sulfite reductase, subunit C. Member	80.88
PF13183		57	Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_	80.81
cd07032		291	RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA poly	80.77
PRK07569		234	bidirectional hydrogenase complex protein HoxU; Va	80.48
PLN00129		276	succinate dehydrogenase [ubiquinone] iron-sulfur s	80.4

>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion]	Back alignment and domain information

Probab=100.00  E-value=2e-118  Score=867.95  Aligned_cols=386  Identities=64%  Similarity=1.151  Sum_probs=375.5

Q ss_pred             CCCCCCCeeeeeeecCeEEEecEEEecccCCCccchhHHHhcCCCcccCCCCceEEEEEEEEEecCCCCCCCCcEEEEcC
Q 016489            1 MGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLG   80 (388)
Q Consensus         1 ~g~~~dG~~~~~~~~g~~i~Ak~vI~AdG~~s~lar~l~~~~gl~~~~~~~~~~~~lgvke~~~~~~~~~~~g~v~~~~G   80 (388)
                      +||+|||.|+.+|++||+|+||++|+|||++++|++|+++||+||  ..+++|+|++|+||+|+++++++++|.|.|++|
T Consensus       225 ~GI~k~G~pKd~FerGme~hak~TifAEGc~G~Lskqi~kkf~Lr--~n~e~qtYglGlKEvWei~~~~~~pG~v~HT~G  302 (621)
T KOG2415|consen  225 VGISKDGAPKDTFERGMEFHAKVTIFAEGCHGSLSKQIIKKFDLR--ENCEPQTYGLGLKEVWEIDPENHNPGEVAHTLG  302 (621)
T ss_pred             ccccCCCCccccccccceecceeEEEeccccchhHHHHHHHhCcc--cCCCcceeccccceeEecChhhcCCcceeeecc
Confidence            699999999999999999999999999999999999999999999  589999999999999999999999999999999


Q ss_pred             CCCCCCCcceeEEEEcCCCEEEEEEEEecCCCCCCCChHHHHHHHHcCCCcccccCCCeeeeecceeeccCCCcCCCccc
Q 016489           81 WPLDQKTYGGSFLYHMNDRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPV  160 (388)
Q Consensus        81 ~p~~~~~~Gggwiy~~~~~~vsVGlv~~l~~~~~~~~~~~~~~~~k~~P~i~~~l~~~~~~~yga~~ip~gg~~~~p~~~  160 (388)
                      ||++.+++||+|+||+.|..|+||+|+.+||+||+++|+++||+||+||.|+..|+||++++|+||++.+||||++|+++
T Consensus       303 wPl~~~tYGGsFlYh~~d~~VavGlVVgLdY~NP~lsP~~EFQk~K~hP~i~~vleGgk~i~YgARaLNEGGfQsiPkl~  382 (621)
T KOG2415|consen  303 WPLDNDTYGGSFLYHFNDPLVAVGLVVGLDYKNPYLSPYKEFQKMKHHPSISKVLEGGKRIAYGARALNEGGFQSIPKLV  382 (621)
T ss_pred             CcccCCccCceeEEEcCCCeEEEEEEEEecCCCCCCCHHHHHHHhhcCcchhhhhcCcceeeehhhhhccCCcccCcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCEEEEccCccccCCCCccchHHHHHHHHHHHHHHHHhhcc-C------chHHHHHHHHHHhhhHHHHHHHHhhhHHHh
Q 016489          161 FPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHE-D------SNMEIYWDTLQKSWVWQELQRARNYRPAFE  233 (388)
Q Consensus       161 ~~g~lLvGDAAG~vdp~~~~Gi~~Am~SG~lAAeai~~al~~-~------~~l~~Y~~~~~~s~~~~el~~~r~~~~~~~  233 (388)
                      +||.+|||++|||+|..+++|.|+||+|||+|||+|++++++ .      ..+..|++.++++|+++||+.+||+|+.|+
T Consensus       383 FPGG~liGcSaGFlNVpKIKGTHtAMKSGmlAAesif~ai~~~~~~k~~~~~~~~Ye~nlkds~V~KeLysvRNirPsf~  462 (621)
T KOG2415|consen  383 FPGGALIGCSAGFLNVPKIKGTHTAMKSGMLAAESIFEAIKGLPQSKMAGLDPTTYEENLKDSYVWKELYSVRNIRPSFH  462 (621)
T ss_pred             cCCceEeecccccccccccccchhhhhcchhHHHHHHHHHhcCccccccccChhhHHHhhhhhHHHHHHHHhhccCcccc
Confidence            999999999999999999999999999999999999999975 1      236799999999999999999999999997


Q ss_pred             --hCChHHHHHHHHHHHHhcCCCCccccCCCCCcccchhhhcCCCCCCCCCCCCCCCCcccceEeecccccCCCCCCeEe
Q 016489          234 --YGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHLRL  311 (388)
Q Consensus       234 --~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~dg~ltfd~~~~v~~s~~~h~~d~~~Hl~v  311 (388)
                        +|.|+||+++++..++.+|+.||||+|.+.|++.|+|++.++||.||||||+||||.+|||++|||||++|||+||++
T Consensus       463 ~~lG~ygGmiySgi~~~~lkG~~PwTLkh~~~D~e~l~pa~k~~pI~YPKPDg~lSFDlltSvs~sgTnH~~dqP~HL~l  542 (621)
T KOG2415|consen  463 GKLGLYGGMIYSGIFSYVLKGKVPWTLKHGKNDHEALKPASKYKPIVYPKPDGVLSFDLLTSVSRSGTNHDEDQPAHLTL  542 (621)
T ss_pred             cccccccchhhhhhHHHhhcCccceeeccCCCchhhccchhhCCCcccCCCCceEEEeecchhhccCCCCCCCCCceeee
Confidence              899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCcccCCCCCCCccccccCCceEEEecCCCC--ceeEEEecCCCccCCcccccCCCCCeeEECcCCCCCCcccCC
Q 016489          312 RDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKN--QLKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM  388 (388)
Q Consensus       312 ~d~~~c~~~~~~~~~~~c~~~CPa~~y~~~~~~~~--~~~~~i~~~~C~~Cg~C~~~cp~~~I~w~~p~gg~G~~y~~~  388 (388)
                      +|++++.+.|++.|.+|+.|||||+|||++++|.+  .++++||+|||+||+||+|++|.|+|+|++||||+||.|..|
T Consensus       543 ~~~~ip~~~nf~~y~gpE~rfCPAgVYEyV~dE~~~~~krlqINaQNCiHCKtCDIKdP~QnI~W~vPeGGgGP~Y~~m  621 (621)
T KOG2415|consen  543 RDDDIPVKVNFPVYKGPESRFCPAGVYEYVPDEAGPVGKRLQINAQNCIHCKTCDIKDPKQNINWVVPEGGGGPKYTLM  621 (621)
T ss_pred             cCCCcchhcCcccccChhhccCCccceeecccccCCCcceEEEccccceecccccccCcccCceeeCcCCCCCCCcccC
Confidence            99999999999999999999999999999887644  359999999999999999999999999999999999999988

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>PF05187 ETF_QO: Electron transfer flavoprotein-ubiquinone oxidoreductase; InterPro: IPR007859 Electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>COG2440 FixX Ferredoxin-like protein [Energy production and conversion]	Back alignment and domain information

>PRK15449 ferredoxin-like protein FixX; Provisional	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>COG1146 Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>CHL00065 psaC photosystem I subunit VII	Back alignment and domain information

>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A	Back alignment and domain information

>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR01660 narH nitrate reductase, beta subunit	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only]	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>PRK05113 electron transport complex protein RnfB; Provisional	Back alignment and domain information

>KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion]	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>PRK14993 tetrathionate reductase subunit B; Provisional	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein	Back alignment and domain information

>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK09898 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit	Back alignment and domain information

>PRK09477 napH quinol dehydrogenase membrane component; Provisional	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit	Back alignment and domain information

>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>PRK10882 hydrogenase 2 protein HybA; Provisional	Back alignment and domain information

>TIGR02912 sulfite_red_C sulfite reductase, subunit C	Back alignment and domain information

>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>COG2768 Uncharacterized Fe-S center protein [General function prediction only]	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only	Back alignment and domain information

>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional	Back alignment and domain information

>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism]	Back alignment and domain information

>cd07030 RNAP_D D subunit of Archaeal RNA polymerase	Back alignment and domain information

>PRK09898 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein	Back alignment and domain information

>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>PRK00783 DNA-directed RNA polymerase subunit D; Provisional	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>PF13484 Fer4_16: 4Fe-4S double cluster binding domain	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK09326 F420H2 dehydrogenase subunit F; Provisional	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit	Back alignment and domain information

>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion]	Back alignment and domain information

>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B	Back alignment and domain information

>PRK14993 tetrathionate reductase subunit B; Provisional	Back alignment and domain information

>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit	Back alignment and domain information

>PRK10882 hydrogenase 2 protein HybA; Provisional	Back alignment and domain information

>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional	Back alignment and domain information

>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit	Back alignment and domain information

>PRK08493 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>TIGR02486 RDH reductive dehalogenase	Back alignment and domain information

>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK09477 napH quinol dehydrogenase membrane component; Provisional	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>PRK05035 electron transport complex protein RnfC; Provisional	Back alignment and domain information

>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification]	Back alignment and domain information

>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR01660 narH nitrate reductase, beta subunit	Back alignment and domain information

>PRK07860 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit	Back alignment and domain information

>PRK09129 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>PRK08166 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit	Back alignment and domain information

>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>PRK09130 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR00273 iron-sulfur cluster-binding protein	Back alignment and domain information

>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional	Back alignment and domain information

>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>TIGR00276 iron-sulfur cluster binding protein, putative	Back alignment and domain information

>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>PRK15033 tricarballylate utilization protein B; Provisional	Back alignment and domain information

>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]	Back alignment and domain information

>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion]	Back alignment and domain information

>COG1600 Uncharacterized Fe-S protein [Energy production and conversion]	Back alignment and domain information

>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA	Back alignment and domain information

>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion]	Back alignment and domain information

>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG	Back alignment and domain information

>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein	Back alignment and domain information

>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion]	Back alignment and domain information

>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C	Back alignment and domain information

>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>CHL00065 psaC photosystem I subunit VII	Back alignment and domain information

>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit	Back alignment and domain information

>PF13484 Fer4_16: 4Fe-4S double cluster binding domain	Back alignment and domain information

>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional	Back alignment and domain information

>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional	Back alignment and domain information

>COG1146 Ferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A	Back alignment and domain information

>COG1141 Fer Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B	Back alignment and domain information

>TIGR02910 sulfite_red_A sulfite reductase, subunit A	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PRK12385 fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK15055 anaerobic sulfite reductase subunit A; Provisional	Back alignment and domain information

>TIGR02484 CitB CitB domain protein	Back alignment and domain information

>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit	Back alignment and domain information

>PF13459 Fer4_15: 4Fe-4S single cluster domain	Back alignment and domain information

>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK05113 electron transport complex protein RnfB; Provisional	Back alignment and domain information

>KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion]	Back alignment and domain information

>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>COG0348 NapH Polyferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma	Back alignment and domain information

>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion]	Back alignment and domain information

>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>COG1141 Fer Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK12386 fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]	Back alignment and domain information

>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>PF13746 Fer4_18: 4Fe-4S dicluster domain	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed	Back alignment and domain information

>PRK00783 DNA-directed RNA polymerase subunit D; Provisional	Back alignment and domain information

>PF13459 Fer4_15: 4Fe-4S single cluster domain	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion]	Back alignment and domain information

>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein	Back alignment and domain information

>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A	Back alignment and domain information

>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>TIGR02912 sulfite_red_C sulfite reductase, subunit C	Back alignment and domain information

>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N	Back alignment and domain information

>cd07032 RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III	Back alignment and domain information

>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		388
2gmh_A		584	Structure Of Porcine Electron Transfer Flavoprotein		1e-128

>pdb|2GMH|A Chain A, Structure Of Porcine Electron Transfer Flavoprotein- Ubiquinone Oxidoreductase In Complexed With Ubiquinone Length = 584

Back alignment and structure

Iteration: 1

Score = 453 bits (1166), Expect = e-128, Method: Compositional matrix adjust. Identities = 222/401 (55%), Positives = 286/401 (71%), Gaps = 15/401 (3%) Query: 1 MGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIK 60 +GI KDG+ K F+RG+EL ++T+ AEGC G L+++L K F LR ++ + QTY +G+K Sbjct: 186 VGIQKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLR--ANCEPQTYGIGLK 243 Query: 61 EVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQ--IALGLVVALNYHNPFLNP 118 E+W IDE K PG + HT+GWPLD+ TYGGSFLYH+N+ + +ALG VV L+Y NP+L+P Sbjct: 244 ELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSP 303 Query: 119 YEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPK 178 + EFQ++KHHP+IKP LEGG + YGAR LNEGG QSIP FPGG +IGC+ GF+NVPK Sbjct: 304 FREFQRWKHHPSIKPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPK 363 Query: 179 IKGTHTAMKSGMLAAEAGFGVLHEDS--------NMEIYWDTLQKSWVWQELQRARNYRP 230 IKGTHTAMKSG LAAE+ F L ++ ++ Y D L+ SWVW+EL RN RP Sbjct: 364 IKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRP 423 Query: 231 AFE--YGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSF 288 + G+ G+ G+ ++I RG P+TLKH D + A+ +PIEYPKPDG +SF Sbjct: 424 SCHGILGVYGGMIYTGIFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISF 483 Query: 289 DVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEK-NQ 347 D+ +S+ S TNHEHDQPAHL L+D +P NL Y GPE R+CPA VYE+VP E+ + Sbjct: 484 DLLSSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDG 543 Query: 348 LKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM 388 +LQINAQNC+HCK CDIKDP QNI W VPEGGGGP Y+ M Sbjct: 544 FRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM 584

PyMOL of 2gmh

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		388
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	0.0
3atr_A		453	Conserved archaeal protein; saturating double bond	1e-22
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	7e-10
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	8e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	2e-04

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Length = 584	Back alignment and structure

 Score =  567 bits (1463), Expect = 0.0
 Identities = 222/401 (55%), Positives = 283/401 (70%), Gaps = 15/401 (3%)

Query: 1   MGIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIK 60
           +GI KDG+ K  F+RG+EL  ++T+ AEGC G L+++L K F LR     + QTY +G+K
Sbjct: 186 VGIQKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANC--EPQTYGIGLK 243

Query: 61  EVWEIDEGKHNPGEILHTLGWPLDQKTYGGSFLYHMNDRQ--IALGLVVALNYHNPFLNP 118
           E+W IDE K  PG + HT+GWPLD+ TYGGSFLYH+N+ +  +ALG VV L+Y NP+L+P
Sbjct: 244 ELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSP 303

Query: 119 YEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYPVFPGGAIIGCAAGFLNVPK 178
           + EFQ++KHHP+IKP LEGG  + YGAR LNEGG QSIP   FPGG +IGC+ GF+NVPK
Sbjct: 304 FREFQRWKHHPSIKPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPK 363

Query: 179 IKGTHTAMKSGMLAAEAGFGVLHEDS--------NMEIYWDTLQKSWVWQELQRARNYRP 230
           IKGTHTAMKSG LAAE+ F  L  ++        ++  Y D L+ SWVW+EL   RN RP
Sbjct: 364 IKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRP 423

Query: 231 AFE--YGLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSF 288
           +     G+  G+   G+ ++I RG  P+TLKH   D +    A+  +PIEYPKPDG +SF
Sbjct: 424 SCHGILGVYGGMIYTGIFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISF 483

Query: 289 DVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKN-Q 347
           D+ +S+  S TNHEHDQPAHL L+D  +P   NL  Y GPE R+CPA VYE+VP E+   
Sbjct: 484 DLLSSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDG 543

Query: 348 LKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM 388
            +LQINAQNC+HCK CDIKDP QNI W VPEGGGGP Y+ M
Sbjct: 544 FRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM 584

PyMOL of 2gmh

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		388
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	100.0
3oz2_A		397	Digeranylgeranylglycerophospholipid reductase; str	99.88
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	99.81
3atr_A		453	Conserved archaeal protein; saturating double bond	99.77
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	99.71
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	99.64
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	99.58
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	99.52
1k0i_A		394	P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h	99.39
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	99.36
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	99.31
2weu_A		511	Tryptophan 5-halogenase; regioselectivity, antifun	99.29
3fmw_A		570	Oxygenase; mithramycin, baeyer-villiger, flavin bi	99.28
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	99.26
2e4g_A		550	Tryptophan halogenase; flavin-binding, rebeccamyci	99.23
2qa1_A		500	PGAE, polyketide oxygenase PGAE; FAD, angucycline,	99.22
3ihg_A		535	RDME; flavoenzyme, anthracycline, polyketide biosy	99.22
2qa2_A		499	CABE, polyketide oxygenase CABE; FAD, angucycline,	99.21
2pyx_A		526	Tryptophan halogenase; structural genomics, JOI fo	99.2
2aqj_A		538	Tryptophan halogenase, pRNA; flavin-dependent halo	99.19
1pn0_A		665	Phenol 2-monooxygenase; two dimers, TLS refinement	99.18
4hb9_A		412	Similarities with probable monooxygenase; flavin,	99.15
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	99.12
2dkh_A		639	3-hydroxybenzoate hydroxylase; flavoprotein, monoo	99.05
3c4a_A		381	Probable tryptophan hydroxylase VIOD; alpha-beta p	99.02
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	99.01
2r0c_A		549	REBC; flavin adenine dinucleotide, monooxygenase,	98.92
1jb0_C		80	Photosystem I iron-sulfur center; membrane protein	98.89
7fd1_A		106	FD1, protein (7-Fe ferredoxin I); electron transpo	98.84
3eun_A		82	Ferredoxin; electron transport, [4Fe-4S] cluster,	98.81
1xer_A		103	Ferredoxin; electron transport, iron-sulfur, dupli	98.8
1dwl_A		59	Ferredoxin I; electron transfer, model, heteronucl	98.8
2fdn_A		55	Ferredoxin; electron transport, iron-sulfur, 4Fe-4	98.78
1bc6_A		77	7-Fe ferredoxin; electron transport, iron-sulfur;	98.77
2v2k_A		105	Ferredoxin; iron, transport, iron-sulfur, mycobact	98.76
2fgo_A		82	Ferredoxin; allochromatium vinosum, [4Fe-4S] clust	98.73
1h98_A		78	Ferredoxin; electron transport, thermophilic, iron	98.72
1rgv_A		80	Ferredoxin; electron transport; 2.90A {Thauera aro	98.68
3gyx_B		166	Adenylylsulfate reductase; oxidoreductase; HET: FA	98.67
1jnr_B		150	Adenylylsulfate reductase; oxidoreductase; HET: FA	98.67
2zvs_A		85	Uncharacterized ferredoxin-like protein YFHL; elec	98.54
3i9v_9		182	NADH-quinone oxidoreductase subunit 9; electron tr	98.52
3ihm_A		430	Styrene monooxygenase A; rossman fold, anti-parall	98.45
1dax_A		64	Ferredoxin I; electron transport, electron-transfe	98.45
1rof_A		60	Ferredoxin; electron transport, iron-sulfur; NMR {	98.41
1f2g_A		58	Ferredoxin II; electron transport, FDII desulfovib	98.36
2vpz_B		195	NRFC protein; oxidoreductase, molybdopterin guanin	98.31
1hfe_L		421	Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg	98.31
1iqz_A		81	Ferredoxin; iron-sulfer protein, ultlahigh resolut	98.28
2ivf_B		352	Ethylbenzene dehydrogenase beta-subunit; anaerobic	98.16
3or1_B		386	Sulfite reductase beta; dissimilatory sulfite redu	98.14
1ti6_B		274	Pyrogallol hydroxytransferase small subunit; molyb	98.11
1kqf_B		294	FDH-N beta S, formate dehydrogenase, nitrate-induc	98.11
1q16_B		512	Respiratory nitrate reductase 1 beta chain; membra	98.09
3mm5_B		366	Sulfite reductase, dissimilatory-type subunit BET;	98.05
1sj1_A		66	Ferredoxin; thermostability, iron-sulfur cluster,	98.02
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	97.95
2c42_A		1231	Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron,	97.91
3mm5_A		418	Sulfite reductase, dissimilatory-type subunit ALP;	97.77
3c8y_A		574	Iron hydrogenase 1; dithiomethylether, H-cluster,	97.77
1gte_A		1025	Dihydropyrimidine dehydrogenase; electron transfer	97.75
1ti6_B		274	Pyrogallol hydroxytransferase small subunit; molyb	97.7
1h0h_B		214	Formate dehydrogenase (small subunit); tungsten se	97.63
3or1_A		437	Sulfite reductase alpha; dissimilatory sulfite red	97.53
2ivf_B		352	Ethylbenzene dehydrogenase beta-subunit; anaerobic	97.47
2vpz_B		195	NRFC protein; oxidoreductase, molybdopterin guanin	97.41
3i9v_3		783	NADH-quinone oxidoreductase subunit 3; electron tr	97.38
1q16_B		512	Respiratory nitrate reductase 1 beta chain; membra	97.29
1h0h_B		214	Formate dehydrogenase (small subunit); tungsten se	97.27
1kqf_B		294	FDH-N beta S, formate dehydrogenase, nitrate-induc	97.16
3kkj_A		336	Amine oxidase, flavin-containing; oxidoreductase,	97.11
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	97.03
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	97.02
2pa8_D		265	DNA-directed RNA polymerase subunit D; ferredoxin-	96.98
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	96.7
3fpz_A		326	Thiazole biosynthetic enzyme; FAD, mitochondrion,	96.26
3eun_A		82	Ferredoxin; electron transport, [4Fe-4S] cluster,	96.26
1dwl_A		59	Ferredoxin I; electron transfer, model, heteronucl	96.25
1xer_A		103	Ferredoxin; electron transport, iron-sulfur, dupli	96.17
1dax_A		64	Ferredoxin I; electron transport, electron-transfe	96.03
1jb0_C		80	Photosystem I iron-sulfur center; membrane protein	95.98
2zvs_A		85	Uncharacterized ferredoxin-like protein YFHL; elec	95.95
1iqz_A		81	Ferredoxin; iron-sulfer protein, ultlahigh resolut	95.84
2fgo_A		82	Ferredoxin; allochromatium vinosum, [4Fe-4S] clust	95.82
1sj1_A		66	Ferredoxin; thermostability, iron-sulfur cluster,	95.79
1rgv_A		80	Ferredoxin; electron transport; 2.90A {Thauera aro	95.75
2fdn_A		55	Ferredoxin; electron transport, iron-sulfur, 4Fe-4	95.7
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	95.33
1rof_A		60	Ferredoxin; electron transport, iron-sulfur; NMR {	95.12
1bc6_A		77	7-Fe ferredoxin; electron transport, iron-sulfur;	95.0
2wdq_B		238	Succinate dehydrogenase iron-sulfur subunit; succi	94.87
1f2g_A		58	Ferredoxin II; electron transport, FDII desulfovib	94.84
1h98_A		78	Ferredoxin; electron transport, thermophilic, iron	94.35
7fd1_A		106	FD1, protein (7-Fe ferredoxin I); electron transpo	94.24
3i9v_9		182	NADH-quinone oxidoreductase subunit 9; electron tr	94.11
1kf6_B		243	Fumarate reductase iron-sulfur protein; respiratio	93.82
2v2k_A		105	Ferredoxin; iron, transport, iron-sulfur, mycobact	93.58
2c42_A		1231	Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron,	93.33
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	93.26
2h88_B		252	Succinate dehydrogenase IP subunit; complex II, me	92.73
1hfe_L		421	Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg	92.54
3cf4_A		807	Acetyl-COA decarboxylase/synthase alpha subunit; m	91.96
3nyc_A		381	D-arginine dehydrogenase; FAD, imino-arginine, oxi	91.92
2bs2_B		241	Quinol-fumarate reductase iron-sulfur subunit B; 2	90.11
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	88.87
3vr8_B		282	Iron-sulfur subunit of succinate dehydrogenase; me	87.97
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	86.88
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	86.06
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	85.44
3c8y_A		574	Iron hydrogenase 1; dithiomethylether, H-cluster,	83.79
1gte_A		1025	Dihydropyrimidine dehydrogenase; electron transfer	82.84
3da1_A		561	Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9	82.45
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	81.71
2qcu_A		501	Aerobic glycerol-3-phosphate dehydrogenase; glycer	81.55
3dme_A		369	Conserved exported protein; structural genomics, P	81.53
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	80.63

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A*	Back alignment and structure

Probab=100.00  E-value=3.7e-83  Score=673.86  Aligned_cols=385  Identities=58%  Similarity=1.075  Sum_probs=352.5

Q ss_pred             CCCCCCeeeeeeecCeEEEecEEEecccCCCccchhHHHhcCCCcccCCCCceEEEEEEEEEecCCCCCCCCcEEEEcCC
Q 016489            2 GIAKDGSKKENFQRGVELRGRITLLAEGCRGSLSEKLIKNFKLREKSHAQHQTYALGIKEVWEIDEGKHNPGEILHTLGW   81 (388)
Q Consensus         2 g~~~dG~~~~~~~~g~~i~Ak~vI~AdG~~s~lar~l~~~~gl~~~~~~~~~~~~lgvke~~~~~~~~~~~g~v~~~~G~   81 (388)
                      |+++||+++.+|++|.+++||+||+|||++|.+.++|++++|++  ....++.++++++++|.++.+.+.++.+.|++||
T Consensus       187 g~~~~G~~~~~~~~g~~i~Ad~VV~AdG~~S~vr~~l~~~~gl~--~~~~p~~~g~g~~~~~~v~~~~~~~~~~~~~~g~  264 (584)
T 2gmh_A          187 GIQKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLR--ANCEPQTYGIGLKELWVIDEKKWKPGRVDHTVGW  264 (584)
T ss_dssp             EECTTSCEEEEEECCCEEECSEEEECCCTTCHHHHHHHHHTTTT--TTSCCCCEEEEEEEEEECCGGGCCTTEEEEEEET
T ss_pred             cccCCCCcccccCCceEEECCEEEEeeCCCchHHHHHHHHhCCC--CCCCchhHHhhhhhheecCcccccCCeEEEEEec
Confidence            45678888888888999999999999999999999999999997  3456778999999999888777778888999999


Q ss_pred             CCCCCCcceeEEEEcC--CCEEEEEEEEecCCCCCCCChHHHHHHHHcCCCcccccCCCeeeeecceeeccCCCcCCCcc
Q 016489           82 PLDQKTYGGSFLYHMN--DRQIALGLVVALNYHNPFLNPYEEFQKFKHHPAIKPLLEGGTVVQYGARTLNEGGLQSIPYP  159 (388)
Q Consensus        82 p~~~~~~Gggwiy~~~--~~~vsVGlv~~l~~~~~~~~~~~~~~~~k~~P~i~~~l~~~~~~~yga~~ip~gg~~~~p~~  159 (388)
                      |+....+|++|+|+..  +++++||+++..++.++..++++.|++|++||.++++|++++++.|+++.++.++++.++++
T Consensus       265 ~~~~~~~gg~~~~~~~~~~~~~~vg~~~~~~~~~~~~~~~~~l~~~~~~p~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~  344 (584)
T 2gmh_A          265 PLDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRIAYGARALNEGGFQSIPKL  344 (584)
T ss_dssp             TSCTTSCEEEEEEECCSSSCEEEEEEEEETTCCCTTCCHHHHHHHHTTSTTTHHHHTTCEEEEEEEEEEECCGGGGCCCC
T ss_pred             cccCCcCCceEEEEecCCCCeEEEEEEEecCcccccCChHHHHHHHHhChHHHHHhCCCeEEEecceEccCCCcccCCcc
Confidence            8765567889999998  78999999999887777778899999999999999999999999999999999888888999


Q ss_pred             ccCCEEEEccCccccCCCCccchHHHHHHHHHHHHHHHHhhcc-----Cch---HHHHHHHHHHhhhHHHHHHHHhhhHH
Q 016489          160 VFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHE-----DSN---MEIYWDTLQKSWVWQELQRARNYRPA  231 (388)
Q Consensus       160 ~~~g~lLvGDAAG~vdp~~~~Gi~~Am~SG~lAAeai~~al~~-----~~~---l~~Y~~~~~~s~~~~el~~~r~~~~~  231 (388)
                      +.+|++||||||++++|++++|+++||.+|+++|+++.++++.     ..+   |+.|+++++++|+++||+.+|+++++
T Consensus       345 ~~~rv~LvGDAAh~~~P~~GqG~~~Ai~da~~LA~~L~~~~~~g~~~~~~a~~~L~~Ye~~r~~~~v~~~l~~~r~~~~~  424 (584)
T 2gmh_A          345 TFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPS  424 (584)
T ss_dssp             EETTEEECTTTTCCCBTTTTBCHHHHHHHHHHHHHHHHHHHTCCCCCCSSSSCCCTHHHHHHHTSHHHHHHHHTTTTTGG
T ss_pred             ccCCEEEEcccccccCccccccHHHHHHHHHHHHHHHHHHHHcCCcchhhhhhhHHHHHHHHHHhHHHHHHHHHhChhHH
Confidence            9999999999999999999999999999999999999998853     232   89999999999999999999999998


Q ss_pred             Hh-h-CChHHHHHHHHHHHHhcCCCCccccCCCCCcccchhhhcCCCCCCCCCCCCCCCCcccceEeecccccCCCCCCe
Q 016489          232 FE-Y-GLLPGLAICGLEHYILRGKSPYTLKHGKPDHEATDAARLHSPIEYPKPDGVLSFDVPTSLHRSNTNHEHDQPAHL  309 (388)
Q Consensus       232 ~~-~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~dg~ltfd~~~~v~~s~~~h~~d~~~Hl  309 (388)
                      |+ + |.||+|++.++++|+++|+.|||++|.++|+.++++++.++||+||||||+||||++|||++|||||+||||+||
T Consensus       425 ~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~hl  504 (584)
T 2gmh_A          425 CHGILGVYGGMIYTGIFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHL  504 (584)
T ss_dssp             GGSTTTHHHHHHHHHHHTTTTTTCCSCCCCCCSCGGGCCCCGGGSCCCCCCCCCSSSSCCHHHHHHTTTCBCCSSSCCSE
T ss_pred             HHHhhccHHHHHHHHHHHHHcCCCCCCccCCCCCCchhhhhHHhcCCCCCCCccccccccccchhhhccccccCCCCCeE
Confidence            86 3 999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCCCCcccCCCCCCCccccccCCceEEEecCCCCc-eeEEEecCCCccCCcccccCCCCCeeEECcCCCCCCcccCC
Q 016489          310 RLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDEKNQ-LKLQINAQNCLHCKACDIKDPKQNIKWTVPEGGGGPGYSVM  388 (388)
Q Consensus       310 ~v~d~~~c~~~~~~~~~~~c~~~CPa~~y~~~~~~~~~-~~~~i~~~~C~~Cg~C~~~cp~~~I~w~~p~gg~G~~y~~~  388 (388)
                      +|+|+++|...|++.|+++|+++|||+||++++++++. .+++||+++|+|||||+++||++||+|++|+||+||+|++|
T Consensus       505 ~~~d~~~~~~~~~~~~~~~c~~~CPa~~~~~~~~~~~~~~~~~i~~~~Ci~C~~C~~~cp~~~i~~~~p~gg~g~~~~~~  584 (584)
T 2gmh_A          505 TLKDDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  584 (584)
T ss_dssp             EESSTTHHHHTHHHHHCCTHHHHCTTCCEEEEECSSTTCEEEEECGGGCCCCCHHHHHCTTCCEEECCCSTTCBCCCSCC
T ss_pred             EEcCcccchhhchhhhcchhhhcCChhhEEEeecCCCCceEEEEeCCCCcCCCCchhhCCCCCceeECCCCCCCcCccCC
Confidence            99999999877788889999999999999994422232 27999999999999999999999999999999999999998

PyMOL of 2gmh

>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum}	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A*	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii}	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus}	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A*	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae}	Back alignment and structure

>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ...	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa}	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A*	Back alignment and structure

>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A*	Back alignment and structure

>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus}	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A*	Back alignment and structure

>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A	Back alignment and structure

>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces}	Back alignment and structure

>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens}	Back alignment and structure

>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces}	Back alignment and structure

>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina}	Back alignment and structure

>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A*	Back alignment and structure

>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A*	Back alignment and structure

>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens}	Back alignment and structure

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A*	Back alignment and structure

>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A*	Back alignment and structure

>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472}	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2	Back alignment and structure

>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A*	Back alignment and structure

>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C*	Back alignment and structure

>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ...	Back alignment and structure

>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A	Back alignment and structure

>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A	Back alignment and structure

>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1	Back alignment and structure

>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A	Back alignment and structure

>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A	Back alignment and structure

>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis}	Back alignment and structure

>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa}	Back alignment and structure

>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2	Back alignment and structure

>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1	Back alignment and structure

>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B*	Back alignment and structure

>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli}	Back alignment and structure

>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9*	Back alignment and structure

>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida}	Back alignment and structure

>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A	Back alignment and structure

>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A	Back alignment and structure

>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A	Back alignment and structure

>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B*	Back alignment and structure

>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A*	Back alignment and structure

>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A*	Back alignment and structure

>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum}	Back alignment and structure

>3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B*	Back alignment and structure

>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N*	Back alignment and structure

>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B*	Back alignment and structure

>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B*	Back alignment and structure

>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B*	Back alignment and structure

>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A*	Back alignment and structure

>3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A*	Back alignment and structure

>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A*	Back alignment and structure

>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A*	Back alignment and structure

>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N*	Back alignment and structure

>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5	Back alignment and structure

>3or1_A Sulfite reductase alpha; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_A* 2v4j_A* 2xsj_A*	Back alignment and structure

>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum}	Back alignment and structure

>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B*	Back alignment and structure

>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3*	Back alignment and structure

>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B*	Back alignment and structure

>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5	Back alignment and structure

>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B*	Back alignment and structure

>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV}	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D	Back alignment and structure

>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae}	Back alignment and structure

>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A	Back alignment and structure

>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1	Back alignment and structure

>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A	Back alignment and structure

>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A	Back alignment and structure

>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C*	Back alignment and structure

>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli}	Back alignment and structure

>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A*	Back alignment and structure

>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa}	Back alignment and structure

>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A	Back alignment and structure

>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1	Back alignment and structure

>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B*	Back alignment and structure

>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A	Back alignment and structure

>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A	Back alignment and structure

>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B*	Back alignment and structure

>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A	Back alignment and structure

>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2	Back alignment and structure

>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ...	Back alignment and structure

>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9*	Back alignment and structure

>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B*	Back alignment and structure

>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis}	Back alignment and structure

>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A*	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ...	Back alignment and structure

>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A*	Back alignment and structure

>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri}	Back alignment and structure

>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A*	Back alignment and structure

>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B*	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A*	Back alignment and structure

>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B*	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A*	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A*	Back alignment and structure

>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A*	Back alignment and structure

>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans}	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A*	Back alignment and structure

>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A*	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis}	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		388
d2gmha1		380	c.3.1.2 (A:4-236,A:336-482) Electron transfer flav	4e-48
d2gmha1		380	c.3.1.2 (A:4-236,A:336-482) Electron transfer flav	1e-04
d2gmha3		102	d.58.1.6 (A:483-584) Electron transfer flavoprotei	7e-47
d2gmha2		99	d.16.1.8 (A:237-335) Electron transfer flavoprotei	3e-42
d2gjca1		311	c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th	4e-04

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  165 bits (418), Expect = 4e-48
 Identities = 71/146 (48%), Positives = 90/146 (61%), Gaps = 10/146 (6%)

Query: 152 GLQSIPYPVFPGGAIIGCAAGFLNVPKIKGTHTAMKSGMLAAEAGFGVLHEDSNME---- 207
           G QSIP   FPGG +IGC+ GF+NVPKIKGTHTAMKSG LAAE+ F  L  ++       
Sbjct: 235 GFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIG 294

Query: 208 ----IYWDTLQKSWVWQELQRARNYRPAFE--YGLLPGLAICGLEHYILRGKSPYTLKHG 261
                Y D L+ SWVW+EL   RN RP+     G+  G+   G+ ++I RG  P+TLKH 
Sbjct: 295 LHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFRGMEPWTLKHK 354

Query: 262 KPDHEATDAARLHSPIEYPKPDGVLS 287
             D +    A+  +PIEYPKPDG +S
Sbjct: 355 GSDSDQLKPAKDCTPIEYPKPDGQIS 380

PyMOL of d2gmha1

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380	Back information, alignment and structure

>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 102	Back information, alignment and structure

>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 99	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		388
d2gmha3		102	Electron transfer flavoprotein-ubiquinone oxidored	100.0
d2gmha1		380	Electron transfer flavoprotein-ubiquinone oxidored	100.0
d2gmha2		99	Electron transfer flavoprotein-ubiquinone oxidored	99.95
d1bc6a_		77	Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	99.06
d1h98a_		77	Ferredoxin {Thermus thermophilus [TaxId: 274]}	99.05
d2fdna_		55	Ferredoxin II {Clostridium acidurici [TaxId: 1556]	98.92
d7fd1a_		106	Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	98.91
d1blua_		80	Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	98.91
d1xera_		103	Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	98.91
d1jnrb_		149	Adenylylsulfate reductase B subunit {Archaeon Arch	98.88
d1hfel2		85	Fe-only hydrogenase larger subunit, N-domain {Desu	98.86
d1jb0c_		80	Photosystem I iron-sulfur protein PsaC {Synechococ	98.84
d1dura_		55	Ferredoxin II {Peptostreptococcus asaccharolyticus	98.8
d3c7bb1		65	DsrB insert domain {Archaeoglobus fulgidus [TaxId:	98.76
d1rgva_		80	Ferredoxin II {Thauera aromatica [TaxId: 59405]}	98.72
d2fug91		154	NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus	98.64
d1vjwa_		59	Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	98.58
d1gtea5		173	Dihydropyrimidine dehydrogenase, C-terminal domain	98.46
d2c42a5		117	Pyruvate-ferredoxin oxidoreductase, PFOR, domain V	98.36
d1kqfb1		244	Formate dehydrogenase N, iron-sulfur (beta) subuni	98.36
d1y5ib1		509	Respiratory nitrate reductase 1 beta chain {Escher	98.34
d3c8ya3		83	Fe-only hydrogenase, second domain {Clostridium pa	98.3
d1fxra_		64	Ferredoxin I {Sulfate-reducing bacteria (Desulfovi	98.29
d1vlfn2		195	Transhydroxylase beta subunit, BthL, N-terminal do	98.2
d1iqza_		81	Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1	98.07
d1sj1a_		66	Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI	98.03
d1fxda_		58	Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	98.01
d1pn0a1		360	Phenol hydroxylase {Soil-living yeast (Trichosporo	97.89
d2fug34		151	NADH-quinone oxidoreductase chain 3, Nqo3, domain	97.39
d1vlfn2		195	Transhydroxylase beta subunit, BthL, N-terminal do	97.08
d2v4jb1		69	DsrB insert domain {Desulfovibrio vulgaris [TaxId:	96.98
d1y5ib1		509	Respiratory nitrate reductase 1 beta chain {Escher	96.95
d1kqfb1		244	Formate dehydrogenase N, iron-sulfur (beta) subuni	96.88
d1hfel2		85	Fe-only hydrogenase larger subunit, N-domain {Desu	96.85
d1h0hb_		214	Tungsten containing formate dehydrogenase, small s	96.74
d3c7ba1		66	DsrA insert domain {Archaeoglobus fulgidus [TaxId:	96.74
d1blua_		80	Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	96.66
d1xera_		103	Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	96.57
d2fdna_		55	Ferredoxin II {Clostridium acidurici [TaxId: 1556]	96.47
d1jb0c_		80	Photosystem I iron-sulfur protein PsaC {Synechococ	96.47
d2v4ja1		81	DsrA insert domain {Desulfovibrio vulgaris [TaxId:	96.46
d3c96a1		288	Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId:	96.18
d1rgva_		80	Ferredoxin II {Thauera aromatica [TaxId: 59405]}	95.88
d1b5qa1		347	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	95.56
d1dura_		55	Ferredoxin II {Peptostreptococcus asaccharolyticus	95.54
d2gjca1		311	Thiazole biosynthetic enzyme Thi4 {Baker's yeast (	95.38
d1bc6a_		77	Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	95.3
d1fxra_		64	Ferredoxin I {Sulfate-reducing bacteria (Desulfovi	95.18
d1vjwa_		59	Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	95.15
d2c42a5		117	Pyruvate-ferredoxin oxidoreductase, PFOR, domain V	94.95
d1sj1a_		66	Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI	94.74
d1h98a_		77	Ferredoxin {Thermus thermophilus [TaxId: 274]}	94.49
d3c8ya3		83	Fe-only hydrogenase, second domain {Clostridium pa	94.44
d1h0hb_		214	Tungsten containing formate dehydrogenase, small s	94.21
d7fd1a_		106	Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	93.54
d2fug91		154	NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus	92.81
d1iqza_		81	Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1	92.46
d1gtea5		173	Dihydropyrimidine dehydrogenase, C-terminal domain	92.37
d1fxda_		58	Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	92.2
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	90.96
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	86.6
d1k0ia1		292	p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a	85.52
d3c7bb1		65	DsrB insert domain {Archaeoglobus fulgidus [TaxId:	85.26
d2dw4a2		449	Lysine-specific histone demethylase 1, LSD1 {Human	84.39
d1nekb1		132	Succinate dehydogenase {Escherichia coli [TaxId: 5	83.18
d1jnrb_		149	Adenylylsulfate reductase B subunit {Archaeon Arch	82.58
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	80.94
d1neka2		330	Succinate dehydogenase {Escherichia coli [TaxId: 5	80.55

>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: 4Fe-4S ferredoxins
family: ETF-QO domain-like
domain: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=4.7e-45  Score=293.33  Aligned_cols=101  Identities=64%  Similarity=1.169  Sum_probs=96.1

Q ss_pred             CCcccceEeecccccCCCCCCeEecCCCCCcccCCCCCCCccccccCCceEEEecCC-CCceeEEEecCCCccCCccccc
Q 016489          288 FDVPTSLHRSNTNHEHDQPAHLRLRDPKIPELVNLPEYAGPESRYCPARVYEYVPDE-KNQLKLQINAQNCLHCKACDIK  366 (388)
Q Consensus       288 fd~~~~v~~s~~~h~~d~~~Hl~v~d~~~c~~~~~~~~~~~c~~~CPa~~y~~~~~~-~~~~~~~i~~~~C~~Cg~C~~~  366 (388)
                      ||||||||+|||+|+||||+||+|+|+++|+..++++|++||+++|||+|||+++++ +..++++||++||+|||||+|+
T Consensus         1 FD~lssv~~sgt~HeEdQP~HL~ikd~~i~~~~~~~~y~~Pc~r~CPAgVYE~~~~~~~~~~~l~In~~nCleC~tC~i~   80 (102)
T d2gmha3           1 FDLLSSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIK   80 (102)
T ss_dssp             CCHHHHHHTTTCBCCSSSCCSEEESSTTHHHHTHHHHHCCTHHHHCTTCCEEEEECSSTTCEEEEECGGGCCCCCHHHHH
T ss_pred             CCccceeeecCCCCCCCCCceEEecCcchhhhcccccccchheeeccceEEEEeecCCCCccEEEEEeCCceeeccceee
Confidence            999999999999999999999999999999998899999999999999999998754 3346899999999999999999


Q ss_pred             CCCCCeeEECcCCCCCCcccCC
Q 016489          367 DPKQNIKWTVPEGGGGPGYSVM  388 (388)
Q Consensus       367 cp~~~I~w~~p~gg~G~~y~~~  388 (388)
                      ||+++|+|++||||+||+|++|
T Consensus        81 ~p~~nI~W~~P~GG~Gp~Y~~m  102 (102)
T d2gmha3          81 DPSQNINWVVPEGGGGPAYNGM  102 (102)
T ss_dssp             CTTCCEEECCCSTTCBCCCSCC
T ss_pred             CCCCceEEECCCCCCCcCCCCC
Confidence            9999999999999999999999

PyMOL of d2gmha3

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	Back information, alignment and structure

>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]}	Back information, alignment and structure

>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	Back information, alignment and structure

>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	Back information, alignment and structure

>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]}	Back information, alignment and structure

>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]}	Back information, alignment and structure

>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]}	Back information, alignment and structure

>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]}	Back information, alignment and structure

>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}	Back information, alignment and structure

>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]}	Back information, alignment and structure

>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}	Back information, alignment and structure

>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]}	Back information, alignment and structure

>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}	Back information, alignment and structure

>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}	Back information, alignment and structure

>d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]}	Back information, alignment and structure

>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]}	Back information, alignment and structure

>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d3c7ba1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]}	Back information, alignment and structure

>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]}	Back information, alignment and structure

>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]}	Back information, alignment and structure

>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]}	Back information, alignment and structure

>d2v4ja1 d.58.1.5 (A:242-322) DsrA insert domain {Desulfovibrio vulgaris [TaxId: 881]}	Back information, alignment and structure

>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]}	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]}	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]}	Back information, alignment and structure

>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]}	Back information, alignment and structure

>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}	Back information, alignment and structure

>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]}	Back information, alignment and structure

>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure