Citrus Sinensis ID: 016534

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MKLSSISNAASCFLLVIVQISLAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVSSQLCSPSQKSYSVCKQAYGRRPRP
cccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEccccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHcccccccEEccccccccccccccccccccccEEEccccccEEcccccccccccccEEEccccccccccccccccccEEcccccEEcccccHHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEcccccccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccEcccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccccc
MKLSSISNAASCFLLVIVQISLAVALTSPQDISALKAFkasikpssiqpwsclaswdftatdpcalprrthftcgllcssdstrvtqltldpagysgqltpliSQLTqltildlsdnyffgpipasisslsnLQMLTLRsnsfsssvpdsltqlknldsldlsynslsgslpkntfLMSSLRRLDLSYnkltgslpklppnlselalKNNVLSGVitknsfdglTQLEVIELSENSFTGTLEAWFFLLPalqqvnlsnntltrvgiskpvdgrsdlvavDLGFnkiqgylpvnfadypmlSSLSMRYNRlrggiplefshkksLKRLFLdgnfligkapigfftgdvpvagslgdnclqgcpvssqlcspsqksysvckqaygrrprp
MKLSSISNAASCFLLVIVQISLAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVssqlcspsqksysvckqaygrrprp
MKLSSISNAASCFLLVIVQISLAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQLKnldsldlsynslsgslPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVSSQLCSPSQKSYSVCKQAYGRRPRP
********AASCFLLVIVQISLAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQML**************************************TFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVSSQL*********************
******S*AASCFLLVIVQISLAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVS*****************YG**P*P
MKLSSISNAASCFLLVIVQISLAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRS*********SLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVSSQLCSPSQKSYSVCKQAYGRRPRP
*KLSSISNAASCFLLVIVQISLAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVSSQLCSPSQKSYSVCKQAYGRRPR*
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLSSISNAASCFLLVIVQISLAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVSSQLCSPSQKSYSVCKQAYGRRPRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query388 2.2.26 [Sep-21-2011]
Q00874372 DNA-damage-repair/tolerat no no 0.798 0.833 0.309 7e-30
Q8GT95332 Polygalacturonase inhibit no no 0.757 0.885 0.339 2e-28
Q9FL28 1173 LRR receptor-like serine/ no no 0.814 0.269 0.334 2e-28
Q9ZUI0 980 Putative leucine-rich rep no no 0.713 0.282 0.329 7e-26
C0LGQ5 1249 LRR receptor-like serine/ no no 0.768 0.238 0.321 2e-25
Q05091330 Polygalacturonase inhibit N/A no 0.703 0.827 0.358 2e-25
Q9SHI2 1101 Leucine-rich repeat recep no no 0.755 0.266 0.290 3e-25
Q9FRS6 1029 Leucine-rich repeat recep no no 0.721 0.272 0.311 5e-25
Q9LYN8 1192 Leucine-rich repeat recep no no 0.778 0.253 0.308 6e-25
O82318 960 Probably inactive leucine no no 0.680 0.275 0.317 7e-25
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function desciption
 Score =  131 bits (330), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 115/371 (30%), Positives = 167/371 (45%), Gaps = 61/371 (16%)

Query: 28  SPQDISALKAFKASIKPSSI---QPWS----CLASWDFTATDPCA--------------- 65
           SP+D +AL AFK+S+   ++     WS    C   W   + DP +               
Sbjct: 28  SPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESEDA 87

Query: 66  ---LPRRTHFTCGLL--CSSDSTRVTQLTL-DPAGYSGQLTPLISQLTQLTILDLSDNYF 119
                 R+ +  G +     D T +T L L D  G +G++ P I+ L  L ILDL+ N  
Sbjct: 88  IFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKI 147

Query: 120 FGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMS 179
            G IPA I  LS L +L L  N  S  +P SLT L  L  L+L+ N ++G +P +   + 
Sbjct: 148 TGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLK 207

Query: 180 SLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTG 239
            L R+ L  N+LTGS+P+                      S  G+ +L  ++LS+N   G
Sbjct: 208 MLSRVLLGRNELTGSIPE----------------------SISGMERLADLDLSKNHIEG 245

Query: 240 TLEAWFFLLPALQQVNLSNNTLTRVGISKPVDG----RSDLVAVDLGFNKIQGYLPVNFA 295
            +  W   +  L  +NL  N+LT      P+ G     S L   +L  N ++G +P  F 
Sbjct: 246 PIPEWMGNMKVLSLLNLDCNSLT-----GPIPGSLLSNSGLDVANLSRNALEGTIPDVFG 300

Query: 296 DYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGD 355
               L SL + +N L G IP   S  K +  L +  N L G+ P G F  D   A S  D
Sbjct: 301 SKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHNKLCGRIPTG-FPFDHLEATSFSD 359

Query: 356 N-CLQGCPVSS 365
           N CL G P+++
Sbjct: 360 NQCLCGGPLTT 370
This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8GT95|PGIP1_ORYSJ Polygalacturonase inhibitor 1 OS=Oryza sativa subsp. japonica GN=FOR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q05091|PGIP_PYRCO Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
255555307386 serine-threonine protein kinase, plant-t 0.940 0.945 0.797 1e-156
224056184387 predicted protein [Populus trichocarpa] 0.969 0.971 0.766 1e-156
224103655385 predicted protein [Populus trichocarpa] 0.935 0.942 0.767 1e-151
225428890378 PREDICTED: probably inactive leucine-ric 0.958 0.984 0.664 1e-142
296090454386 unnamed protein product [Vitis vinifera] 0.956 0.961 0.665 1e-142
359806182397 probably inactive leucine-rich repeat re 0.961 0.939 0.668 1e-140
21554189384 putative leucine-rich repeat disease res 0.945 0.955 0.652 1e-136
15226087382 leucine-rich repeat-containing protein [ 0.948 0.963 0.647 1e-136
449438371390 PREDICTED: probable LRR receptor-like se 0.912 0.907 0.716 1e-136
297836146388 leucine-rich repeat family protein [Arab 0.940 0.940 0.650 1e-136
>gi|255555307|ref|XP_002518690.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223542071|gb|EEF43615.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 291/365 (79%), Positives = 318/365 (87%)

Query: 24  VALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDST 83
           + +TSPQDISALKAFK+SIKPSSI  WSCLASWDFT  DPC LPRR+HFTCG+ CSSD+T
Sbjct: 20  LGVTSPQDISALKAFKSSIKPSSIPSWSCLASWDFTLADPCLLPRRSHFTCGVTCSSDAT 79

Query: 84  RVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRSNSF 143
           RVTQLTLDP GYSGQLTPLISQLT LTILDLSDN FFG +P+SISSL NLQ LTLR NSF
Sbjct: 80  RVTQLTLDPVGYSGQLTPLISQLTNLTILDLSDNNFFGSVPSSISSLINLQTLTLRFNSF 139

Query: 144 SSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLS 203
           S S+P S+T LK+L SLDLS+NSL G LPK+   MSSLRRLDLSYNKLTGSLPKLP NL 
Sbjct: 140 SGSLPISITNLKSLRSLDLSHNSLFGYLPKSMNSMSSLRRLDLSYNKLTGSLPKLPYNLL 199

Query: 204 ELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTR 263
           ELALKNN LSG ++K SFDGLTQLEVIELSENSF G LE+WFFLLPALQQV+L+NN LTR
Sbjct: 200 ELALKNNSLSGSLSKASFDGLTQLEVIELSENSFNGVLESWFFLLPALQQVDLANNDLTR 259

Query: 264 VGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKS 323
             ISKPV+G SDLVAVDLGFNKI+G +P+NFADYP+LSSLS+RYNRLRG IPLEFS KKS
Sbjct: 260 AEISKPVNGNSDLVAVDLGFNKIEGNVPLNFADYPLLSSLSLRYNRLRGTIPLEFSQKKS 319

Query: 324 LKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVSSQLCSPSQKSYSVCKQAYG 383
           LKRLFLDGNFLIGK P  FF G VPV GSLGDNCLQGCP SSQLC+PSQK  SVCKQAYG
Sbjct: 320 LKRLFLDGNFLIGKPPSEFFAGGVPVTGSLGDNCLQGCPGSSQLCTPSQKPSSVCKQAYG 379

Query: 384 RRPRP 388
           R+ +P
Sbjct: 380 RKGKP 384

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224056184|ref|XP_002298744.1| predicted protein [Populus trichocarpa] gi|222846002|gb|EEE83549.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224103655|ref|XP_002313141.1| predicted protein [Populus trichocarpa] gi|222849549|gb|EEE87096.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225428890|ref|XP_002285338.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090454|emb|CBI40273.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359806182|ref|NP_001241201.1| probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like precursor [Glycine max] gi|223452538|gb|ACM89596.1| leucine-rich repeat disease resistance protein [Glycine max] Back     alignment and taxonomy information
>gi|21554189|gb|AAM63268.1| putative leucine-rich repeat disease resistance protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15226087|ref|NP_179134.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|4662629|gb|AAD26901.1| putative leucine-rich repeat disease resistance protein [Arabidopsis thaliana] gi|15292805|gb|AAK92771.1| putative leucine-rich repeat disease resistance protein [Arabidopsis thaliana] gi|20258861|gb|AAM14102.1| putative leucine-rich repeat disease resistance protein [Arabidopsis thaliana] gi|330251293|gb|AEC06387.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449438371|ref|XP_004136962.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Cucumis sativus] gi|449533824|ref|XP_004173871.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297836146|ref|XP_002885955.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297331795|gb|EFH62214.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
TAIR|locus:2049098382 AT2G15320 [Arabidopsis thalian 0.971 0.986 0.613 3.5e-123
TAIR|locus:2155001418 AT5G66330 [Arabidopsis thalian 0.842 0.782 0.348 1.1e-41
TAIR|locus:2097458419 AT3G59510 [Arabidopsis thalian 0.755 0.699 0.335 2.1e-36
TAIR|locus:4515102753 598 AT1G73066 [Arabidopsis thalian 0.809 0.525 0.314 2.2e-30
TAIR|locus:2090472396 AT3G17640 "AT3G17640" [Arabido 0.863 0.845 0.324 3.8e-30
TAIR|locus:2091260372 DRT100 "DNA-DAMAGE REPAIR/TOLE 0.873 0.911 0.309 2.1e-29
TAIR|locus:2005629 1140 AT1G75640 [Arabidopsis thalian 0.649 0.221 0.328 2.9e-29
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.845 0.279 0.318 3.8e-26
UNIPROTKB|Q8GT95332 FOR1 "Polygalacturonase inhibi 0.814 0.951 0.305 5.2e-26
TAIR|locus:2032697 1123 PEPR1 "PEP1 receptor 1" [Arabi 0.721 0.249 0.313 4.2e-25
TAIR|locus:2049098 AT2G15320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1211 (431.4 bits), Expect = 3.5e-123, P = 3.5e-123
 Identities = 233/380 (61%), Positives = 296/380 (77%)

Query:    11 SCFLLVIVQI--SLAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPR 68
             +C LL+++ +  S A +LTSP D+SALKAFKA++KP+SI PWSCLASWDFT +DPCA PR
Sbjct:     2 TCLLLLLLLLLFSSADSLTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPR 61

Query:    69 RTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASIS 128
             RTHFTCG+ CSSDSTRVTQLTLDPAGY+G+LTPLIS LT+L  LDL++N F+G IP+SIS
Sbjct:    62 RTHFTCGITCSSDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSIS 121

Query:   129 SLSNLQMLTLRSNSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSY 188
             SL++L+ L LRSNSFS S+PDS+T+L                 PK    +S+LR+LDLSY
Sbjct:   122 SLTSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSY 181

Query:   189 NKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLL 248
             NKLTG++PKLP NL +LALK N LSG I+K+SF   TQLE++E++ENSFTGTL AWFFLL
Sbjct:   182 NKLTGAIPKLPKNLIDLALKANTLSGPISKDSFTESTQLEIVEIAENSFTGTLGAWFFLL 241

Query:   249 PALQQVNLSNNTLTRVGISKP-VDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRY 307
              ++QQV+L+NNTLT + +  P + G ++LVAV+LGFN+I+G  P +FA YP LSSLSMRY
Sbjct:   242 ESIQQVDLANNTLTGIEVLPPNLAGENNLVAVELGFNQIRGNAPASFAAYPRLSSLSMRY 301

Query:   308 NRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQGCPVSSQL 367
             N L G IP E+   K+L+RL+LDGNFL GK P  F   D  V GSLG+NCLQGCP  +++
Sbjct:   302 NVLHGVIPSEYERSKTLRRLYLDGNFLTGKPPARFVRTDAEVMGSLGNNCLQGCPGKAKM 361

Query:   368 CSPSQKSYSVCKQAYGRRPR 387
             C+PSQK + +CKQAYG +P+
Sbjct:   362 CAPSQKPFYICKQAYGGKPK 381
GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2155001 AT5G66330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097458 AT3G59510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090472 AT3G17640 "AT3G17640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091260 DRT100 "DNA-DAMAGE REPAIR/TOLERATION 100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005629 AT1G75640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GT95 FOR1 "Polygalacturonase inhibitor 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2032697 PEPR1 "PEP1 receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_I001048
hypothetical protein (387 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_LG_XV000312
hypothetical protein (673 aa)
  •     0.470
eugene3.00180747
hypothetical protein (336 aa)
  •     0.436
fgenesh4_pg.C_scaffold_1268000001
hypothetical protein (327 aa)
  •     0.423
eugene3.00110941
hypothetical protein (581 aa)
  •     0.420
estExt_fgenesh4_pg.C_2110009
hypothetical protein (338 aa)
  •     0.413

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-32
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-28
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-17
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-10
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  131 bits (332), Expect = 2e-33
 Identities = 93/292 (31%), Positives = 134/292 (45%), Gaps = 27/292 (9%)

Query: 95  YSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQL 154
            SG++   I   + L +LDL  N   G IP S+++L++L+ LTL SN     +P  L Q+
Sbjct: 152 LSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQM 211

Query: 155 KNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELA---LKNNV 211
           K+L  + L YN+LSG +P     ++SL  LDL YN LTG +P    NL  L    L  N 
Sbjct: 212 KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNK 271

Query: 212 LSGVITKNSFD-----------------------GLTQLEVIELSENSFTGTLEAWFFLL 248
           LSG I  + F                         L  LE++ L  N+FTG +      L
Sbjct: 272 LSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSL 331

Query: 249 PALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYN 308
           P LQ + L +N  +   I K +   ++L  +DL  N + G +P        L  L +  N
Sbjct: 332 PRLQVLQLWSNKFSG-EIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSN 390

Query: 309 RLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIGFFTGDVPVAGSLGDNCLQG 360
            L G IP      +SL+R+ L  N   G+ P  F    +     + +N LQG
Sbjct: 391 SLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQG 442

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 388
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
KOG4237498 consensus Extracellular matrix protein slit, conta 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PLN03150623 hypothetical protein; Provisional 99.63
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.33
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.3
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.29
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.24
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.23
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.21
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.19
PLN03150623 hypothetical protein; Provisional 99.18
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.77
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.55
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.5
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.49
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.47
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.4
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.38
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.2
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.1
PRK15386 426 type III secretion protein GogB; Provisional 98.09
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.07
PRK15386 426 type III secretion protein GogB; Provisional 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.82
KOG4341483 consensus F-box protein containing LRR [General fu 97.82
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.7
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.67
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.37
KOG4341483 consensus F-box protein containing LRR [General fu 97.27
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.17
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.14
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.96
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.72
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.68
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.68
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.18
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.18
KOG4308478 consensus LRR-containing protein [Function unknown 94.32
KOG4308478 consensus LRR-containing protein [Function unknown 94.24
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.82
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.33
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.01
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.94
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.61
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 89.15
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.23
smart0037026 LRR Leucine-rich repeats, outliers. 87.78
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.78
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.07
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-43  Score=375.70  Aligned_cols=346  Identities=29%  Similarity=0.414  Sum_probs=258.3

Q ss_pred             cCCChhHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccceeeCCCCCceEEEEeCCCCCCCCCccccc
Q 016534           25 ALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQLTPLIS  104 (388)
Q Consensus        25 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~W~~~~~~~C~~~~~~~~~~g~~c~~~~~~l~~L~l~~~~l~~~~~~~l~  104 (388)
                      +..+++|+.||++||..+.    ++++.+.+|+.. .|+|.|       .|+.|+. .++|+.|+++++++.|.++..+.
T Consensus        24 ~~~~~~~~~~l~~~~~~~~----~~~~~~~~w~~~-~~~c~w-------~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~   90 (968)
T PLN00113         24 SMLHAEELELLLSFKSSIN----DPLKYLSNWNSS-ADVCLW-------QGITCNN-SSRVVSIDLSGKNISGKISSAIF   90 (968)
T ss_pred             cCCCHHHHHHHHHHHHhCC----CCcccCCCCCCC-CCCCcC-------cceecCC-CCcEEEEEecCCCccccCChHHh
Confidence            4447789999999999983    455667899765 789999       8999985 57899999999999999999999


Q ss_pred             CCCCCCEEEccCCcCCccCccccc-CCCCCCEEeeecCcCCCCCchhhcCCCCCCEEEccCCcCCCCcCccccCCCCCcE
Q 016534          105 QLTQLTILDLSDNYFFGPIPASIS-SLSNLQMLTLRSNSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRR  183 (388)
Q Consensus       105 ~l~~L~~L~L~~n~l~~~~~~~l~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~  183 (388)
                      .+++|++|+|++|.+++.+|..+. ++++|++|++++|.+++.+|.  +.+++|++|++++|.+.+.+|..+..+++|++
T Consensus        91 ~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~  168 (968)
T PLN00113         91 RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKV  168 (968)
T ss_pred             CCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCE
Confidence            999999999999999988887655 788888888888888776664  35677777777777777777777777777777


Q ss_pred             EEcccCcCCCCCCCC---CCCCCEEEccCCccCcccCccccCCCCccCEEEccCCcCCCcchHHhhcCCCCCEEEccCCC
Q 016534          184 LDLSYNKLTGSLPKL---PPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNT  260 (388)
Q Consensus       184 L~l~~n~l~~~~~~~---~~~L~~L~l~~n~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~  260 (388)
                      |++++|.+.+.+|..   .++|++|++++|.+.+.+ +..++++++|++|++++|.+++.+|..++.+++|++|++++|.
T Consensus       169 L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~-p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  247 (968)
T PLN00113        169 LDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQI-PRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNN  247 (968)
T ss_pred             EECccCcccccCChhhhhCcCCCeeeccCCCCcCcC-ChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCce
Confidence            777777776666542   266777777777776665 5667777777777777777777777777777777777777777


Q ss_pred             CCCCCCCCCCCCCCCCCEEEccCCcCCCCCcccccCCCCCCEEEccCCcccccCCccccCCCCCcEEeCcCCcCccCCCc
Q 016534          261 LTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPI  340 (388)
Q Consensus       261 l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~  340 (388)
                      +++ .+|..+..+++|++|++++|.+++.+|..+..+++|++|++++|.+.+.+|..+..+++|+.|++++|.+++.+|.
T Consensus       248 l~~-~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~  326 (968)
T PLN00113        248 LTG-PIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPV  326 (968)
T ss_pred             ecc-ccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCCh
Confidence            766 3566666677777777777777766666666677777777777777767776666667777777777776666666


Q ss_pred             cCcCCCCCcEEEcCCCcCC-CCCCCCCCCCCCccccccccCCCCCCCC
Q 016534          341 GFFTGDVPVAGSLGDNCLQ-GCPVSSQLCSPSQKSYSVCKQAYGRRPR  387 (388)
Q Consensus       341 ~~~~~~~L~~l~l~~n~l~-~~p~~~~~~~~L~~l~l~~n~~~~~ip~  387 (388)
                      .+..+++|+.|++++|.+. .+|..++.+++|+.|++++|++.+.+|+
T Consensus       327 ~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~  374 (968)
T PLN00113        327 ALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPE  374 (968)
T ss_pred             hHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCCh
Confidence            6666667777777766665 4566666666666666666666665553

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-18
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 7e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 9e-16
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 7e-08
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 8e-08
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 1e-05
2z81_A 549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 4e-05
3a79_A 580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 5e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-04
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 4e-04
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 4e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 7e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 98/382 (25%), Positives = 150/382 (39%), Gaps = 76/382 (19%)
Query: 77  LCSSDSTRVTQLTLDPAGYSGQLTPLISQLTQLTILDLSDNYFFGPIPASISSLSNLQML 136
           LC +    + +L L   G++G++ P +S  ++L  L LS NY  G IP+S+ SLS L+ L
Sbjct: 385 LCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 444
Query: 137 TLRSNSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLP 196
            L  N     +P  L  +K                P      ++L  + LS N+LTG +P
Sbjct: 445 KLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIP 504
Query: 197 KLP---PNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFF------- 246
           K      NL+ L L NN  SG I     D    L  ++L+ N F GT+ A  F       
Sbjct: 505 KWIGRLENLAILKLSNNSFSGNIPAELGD-CRSLIWLDLNTNLFNGTIPAAMFKQSGKIA 563
Query: 247 --LLPALQQVNLSN---------------------------------NTLTRV--GISKP 269
              +   + V + N                                 N  +RV  G + P
Sbjct: 564 ANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSP 623
Query: 270 V-DGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLF 328
             D    ++ +D+ +N + GY+P      P L  L++ +N + G IP E    + L  L 
Sbjct: 624 TFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILD 683
Query: 329 LDGNFLIGKAPIGF---------------FTGDVPVAGS---------LGDNCLQGCPVS 364
           L  N L G+ P                   +G +P  G          L +  L G P+ 
Sbjct: 684 LSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP 743
Query: 365 SQLCSPSQ-KSYSVCKQAYGRR 385
              C PS    Y+  ++++GRR
Sbjct: 744 R--CDPSNADGYAHHQRSHGRR 763
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-51
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-44
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-36
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-29
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-30
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-29
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-32
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-30
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-29
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-29
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-26
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-27
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-27
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-26
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-18
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-16
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-22
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-20
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-16
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-17
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-17
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-12
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  187 bits (477), Expect = 8e-57
 Identities = 88/317 (27%), Positives = 143/317 (45%), Gaps = 27/317 (8%)

Query: 26  LTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSD--ST 83
           L +PQD  AL   K  +   +      L+SW    TD C       +  G+LC +D  + 
Sbjct: 2   LCNPQDKQALLQIKKDLGNPTT-----LSSWL-PTTDCC----NRTWL-GVLCDTDTQTY 50

Query: 84  RVTQLTLDPAGYSGQLT--PLISQLTQLTILDLSD-NYFFGPIPASISSLSNLQMLTLRS 140
           RV  L L              ++ L  L  L +   N   GPIP +I+ L+ L  L +  
Sbjct: 51  RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITH 110

Query: 141 NSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLMSSLRRLDLSYNKLTGSLPK--- 197
            + S ++PD L+Q+K L +LD SYN+LSG+LP +   + +L  +    N+++G++P    
Sbjct: 111 TNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYG 170

Query: 198 -LPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNL 256
                 + + +  N L+G I   +F  L  L  ++LS N   G     F      Q+++L
Sbjct: 171 SFSKLFTSMTISRNRLTGKIPP-TFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHL 228

Query: 257 SNNTLTRVG-ISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIP 315
           + N+L     + K    ++ L  +DL  N+I G LP        L SL++ +N L G IP
Sbjct: 229 AKNSLA--FDLGKVGLSKN-LNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP 285

Query: 316 LEFSHKKSLKRLFLDGN 332
            +  + +         N
Sbjct: 286 -QGGNLQRFDVSAYANN 301
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.79
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.26
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.22
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.19
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.05
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.95
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.82
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.48
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.41
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.8
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.72
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-45  Score=376.65  Aligned_cols=345  Identities=25%  Similarity=0.287  Sum_probs=256.4

Q ss_pred             hhhcCCChhHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccceeeCCCCCceEEEEeCCCCCCCC---
Q 016534           22 LAVALTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCALPRRTHFTCGLLCSSDSTRVTQLTLDPAGYSGQ---   98 (388)
Q Consensus        22 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~W~~~~~~~C~~~~~~~~~~g~~c~~~~~~l~~L~l~~~~l~~~---   98 (388)
                      +++++..++|++||++||+++.    +|. .+++|... .|||.|       .||+|+  .++|++|+|+++++.|.   
T Consensus         4 ~~~~~~~~~~~~all~~k~~~~----~~~-~l~~W~~~-~~~C~w-------~gv~C~--~~~v~~L~L~~~~l~g~~~~   68 (768)
T 3rgz_A            4 ASPSQSLYREIHQLISFKDVLP----DKN-LLPDWSSN-KNPCTF-------DGVTCR--DDKVTSIDLSSKPLNVGFSA   68 (768)
T ss_dssp             ----CCHHHHHHHHHHHHTTCS----CTT-SSTTCCTT-SCGGGS-------TTEEEE--TTEEEEEECTTSCCCEEHHH
T ss_pred             CccccCCHHHHHHHHHHHhhCC----Ccc-cccCCCCC-CCCcCC-------cceEEC--CCcEEEEECCCCCcCCccCc
Confidence            3444557789999999999983    555 78999855 799999       899998  48999999999999886   


Q ss_pred             Ccc-----------------------cccCCCCCCEEEccCCcCCccCcc--cccCCCCCCEEeeecCcCCCCCchhh-c
Q 016534           99 LTP-----------------------LISQLTQLTILDLSDNYFFGPIPA--SISSLSNLQMLTLRSNSFSSSVPDSL-T  152 (388)
Q Consensus        99 ~~~-----------------------~l~~l~~L~~L~L~~n~l~~~~~~--~l~~l~~L~~L~L~~n~l~~~~p~~l-~  152 (388)
                      +++                       .++++++|++|+|++|.++|.+|.  .++++++|++|++++|.+.+..|..+ .
T Consensus        69 l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~  148 (768)
T 3rgz_A           69 VSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGL  148 (768)
T ss_dssp             HHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCC
T ss_pred             cChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhc
Confidence            554                       566667777777777777776666  67777777777777777776666655 6


Q ss_pred             CCCCCCEEEccCCcCCCCcCcc---ccCCCCCcEEEcccCcCCCCCCC-CCCCCCEEEccCCccCcccCccccCCCCccC
Q 016534          153 QLKNLDSLDLSYNSLSGSLPKN---TFLMSSLRRLDLSYNKLTGSLPK-LPPNLSELALKNNVLSGVITKNSFDGLTQLE  228 (388)
Q Consensus       153 ~l~~L~~L~L~~n~l~~~~p~~---l~~~~~L~~L~l~~n~l~~~~~~-~~~~L~~L~l~~n~~~~~~~~~~l~~l~~L~  228 (388)
                      ++++|++|++++|.+++..|..   +..+++|++|++++|.+.+..+. ..++|++|++++|.+.+.+ +. ++++++|+
T Consensus       149 ~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~-~~-l~~l~~L~  226 (768)
T 3rgz_A          149 KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGI-PF-LGDCSALQ  226 (768)
T ss_dssp             CCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCC-CB-CTTCCSCC
T ss_pred             cCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCC-cc-cccCCCCC
Confidence            6777777777777777666655   66777788888877777765553 3478999999999998876 44 88999999


Q ss_pred             EEEccCCcCCCcchHHhhcCCCCCEEEccCCCCCCCCCCCCCCCCCCCCEEEccCCcCCCCCcccccCC-CCCCEEEccC
Q 016534          229 VIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADY-PMLSSLSMRY  307 (388)
Q Consensus       229 ~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l-~~L~~L~L~~  307 (388)
                      +|++++|.+++.+|..+..+++|++|++++|++++ .+|..  .+++|++|++++|.+++.+|..+... ++|++|++++
T Consensus       227 ~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~-~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~  303 (768)
T 3rgz_A          227 HLDISGNKLSGDFSRAISTCTELKLLNISSNQFVG-PIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSG  303 (768)
T ss_dssp             EEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEE-SCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCS
T ss_pred             EEECcCCcCCCcccHHHhcCCCCCEEECCCCcccC-ccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcC
Confidence            99999999998899999999999999999998876 33433  56777777777777776666666553 7777777777


Q ss_pred             CcccccCCccccCCCCCcEEeCcCCcCccCCCcc-CcCCCCCcEEEcCCCcCC-CCCCCCCCCC-CCccccccccCCCCC
Q 016534          308 NRLRGGIPLEFSHKKSLKRLFLDGNFLIGKAPIG-FFTGDVPVAGSLGDNCLQ-GCPVSSQLCS-PSQKSYSVCKQAYGR  384 (388)
Q Consensus       308 n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~-~~~~~~L~~l~l~~n~l~-~~p~~~~~~~-~L~~l~l~~n~~~~~  384 (388)
                      |.+++.+|..+..+++|++|++++|.+++.+|.. +..+++|+.|++++|.++ .+|..+..++ +|+.|++++|.+.+.
T Consensus       304 n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~  383 (768)
T 3rgz_A          304 NHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGP  383 (768)
T ss_dssp             SEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEE
T ss_pred             CcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCC
Confidence            7777777777777777777777777777666654 666777777777777665 5666666555 566666666665555


Q ss_pred             CC
Q 016534          385 RP  386 (388)
Q Consensus       385 ip  386 (388)
                      +|
T Consensus       384 ~~  385 (768)
T 3rgz_A          384 IL  385 (768)
T ss_dssp             CC
T ss_pred             cC
Confidence            44
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 388
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 78.5 bits (192), Expect = 5e-17
 Identities = 56/229 (24%), Positives = 98/229 (42%), Gaps = 6/229 (2%)

Query: 107 TQLTILDLSDNYFFGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQLKNLDSLDLSYNS 166
               +LDL +N           +L NL  L L +N  S   P +   L  L+ L LS N 
Sbjct: 31  PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQ 90

Query: 167 LSGSLPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGV-ITKNSFDGLT 225
           L     K    +  LR  +    K+  S+      +  + L  N L    I   +F G+ 
Sbjct: 91  LKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMK 150

Query: 226 QLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNK 285
           +L  I +++ + T   +    L P+L +++L  N +T+V  +  + G ++L  + L FN 
Sbjct: 151 KLSYIRIADTNITTIPQG---LPPSLTELHLDGNKITKV-DAASLKGLNNLAKLGLSFNS 206

Query: 286 IQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFL 334
           I      + A+ P L  L +  N+L   +P   +  K ++ ++L  N +
Sbjct: 207 ISAVDNGSLANTPHLRELHLNNNKLV-KVPGGLADHKYIQVVYLHNNNI 254
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.02
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.93
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.7
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.22
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.0
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=3.3e-41  Score=309.13  Aligned_cols=293  Identities=30%  Similarity=0.450  Sum_probs=224.1

Q ss_pred             CCChhHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCccceeeCCC--CCceEEEEeCCCCCCC--CC
Q 016534           26 LTSPQDISALKAFKASIKPSSIQPWSCLASWDFTATDPCA--LPRRTHFTCGLLCSSD--STRVTQLTLDPAGYSG--QL   99 (388)
Q Consensus        26 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~W~~~~~~~C~--~~~~~~~~~g~~c~~~--~~~l~~L~l~~~~l~~--~~   99 (388)
                      .|.++|++||++||+++.    ++ ..+++|..+ .|||.  |       .||+|+..  ..||++|+|+++++.|  .+
T Consensus         2 ~c~~~e~~aLl~~k~~~~----~~-~~l~sW~~~-~d~C~~~w-------~gv~C~~~~~~~~v~~L~L~~~~l~g~~~l   68 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLG----NP-TTLSSWLPT-TDCCNRTW-------LGVLCDTDTQTYRVNNLDLSGLNLPKPYPI   68 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT----CC-GGGTTCCTT-SCTTTTCS-------TTEEECCSSSCCCEEEEEEECCCCSSCEEC
T ss_pred             CCCHHHHHHHHHHHHHCC----CC-CcCCCCCCC-CCCCCCcC-------CCeEEeCCCCcEEEEEEECCCCCCCCCCCC
Confidence            488999999999999983    23 358899866 89995  7       89999863  4489999999999988  58


Q ss_pred             cccccCCCCCCEEEccC-CcCCccCcccccCCCCCCEEeeecCcCCCCCchhhcCCCCCCEEEccCCcCCCCcCccccCC
Q 016534          100 TPLISQLTQLTILDLSD-NYFFGPIPASISSLSNLQMLTLRSNSFSSSVPDSLTQLKNLDSLDLSYNSLSGSLPKNTFLM  178 (388)
Q Consensus       100 ~~~l~~l~~L~~L~L~~-n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~~  178 (388)
                      |+.++++++|++|+|++ |+++|.+|.+|+++++|++|++++|++.+..+..+..+.+|++++++.|.+.+.+|..+..+
T Consensus        69 p~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l  148 (313)
T d1ogqa_          69 PSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSL  148 (313)
T ss_dssp             CGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGC
T ss_pred             ChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccC
Confidence            89999999999999997 79999999999999999999999999999899999999999999999999999999999999


Q ss_pred             CCCcEEEcccCcCCCCCCCCCCCCCEEEccCCccCcccCccccCCCCcc-CEEEccCCcCCCcchHHhhcCCCCCEEEcc
Q 016534          179 SSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQL-EVIELSENSFTGTLEAWFFLLPALQQVNLS  257 (388)
Q Consensus       179 ~~L~~L~l~~n~l~~~~~~~~~~L~~L~l~~n~~~~~~~~~~l~~l~~L-~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~  257 (388)
                      ++++++++++|.+.+.+|.                      .+..+..+ +.+++++|++++..+..+..+.. ..++++
T Consensus       149 ~~L~~l~l~~n~l~~~ip~----------------------~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l~  205 (313)
T d1ogqa_         149 PNLVGITFDGNRISGAIPD----------------------SYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDLS  205 (313)
T ss_dssp             TTCCEEECCSSCCEEECCG----------------------GGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEECC
T ss_pred             cccceeecccccccccccc----------------------cccccccccccccccccccccccccccccccc-cccccc
Confidence            9999999999988765543                      33333333 55666666666665555555433 346666


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEccCCcCCCCCcccccCCCCCCEEEccCCcccccCCccccCCCCCcEEeCcCCcCccC
Q 016534          258 NNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIGK  337 (388)
Q Consensus       258 ~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~  337 (388)
                      .+...+ .+|..+..+++++.+++++|.+.+.++ .+..+++|+.|++++|+++|.+|..++++++|++|+|++|+++|.
T Consensus       206 ~~~~~~-~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~  283 (313)
T d1ogqa_         206 RNMLEG-DASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGE  283 (313)
T ss_dssp             SSEEEE-CCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEE
T ss_pred             cccccc-ccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCccccc
Confidence            666555 345555556666666666666665443 455666677777777777766776677777777777777777666


Q ss_pred             CCccCcCCCCCcEEEcCCCc
Q 016534          338 APIGFFTGDVPVAGSLGDNC  357 (388)
Q Consensus       338 ~p~~~~~~~~L~~l~l~~n~  357 (388)
                      +|. ++++++|+.+++++|+
T Consensus       284 iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         284 IPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CCC-STTGGGSCGGGTCSSS
T ss_pred             CCC-cccCCCCCHHHhCCCc
Confidence            663 4556666666666664
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure