Citrus Sinensis ID: 016506

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MAVQAQYPSNVLLLNRNSQEGHDYSLQPQPGGFLDQSYMLFNNGGPFSIPTLLCLKSLLIEMNKYQDSEFAMPPCSGNNNNNPRKRGREVAAANTTTTTSITAAPMNHYSISMQSQQTPQLINLSQLHNHHQPNVVSTGLRLSFGDQQQRQQQQQQQQLQQTPHHHHQQQQQQQNIMCQSPSLLSFLSDDLASPIKRQRDELDQFLQAQGEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQVWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYVDPDRVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFLS
cccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccEEEEEccccccccccHHHHccccccccccccEEEEEEEc
cccEEcccccEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHcccccccccEEcccEEEcccccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccccHHHccccHHHccccccccccHHccccccEEEEEEEcccEEEcccHHHHHccccccHcccccEEEEEEc
mavqaqypsnvlllnrnsqeghdyslqpqpggfldqsymlfnnggpfsipTLLCLKSLLIEMNkyqdsefamppcsgnnnnnprkrgrevaaantttttsitaapmnhysismqsqqtpqlinlsqlhnhhqpnvvstglrlsfgdQQQRQQQQQQQQlqqtphhhhqqqqqqqnimcqspsllsflsddlaspikRQRDELDQFLQAQGEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQVWQAKARAQEATAASLQAQLQQAIMSgagcgaqdsrrgddglmctgevaedaesayvdpdrvvsvpvsgpackgcrkrvasvvllpcrhlcvctecdrvvqacplcfnvrdsSVEVFLS
MAVQAQYPSNVLLLNRNSQEGHDYSLQPQPGGFLDQSYMLFNNGGPFSIPTLLCLKSLLIEMNKYQDSEfamppcsgnnnnnprkrGREVAAANTTTTTSITAAPMNHYSISMQSQQTPQLINLSQLHNHHQPNVVSTGLRLSFGDQQQRQQQQQQQQLQQTPHHHHQQQQQQQNIMCQSPSLLSFLSDDLASPIKRQRDELDQFLQAQGEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQVWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEdaesayvdpdrvvsvpvsgpackgcrkRVASVVLLPCRHLCVCTECDRVVQACPLcfnvrdssvevfls
MAVQAQYPSNVLLLNRNSQEGHDYSLQPQPGGFLDQSYMLFNNGGPFSIPTLLCLKSLLIEMNKYQDSEFAMPPCSGnnnnnPRKRGREVaaantttttsitaaPMNHYSISMQSQQTPQLINLSQLHNHHQPNVVSTGLRLSFGDqqqrqqqqqqqqlqqtphhhhqqqqqqqNIMCQspsllsflsddlaspIKRQRDELDQFLQAQGEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQVWQakaraqeataaslqaqlqqaIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYvdpdrvvsvpvsGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFLS
*******************************GFLDQSYMLFNNGGPFSIPTLLCLKSLLIEMNKY******************************************************************************************************************************************************************LL***********************************************************************************C**********AYVDPDRVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVE****
*AV*A*YPSNVLL*************************************************NKYQDSEF*************************************************************************************************************************ASPIKRQRDELDQFLQAQGEQLR***************GAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQVWQA********AASLQAQL*********************************************PVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFLS
MAVQAQYPSNVLLLNRNSQEGHDYSLQPQPGGFLDQSYMLFNNGGPFSIPTLLCLKSLLIEMNKYQDSEFAMPPCSGNNNNNPRKRGREVAAANTTTTTSITAAPMNHYSISMQSQQTPQLINLSQLHNHHQPNVVSTGLRLSF*******************************IMCQSPSLLSFLSDDLASPIKRQRDELDQFLQAQGEQLRRALAEKRQRHYRALLGAAEESIARLLREK**********NAELEARAA************************AQLQQAIMSG*********RGDDGLMCTGEVAEDAESAYVDPDRVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFLS
*AVQAQYPSNVLLLNRN*QEGHDYSLQPQPGGFLDQSYMLFNNGGPFSIPTL***********KYQDSEFAMPPCS***********************SITAAPMNHYSISMQSQQTPQLINLSQLHNHHQPNVVSTGLRLSFGD***********************************SLLSFLSDDLASPIKRQRDELDQFLQAQGEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQVWQAKARAQEATAASLQAQLQQAIMSGAG***************************************GPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVQAQYPSNVLLLNRNSQEGHDYSLQPQPGGFLDQSYMLFNNGGPFSIPTLLCLKSLLIEMNKYQDSEFAMPPCSGNNNNNPRKRGREVAAANTTTTTSITAAPMNHYSISMQSQQTPQLINLSQLHNHHQPNVVSTGLRLSFGDQQQRQQQQQQQQLQQTPHHHHQQQQQQQNIMCQSPSLLSFLSDDLASPIKRQRDELDQFLQAQGEQLRRALAEKRQRHYRALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAESAYVDPDRVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query388 2.2.26 [Sep-21-2011]
Q13490618 Baculoviral IAP repeat-co yes no 0.126 0.079 0.428 1e-05
Q62210612 Baculoviral IAP repeat-co yes no 0.126 0.080 0.428 2e-05
O08863600 Baculoviral IAP repeat-co no no 0.123 0.08 0.416 3e-05
Q60989496 E3 ubiquitin-protein liga no no 0.123 0.096 0.375 4e-05
Q90660611 Inhibitor of apoptosis pr yes no 0.126 0.080 0.408 4e-05
P98170497 E3 ubiquitin-protein liga no no 0.123 0.096 0.375 4e-05
Q13489604 Baculoviral IAP repeat-co no no 0.126 0.081 0.387 6e-05
Q95M71236 Baculoviral IAP repeat-co N/A no 0.123 0.203 0.437 6e-05
Q95M72236 Baculoviral IAP repeat-co no no 0.123 0.203 0.437 7e-05
Q96P09236 Baculoviral IAP repeat-co no no 0.123 0.203 0.437 7e-05
>sp|Q13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens GN=BIRC2 PE=1 SV=2 Back     alignment and function desciption
 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%)

Query: 340 ACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFLS 388
            CK C  +  SVV +PC HL VC EC   ++ CP+C  +   +V  FLS
Sbjct: 570 TCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS 618
Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling, and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and regulates both canonical and non-canonical NF-kappa-B signaling by acting in opposite directions: acts as a positive regulator of the canonical pathway and suppresses constitutive activation of non-canonical NF-kappa-B signaling. The target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, RIPK2, RIPK3, RIPK4, CASP3, CASP7, CASP8, TRAF2, DIABLO/SMAC, MAP3K14/NIK, MAP3K5/ASK1, IKBKG/NEMO and MXD1/MAD1. Can also function as an E3 ubiquitin-protein ligase of the NEDD8 conjugation pathway, targeting effector caspases for neddylation and inactivation. Acts as an important regulator of innate immune signaling via regulation of Toll-like receptors (TLRs), Nodlike receptors (NLRs) and RIG-I like receptors (RLRs), collectively referred to as pattern recognition receptors (PRRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8. Can stimulate the transcriptional activity of E2F1. Plays a role in the modulation of the cell cycle.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q62210|BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus GN=Birc2 PE=1 SV=1 Back     alignment and function description
>sp|O08863|BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus GN=Birc3 PE=1 SV=2 Back     alignment and function description
>sp|Q60989|XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus GN=Xiap PE=1 SV=2 Back     alignment and function description
>sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus GN=ITA PE=2 SV=1 Back     alignment and function description
>sp|P98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens GN=XIAP PE=1 SV=2 Back     alignment and function description
>sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens GN=BIRC3 PE=1 SV=2 Back     alignment and function description
>sp|Q95M71|BIRC8_GORGO Baculoviral IAP repeat-containing protein 8 OS=Gorilla gorilla gorilla GN=BIRC8 PE=2 SV=1 Back     alignment and function description
>sp|Q95M72|BIRC8_PANTR Baculoviral IAP repeat-containing protein 8 OS=Pan troglodytes GN=BIRC8 PE=2 SV=1 Back     alignment and function description
>sp|Q96P09|BIRC8_HUMAN Baculoviral IAP repeat-containing protein 8 OS=Homo sapiens GN=BIRC8 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
224126395345 predicted protein [Populus trichocarpa] 0.853 0.959 0.64 1e-115
225427360337 PREDICTED: uncharacterized protein LOC10 0.842 0.970 0.618 1e-111
297742185314 unnamed protein product [Vitis vinifera] 0.806 0.996 0.609 1e-106
449534077328 PREDICTED: uncharacterized protein LOC10 0.845 1.0 0.585 1e-100
449461287328 PREDICTED: uncharacterized protein LOC10 0.845 1.0 0.582 1e-100
356511213350 PREDICTED: uncharacterized protein LOC10 0.886 0.982 0.571 1e-95
356563424357 PREDICTED: uncharacterized protein LOC10 0.891 0.969 0.571 8e-92
357482255335 Baculoviral IAP repeat-containing protei 0.837 0.970 0.497 1e-82
224138808313 predicted protein [Populus trichocarpa] 0.530 0.658 0.767 4e-79
449459030331 PREDICTED: uncharacterized protein LOC10 0.840 0.984 0.539 5e-78
>gi|224126395|ref|XP_002329543.1| predicted protein [Populus trichocarpa] gi|222870252|gb|EEF07383.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  422 bits (1084), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 256/400 (64%), Positives = 277/400 (69%), Gaps = 69/400 (17%)

Query: 1   MAVQAQYPSNVLLLNRNSQEGHDYSLQPQPGGFLDQSYMLFNNGGPFSIPTLLCLKSLLI 60
           MAVQAQYPSN+LLLNRN QEG DYSLQPQPGG+LDQS ML NNGG               
Sbjct: 1   MAVQAQYPSNILLLNRNGQEGQDYSLQPQPGGYLDQSSMLLNNGG--------------- 45

Query: 61  EMNKYQDSEFAMPPCSGNNNNNPRKRGREVAAANTTTTTSITAAPMNHYSISMQSQ--QT 118
                               NN RKRGR      T TTT+I     N + +  Q Q   T
Sbjct: 46  -------------------GNNQRKRGRAAPTGTTATTTTI-----NQFCMQPQPQPLST 81

Query: 119 PQLINLSQLHNH--HQP----NVVSTGLRLSFGDQQQRQQQQQQQQLQQTPHHHHQQQQQ 172
            QLI+LSQLHNH  HQP    NVVSTGLRLSFGDQQQ+    QQQ               
Sbjct: 82  TQLIDLSQLHNHRHHQPQPNPNVVSTGLRLSFGDQQQQNHHYQQQNFGTG---------- 131

Query: 173 QQNIMCQSPSLLSFLSDDLASPIKRQRDELDQFLQAQGEQLRRALAEKRQRHYRALLGAA 232
                CQS +LLS  S+D +  IKRQRDE+DQFLQAQGEQLRR LAEKRQRHYRALLGAA
Sbjct: 132 ----ACQSSALLSLSSEDFSIQIKRQRDEIDQFLQAQGEQLRRTLAEKRQRHYRALLGAA 187

Query: 233 EESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQVWQAKARAQEATAASLQAQLQQA 292
           EESIAR LREKE E+EKATRRNAELEARA QLS++AQVWQAK R QE TAASLQAQLQQA
Sbjct: 188 EESIARRLREKEMEIEKATRRNAELEARATQLSIDAQVWQAKVRTQEVTAASLQAQLQQA 247

Query: 293 IMSGAGCGAQDSRRGDDGLMCTGEV-----AEDAESAYVDPDRVVSVPVSGPACKGCRKR 347
           IM+G    AQDSRRGDDG+ C G V     AEDAESAYVDPDRV  VP  GP+CK CRKR
Sbjct: 248 IMNGG--LAQDSRRGDDGIGCPGGVEGQTQAEDAESAYVDPDRVTVVP-GGPSCKACRKR 304

Query: 348 VASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL 387
           +ASVVLLPCRHLCVCTECD+VV ACPLC +VR+SSVEVFL
Sbjct: 305 MASVVLLPCRHLCVCTECDQVVPACPLCLHVRNSSVEVFL 344

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225427360|ref|XP_002279666.1| PREDICTED: uncharacterized protein LOC100265998 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742185|emb|CBI33972.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449534077|ref|XP_004173995.1| PREDICTED: uncharacterized protein LOC101229955 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449461287|ref|XP_004148373.1| PREDICTED: uncharacterized protein LOC101213134 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356511213|ref|XP_003524323.1| PREDICTED: uncharacterized protein LOC100788122 [Glycine max] Back     alignment and taxonomy information
>gi|356563424|ref|XP_003549963.1| PREDICTED: uncharacterized protein LOC100788924 [Glycine max] Back     alignment and taxonomy information
>gi|357482255|ref|XP_003611413.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] gi|355512748|gb|AES94371.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] gi|388517983|gb|AFK47053.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224138808|ref|XP_002326695.1| predicted protein [Populus trichocarpa] gi|222834017|gb|EEE72494.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449459030|ref|XP_004147249.1| PREDICTED: uncharacterized protein LOC101209391 [Cucumis sativus] gi|449521691|ref|XP_004167863.1| PREDICTED: uncharacterized LOC101209391 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
TAIR|locus:2035564312 AT1G32740 "AT1G32740" [Arabido 0.476 0.592 0.507 2.1e-63
TAIR|locus:2171042300 AT5G47050 [Arabidopsis thalian 0.492 0.636 0.479 1.1e-51
TAIR|locus:2129336314 AT4G17680 [Arabidopsis thalian 0.479 0.592 0.468 1.5e-50
TAIR|locus:2036596340 AT1G60610 [Arabidopsis thalian 0.487 0.555 0.304 8.4e-28
TAIR|locus:2019983339 AT1G10650 [Arabidopsis thalian 0.489 0.560 0.292 3.1e-26
TAIR|locus:2825812325 SBP1 "S-ribonuclease binding p 0.471 0.563 0.305 1.8e-23
TAIR|locus:2131571265 AT4G35070 "AT4G35070" [Arabido 0.476 0.698 0.292 2.1e-23
TAIR|locus:2207385358 BRG2 "BOI-related gene 2" [Ara 0.5 0.541 0.267 4.3e-21
TAIR|locus:2133990304 RING [Arabidopsis thaliana (ta 0.461 0.588 0.296 2.8e-18
TAIR|locus:2153227294 BRG1 "BOI-related gene 1" [Ara 0.479 0.632 0.301 4.6e-18
TAIR|locus:2035564 AT1G32740 "AT1G32740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 462 (167.7 bits), Expect = 2.1e-63, Sum P(3) = 2.1e-63
 Identities = 98/193 (50%), Positives = 119/193 (61%)

Query:   195 IKRQRDELDQFLQAQGEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRN 254
             I RQ +ELD+FL AQ E+LRR LAEKR+ HY+ALLGA EES+ R LREKE E+E+ATRR+
Sbjct:   121 INRQSEELDEFLHAQAEELRRTLAEKRKMHYKALLGAVEESLVRKLREKEVEIERATRRH 180

Query:   255 AELEARAAQLSVEAQVWQXXXXXXXXXXXXXXXXXXXXIMSGAG-C-GAQDSRRGDDGLM 312
              EL AR +QL  E QVWQ                    +   AG C  AQDSR  ++GL+
Sbjct:   181 NELVARDSQLRAEVQVWQERAKAHEDAAASLQSQLQQAVNQCAGGCVSAQDSRAAEEGLL 240

Query:   313 CTG-EVAEDAESAYXXXXXXXXXXXXGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQA 371
             CT     +DAES Y             P CK CR+R A+VV+LPCRHL +C  CDR   A
Sbjct:   241 CTTISGVDDAESVYVDPERVKR-----PNCKACREREATVVVLPCRHLSICPGCDRTALA 295

Query:   372 CPLCFNVRDSSVE 384
             CPLC  +R+SSVE
Sbjct:   296 CPLCLTLRNSSVE 308
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2171042 AT5G47050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129336 AT4G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036596 AT1G60610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019983 AT1G10650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825812 SBP1 "S-ribonuclease binding protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131571 AT4G35070 "AT4G35070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207385 BRG2 "BOI-related gene 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133990 RING [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153227 BRG1 "BOI-related gene 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01180075
hypothetical protein (346 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
pfam13779820 pfam13779, DUF4175, Domain of unknown function (DU 4e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
PRK14475167 PRK14475, PRK14475, F0F1 ATP synthase subunit B; P 6e-04
COG1390194 COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase su 6e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.001
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 0.001
COG3064387 COG3064, TolA, Membrane protein involved in colici 0.001
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 0.002
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 0.002
PRK11448 1123 PRK11448, hsdR, type I restriction enzyme EcoKI su 0.004
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 49.7 bits (119), Expect = 2e-08
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 341 CKGCRKRVASVVLLPCRHLCVCTECD---RVVQACPLC 375
           C  C +R  +VV LPC HLC+C EC    R  + CP+C
Sbjct: 5   CVICLERPRNVVFLPCGHLCLCEECAKRLRSKKKCPIC 42

Length = 49
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|184697 PRK14475, PRK14475, F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|224308 COG1390, NtpE, Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 388
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.17
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.95
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.81
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.74
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.67
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.89
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.83
PF1463444 zf-RING_5: zinc-RING finger domain 97.31
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.29
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 97.27
PHA02929238 N1R/p28-like protein; Provisional 97.24
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.14
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.06
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 96.99
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.9
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.81
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.72
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 96.61
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 96.38
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.26
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 96.13
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.0
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 95.91
PHA02926242 zinc finger-like protein; Provisional 95.85
smart0050463 Ubox Modified RING finger domain. Modified RING fi 95.08
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 94.99
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.93
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 94.82
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 94.18
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 94.07
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.06
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 93.24
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 92.69
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 92.63
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 91.12
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 90.79
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 89.67
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 89.61
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 89.21
PF00038312 Filament: Intermediate filament protein; InterPro: 88.96
PF12240205 Angiomotin_C: Angiomotin C terminal; InterPro: IPR 88.85
KOG2113394 consensus Predicted RNA binding protein, contains 87.78
PF04641260 Rtf2: Rtf2 RING-finger 86.73
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 85.52
KOG3002 299 consensus Zn finger protein [General function pred 85.01
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 84.38
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 84.07
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 83.99
COG5152259 Uncharacterized conserved protein, contains RING a 83.67
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 83.57
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 83.1
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 81.88
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.6e-39  Score=301.09  Aligned_cols=192  Identities=46%  Similarity=0.774  Sum_probs=167.7

Q ss_pred             hhhhhhhhhhHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHH
Q 016506          190 DLASPIKRQRDELDQFLQAQGEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAAQLSVEAQ  269 (388)
Q Consensus       190 ~L~~ql~qQ~~EID~~ir~q~ErLR~~LeE~RqRh~ralL~avE~~~a~rLReKEeEIera~rrn~ELEERlrqL~~E~Q  269 (388)
                      ++++++++|..|||+|++.++|+||..+.+.++|+++.++.++|..+.++||+|++||++++++||+|+|+++++.+|+|
T Consensus        15 ~~~~~~~~q~~~id~f~~~~~~~l~~~~~~~~~~~~~~~l~~~e~~~~~~l~~k~~ei~~~~~~~~~l~~~~~~~~~e~~   94 (207)
T KOG1100|consen   15 DLASDIQRQSDEIDRFLKIQGEQLRRELEENRQRELRNLLKAVEEALVKKLREKDEEIERIGNLNWELEERVKSLYVEAQ   94 (207)
T ss_pred             cceeecccccchhhHHHHhhHHHHHHHHHHhChHHHHHHHHHHHHHHHHHhhcchhHHHhcccccceehhhhhhhhhhHH
Confidence            88899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHccCCCCCCCCCCCCCCC-CCCCCccccccccccCCCccccCCCcccccccccccc
Q 016506          270 VWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGL-MCTGEVAEDAESAYVDPDRVVSVPVSGPACKGCRKRV  348 (388)
Q Consensus       270 aWQ~~A~~nEA~a~~Lr~~LqQ~la~~a~~~~~~s~~g~~~~-~c~g~~aeDAeSc~~d~~~~~~~~~~~~~C~IC~~~e  348 (388)
                      .|+++|++||+++++|+.+|+|++.+.. .   ....++++. +++.-+.||++|++++++.......  ..|+.|.+++
T Consensus        95 ~w~~~a~~ne~~~~~l~~nl~q~~~~~~-~---~~~~~~~~~~~~g~~~~~~~~s~~~~~~~~~~~~~--~~Cr~C~~~~  168 (207)
T KOG1100|consen   95 IWRDRAQTNEATVNSLRTNLDQVLAQCP-A---SAPAEERGQKSCGDREADDGKSSYVDPSVDNFKRM--RSCRKCGERE  168 (207)
T ss_pred             HHHHHHHhChHHHHHHHHHHHHHHHhcc-c---ccCchhhhccccCccccccccccccchhhhhhhcc--ccceecCcCC
Confidence            9999999999999999999999999851 1   111122221 1222357899998888765432111  2299999999


Q ss_pred             cceEEeCCCCcccccchHhhCCCCCCCccccCceEEEee
Q 016506          349 ASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  387 (388)
Q Consensus       349 a~vlLLPCrHlclC~~C~~~l~~CPVCR~~i~~sV~V~l  387 (388)
                      +.|+|+||+|+|+|..|+..+..||+|+.+++++|+||+
T Consensus       169 ~~VlllPCrHl~lC~~C~~~~~~CPiC~~~~~s~~~v~~  207 (207)
T KOG1100|consen  169 ATVLLLPCRHLCLCGICDESLRICPICRSPKTSSVEVNF  207 (207)
T ss_pred             ceEEeecccceEecccccccCccCCCCcChhhceeeccC
Confidence            999999999999999999989999999999999999986

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 2e-06
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 2e-05
4ic2_A74 Crystal Structure Of The Xiap Ring Domain Length = 2e-05
2ecg_A75 Solution Structure Of The Ring Domain Of The Baculo 3e-05
4ic3_A74 Crystal Structure Of The F495l Mutant Xiap Ring Dom 1e-04
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure 
Iteration: 1

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%)
Query: 340 ACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFLS 388
            CK C  +  SVV +PC HL VC EC   ++ CP+C  +   +V  FLS
Sbjct: 297 TCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS 345
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 Back     alignment and structure
>pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 3e-12
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 6e-11
2ea5_A68 Cell growth regulator with ring finger domain prot 7e-11
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 3e-06
2zuo_A861 MVP, major vault protein; repeat domains, protein- 1e-05
2zuo_A861 MVP, major vault protein; repeat domains, protein- 9e-05
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 1e-04
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 2e-04
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
 Score = 66.5 bits (160), Expect = 3e-12
 Identities = 35/246 (14%), Positives = 86/246 (34%), Gaps = 12/246 (4%)

Query: 143 SFGDQQQRQQQQQQQQLQQTPHHHHQQQQQQQNIMCQSPSLLSFLSDDLASPIKRQRDEL 202
           S           +            +Q  Q + +          ++D +++ +  + ++ 
Sbjct: 112 SEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENY--KTVNDIVSALLNAEDEKR 169

Query: 203 DQFLQAQGEQLRRALAEKRQRHYRALLGAAEESIARLLREKEAEVEKATRRNAELEARAA 262
           ++  + Q E++        +++  AL       +   + +   +     ++  ++  +  
Sbjct: 170 EEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLP--ILDNLLKANVINKQEHDIIKQKT 227

Query: 263 QLSVEAQVWQAKARAQEATAASLQAQLQQAIMSGAGCGAQDSRRGDDGLMCTGEVAEDAE 322
           Q+ ++A+        +   AA++     + I S         +                +
Sbjct: 228 QIPLQARELIDTILVKGNAAANIFKNSLKEIDSTLYKNLFVDKNMKYI--------PTED 279

Query: 323 SAYVDPDRVVSVPVSGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSS 382
            + +  +  +        CK C  +  SVV +PC HL VC EC   ++ CP+C  +   +
Sbjct: 280 VSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGT 339

Query: 383 VEVFLS 388
           V  FLS
Sbjct: 340 VRTFLS 345
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
2ea5_A68 Cell growth regulator with ring finger domain prot 99.35
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.29
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.22
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.22
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.21
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.16
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.92
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.32
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.18
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.02
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.99
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.94
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.91
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.9
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.85
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.84
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.84
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.84
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.81
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.81
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.8
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.78
2ect_A78 Ring finger protein 126; metal binding protein, st 97.77
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.69
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.67
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.67
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.66
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.65
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.62
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.59
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.59
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.58
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.5
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.48
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.44
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.43
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.42
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.41
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.4
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.4
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.4
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.38
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.34
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.33
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.27
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.26
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.23
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.22
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.17
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.15
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.05
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 96.91
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 96.52
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.52
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.5
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.39
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.27
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.19
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.11
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 95.44
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 95.04
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 94.53
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 93.41
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 93.22
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 93.0
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 92.44
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 89.3
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 87.65
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 85.41
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 85.07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 84.73
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 84.53
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 84.27
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 80.88
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.35  E-value=4.4e-13  Score=103.46  Aligned_cols=51  Identities=33%  Similarity=0.796  Sum_probs=48.5

Q ss_pred             cccccccccccccceEEeCCCCcccccchHhhCCCCCCCccccCceEEEee
Q 016506          337 SGPACKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLCFNVRDSSVEVFL  387 (388)
Q Consensus       337 ~~~~C~IC~~~ea~vlLLPCrHlclC~~C~~~l~~CPVCR~~i~~sV~V~l  387 (388)
                      ....|+||+++.++++|+||+|+++|..|...+..||+||..|...++||.
T Consensus        14 ~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~   64 (68)
T 2ea5_A           14 NSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSG   64 (68)
T ss_dssp             CSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCS
T ss_pred             CCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeec
Confidence            457899999999999999999999999999999999999999999999985
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 388
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 0.001
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.003
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Acute promyelocytic leukaemia proto-oncoprotein PML
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.5 bits (79), Expect = 0.001
 Identities = 10/35 (28%), Positives = 14/35 (40%)

Query: 341 CKGCRKRVASVVLLPCRHLCVCTECDRVVQACPLC 375
           C+ C+       LLPC H       +     CP+C
Sbjct: 9   CQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPIC 43
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.97
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.94
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.72
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.66
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.55
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.39
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.38
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.25
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.14
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.67
d2c2la280 STIP1 homology and U box-containing protein 1, STU 96.58
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.56
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.4
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 96.29
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 95.69
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 94.46
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.28  E-value=1.1e-07  Score=73.49  Aligned_cols=48  Identities=31%  Similarity=0.636  Sum_probs=40.1

Q ss_pred             ccccccccccccceEEeCCCCcccccchHhh-----CCCCCCCccccCceEEEe
Q 016506          338 GPACKGCRKRVASVVLLPCRHLCVCTECDRV-----VQACPLCFNVRDSSVEVF  386 (388)
Q Consensus       338 ~~~C~IC~~~ea~vlLLPCrHlclC~~C~~~-----l~~CPVCR~~i~~sV~V~  386 (388)
                      ...|.||++...+.+++||||. +|..|...     ..+||+||..|...-.|.
T Consensus        23 ~~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~   75 (79)
T d1fbva4          23 FQLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIV   75 (79)
T ss_dssp             TTBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred             CCCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence            3579999999999999999998 89999643     357999999998765443
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure