Citrus Sinensis ID: 016565

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------
MVKAPSLISLAALAVKRELLLGDDVIPYVYELPADLFDILLTCLPPLALQKLQTKMPFRDGDDCGSPDYCFENGRKRGRYGNFNTVWKKLFKTRWSGFTDQIEPVDWQQRYWEAHVQGCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPSSVVVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSLQSLRLLNLRYDMIGNAVSLLLCKLFFPTINSWQFQ
ccccccHHHHHHHHHHHHHcccccccHHHHcccHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccccccccccccHHcccHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHccccccccHHccccccccccccccccHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHHcccccccEEEccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHcccccccccc
ccccHHHHHHHHHHHHHHHHcccccccHHHHccHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHcccccccccccccHHHHHHHHHHcHHHHHHcccccEHHHHHHHHHHHHHHHHHEEEEEccHHHHHHHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHcccccccEEEEEEEEccccccccccccHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHccccccEEEccHcHHHHHHHHcccccccccccccccHHHHHEEEccHcccccHHHHHHHHHHcccccccccc
MVKAPSLISLAALAVKRELllgddvipyvyelPADLFDILLTclpplalqklqtkmpfrdgddcgspdycfengrkrgrygnfNTVWKKLFKTRwsgftdqiepvdWQQRYWEAHVQGCLDEAAElvvlpsfrglisdinisdTILNYIGYEQQMNHLacdysklsyhcqqfgHYARCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHcklspsfvEGICRSLCSKRKRIHKIENLSIDISSFIENCPSSVVVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSslsildlsgnsiggwlskydrsgplfslgagkslqSLRLLNLRYDMIGNAVSLLLCKLffptinswqfq
mvkapsliSLAALAVKRELLLGDDVIPYVYELPADLFDILLTCLPPLALQKLQTKMPFRDGDDCGSPDYCFengrkrgrygnfNTVWKKLFKTRWSGFTDQIEPVDWQQRYWEAHVQGCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPSSVVVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSLQSLRLLNLRYDMIGNAVSLLLCKLFFPTINSWQFQ
MVKAPSLISLAALAVKRELLLGDDVIPYVYELPADLFDILLTCLPPLALQKLQTKMPFRDGDDCGSPDYCFENGRKRGRYGNFNTVWKKLFKTRWSGFTDQIEPVDWQQRYWEAHVQGCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPssvvvelvsflssGRSLCSLKLRHCHLDRDFGRMVFsslleassslsildlsgnsIGGWLSKYDRSGPLFSLGAGKSLQSLRLLNLRYDMIGNAVSLLLCKLFFPTINSWQFQ
******LISLAALAVKRELLLGDDVIPYVYELPADLFDILLTCLPPLALQKLQTKMPFRDGDDCGSPDYCFENGRKRGRYGNFNTVWKKLFKTRWSGFTDQIEPVDWQQRYWEAHVQGCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPSSVVVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSLQSLRLLNLRYDMIGNAVSLLLCKLFFPTINSWQ**
***APSLISLAALAVKRELLLGDDVIPYVYELPADLFDILLTCLPPLALQKLQTKMPFRDGDDCGSPDYCFENGRKRGRYGNFNTVWKKLFKTRWSGFTDQIEPVDWQQRYWEAHVQGCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCS*****HKIENLSIDISSFIENCPSSVVVELV**LSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSLQSLRLLNLRYDMIGNAVSLLLCKLFFPTI******
MVKAPSLISLAALAVKRELLLGDDVIPYVYELPADLFDILLTCLPPLALQKLQTKMPFRDGDDCGSPDYCFENGRKRGRYGNFNTVWKKLFKTRWSGFTDQIEPVDWQQRYWEAHVQGCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPSSVVVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSLQSLRLLNLRYDMIGNAVSLLLCKLFFPTINSWQFQ
*VKAPSLISLAALAVKRELLLGDDVIPYVYELPADLFDILLTCLPPLALQKLQTKMPFRDGDDCGSPDYCF***RKRGRYGNFNTVWKKLFKTRWSGFTDQIEPVDWQQRYWEAHVQGCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPSSVVVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSLQSLRLLNLRYDMIGNAVSLLLCKLFFPTINSWQFQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKAPSLISLAALAVKRELLLGDDVIPYVYELPADLFDILLTCLPPLALQKLQTKMPFRDGDDCGSPDYCFENGRKRGRYGNFNTVWKKLFKTRWSGFTDQIEPVDWQQRYWEAHVQGCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPSSVVVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSLQSLRLLNLRYDMIGNAVSLLLCKLFFPTINSWQFQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
255560275 598 protein binding protein, putative [Ricin 0.896 0.580 0.558 1e-100
297744269 580 unnamed protein product [Vitis vinifera] 0.981 0.655 0.492 1e-98
356503658 604 PREDICTED: uncharacterized protein LOC10 0.927 0.594 0.513 7e-92
449475557 604 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.930 0.596 0.530 4e-91
449443929 604 PREDICTED: uncharacterized protein LOC10 0.930 0.596 0.530 4e-91
359480084 834 PREDICTED: uncharacterized protein LOC10 0.899 0.417 0.490 1e-89
356570694 625 PREDICTED: uncharacterized protein LOC10 0.927 0.574 0.475 8e-87
42569177 604 leucine-rich repeats-ribonuclease inhibi 0.917 0.587 0.525 2e-83
297832112 603 leucine-rich repeat family protein [Arab 0.930 0.597 0.528 5e-80
357154921 653 PREDICTED: uncharacterized protein LOC10 0.896 0.531 0.398 1e-59
>gi|255560275|ref|XP_002521155.1| protein binding protein, putative [Ricinus communis] gi|223539724|gb|EEF41306.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 201/360 (55%), Positives = 248/360 (68%), Gaps = 13/360 (3%)

Query: 14  AVKRELLLGDDVI--PYVYELPADLFDILLTCLPPLALQKLQTKMPFRD--GDDCG-SPD 68
           A+KR+L+ GDDV+    +YE+P+ LF IL+T LPPLAL  LQ +MP+ +  G +C    D
Sbjct: 3   AIKRQLISGDDVLMLAEIYEIPSHLFSILVTKLPPLALHNLQMEMPYENSNGYECSDGGD 62

Query: 69  YCFENGRKRGRYGNFNTVWKKLFKTRWSGF--TDQIEPVDWQQRYWEAHVQGCLDEAAEL 126
            C + GRKRGR   FNT WK LFK RW     TD +E  +W Q YWE H+Q CLDEAA  
Sbjct: 63  GCSKIGRKRGRSCKFNTEWKTLFKLRWPQIVDTDSVESDNWHQAYWEKHLQNCLDEAAGS 122

Query: 127 VVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALC 186
            ++ SF G I +I + D IL +IG E  +NH    YSKLSYH QQ GHYARCLRLQN LC
Sbjct: 123 SMV-SFDGCIGEIKVPDYILKWIGCEGHLNHSI--YSKLSYHFQQLGHYARCLRLQNVLC 179

Query: 187 VEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGIC 246
           V ETCQLLR S+LQ+L LRWIR +EHV  LC+LLIQN ETL SLEF+HCKLS +FV+ IC
Sbjct: 180 VAETCQLLRNSQLQNLALRWIRSQEHVDGLCQLLIQNRETLTSLEFVHCKLSSTFVDAIC 239

Query: 247 RSLCSKRKRIHKIENLSIDISSFIENCPSSVVVELVSFLSSGRSLCSLKLRHCHLDRDFG 306
           RSL  K K+ H I+N SI  S F+E    S+   LVSFLSSGRSLCSL+    HLDR F 
Sbjct: 240 RSLEIKDKQTHGIKNFSIRTSIFLETDLVSLPPSLVSFLSSGRSLCSLRFSGNHLDRKFA 299

Query: 307 RMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLF---SLGAGKSLQSLRLLNLRYD 363
           R++F+ L + SS++S+LDLS N I GWLS ++R        + G  KSLQSLR+LN+R +
Sbjct: 300 RILFTLLFDDSSNISVLDLSDNIIAGWLSNFNRGSSSMVPSTFGITKSLQSLRILNVRNN 359

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297744269|emb|CBI37239.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356503658|ref|XP_003520623.1| PREDICTED: uncharacterized protein LOC100794405 [Glycine max] Back     alignment and taxonomy information
>gi|449475557|ref|XP_004154489.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101227026 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449443929|ref|XP_004139728.1| PREDICTED: uncharacterized protein LOC101206924 [Cucumis sativus] Back     alignment and taxonomy information
>gi|359480084|ref|XP_002267362.2| PREDICTED: uncharacterized protein LOC100261775 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356570694|ref|XP_003553520.1| PREDICTED: uncharacterized protein LOC100817679 [Glycine max] Back     alignment and taxonomy information
>gi|42569177|ref|NP_179611.2| leucine-rich repeats-ribonuclease inhibitor domain-containing protein [Arabidopsis thaliana] gi|330251888|gb|AEC06982.1| leucine-rich repeats-ribonuclease inhibitor domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297832112|ref|XP_002883938.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297329778|gb|EFH60197.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357154921|ref|XP_003576947.1| PREDICTED: uncharacterized protein LOC100822893 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
TAIR|locus:2039027 604 AT2G20210 "AT2G20210" [Arabido 0.984 0.630 0.465 1.8e-78
TAIR|locus:2039027 AT2G20210 "AT2G20210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 789 (282.8 bits), Expect = 1.8e-78, P = 1.8e-78
 Identities = 181/389 (46%), Positives = 223/389 (57%)

Query:     1 MVKAPSLISLAALAVKRELLLGDDVIPYVYELPADLFDILLTCLPPLALQKLQTKMPFR- 59
             M KAPSL  L   ++K +LL  D+ IP +YELP++L D ++  LP LALQK QT MPF  
Sbjct:     1 MTKAPSLAFLCIQSLKIQLLESDNPIPDLYELPSELLDGIVAHLPALALQKFQTNMPFHC 60

Query:    60 -DGDDCGSPDYCFENGRKRGRYGNFNTVWKKLFKTRWSGFTDQIE-PVDWQQRYWEAHVQ 117
              D  + G  D C   GRKR R     + WK LFK RW  F D++E P DWQQ YWE H+Q
Sbjct:    61 LDSYESGD-DCCLITGRKRARNDVLGSSWKLLFKLRWPDFVDRVESPADWQQLYWEKHLQ 119

Query:   118 GCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQ-MNHLACDYSKLSYHCQQFGHYA 176
              C+DEAAE+ + P+F G I  IN+SD IL YI +E+  M    C   +LS+H Q FG Y 
Sbjct:   120 NCVDEAAEVALRPTFSGRICSINVSDNILRYICHEEHIMTCQNCVCKELSFHFQTFGPYL 179

Query:   177 RCLRLQNALCVEETCQLLRESKLQSLVLRWIRFEEHVQALCKLLIQNSETLASLEFLHCK 236
             RCLRL N LCV ET +LLR SKL+SLVLRWIR E+HV+ LCKLLIQ+ ETL SLE +HCK
Sbjct:   180 RCLRLLNVLCVTETSELLRTSKLRSLVLRWIRSEKHVEPLCKLLIQSRETLTSLELIHCK 239

Query:   237 LSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPXXXXXXXXXXXXXGRSLCSLKL 296
             LS S +  IC SL  K      ++   I  SS IE  P              R+L SL  
Sbjct:   240 LSLSSISAICTSLHEKGIHTTGMQRFCIKTSS-IEIDPLAAPSAFVSFLMSVRTLHSLHF 298

Query:   297 RHCHLDRDFGRMVFXXXXXXXXXXXXXXXXXXXIGGWLSKYDRSGPLFSLGAGKSLQSLR 356
                +LDR F RMVF                   I GWLS +     + SL +GKSLQSL 
Sbjct:   299 GDSNLDRYFARMVFSTLLDSSSNLSSLDLSENNISGWLSTFSCKSVVGSLSSGKSLQSLC 358

Query:   357 LLNLRYDMIG--NAVSLLLCKLFFPTINS 383
              LNLR + +   +A +L    L  P + S
Sbjct:   359 KLNLRGNELDRYDAENLAHALLHMPGLES 387


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.326   0.141   0.449    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      387       355   0.00080  117 3  11 22  0.46    33
                                                     34  0.45    37


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  621 (66 KB)
  Total size of DFA:  278 KB (2145 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  29.32u 0.10s 29.42t   Elapsed:  00:00:01
  Total cpu time:  29.32u 0.10s 29.42t   Elapsed:  00:00:01
  Start:  Sat May 11 15:39:01 2013   End:  Sat May 11 15:39:02 2013
GO:0016114 "terpenoid biosynthetic process" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT2G20210
leucine-rich repeat family protein; leucine-rich repeat family protein; FUNCTIONS IN- protein binding; LOCATED IN- endomembrane system; EXPRESSED IN- 12 plant structures; EXPRESSED DURING- 4 anthesis, F mature embryo stage, petal differentiation and expansion stage, D bilateral stage, E expanded cotyledon stage; CONTAINS InterPro DOMAIN/s- Leucine-rich repeat (InterPro-IPR001611), Leucine-rich repeat, ribonuclease inhibitor subtype (InterPro-IPR003590); Has 1691 Blast hits to 1352 proteins in 107 species- Archae - 0; Bacteria - 100; Metazoa - 1035; Fungi - 8; Plants - 127; Viruses - 0; [...] (604 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 387
KOG4308 478 consensus LRR-containing protein [Function unknown 99.46
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.39
KOG4308 478 consensus LRR-containing protein [Function unknown 99.37
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 98.98
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 98.93
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 98.17
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.12
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 98.01
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.75
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.55
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.41
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.37
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.25
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.98
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.87
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 96.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.63
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.56
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 96.52
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.41
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.74
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 95.67
PLN03150623 hypothetical protein; Provisional 95.66
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.61
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 95.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.38
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 95.28
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 95.26
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 95.2
PLN03150623 hypothetical protein; Provisional 95.06
KOG0617264 consensus Ras suppressor protein (contains leucine 94.96
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 94.87
KOG2982 418 consensus Uncharacterized conserved protein [Funct 94.62
KOG1947 482 consensus Leucine rich repeat proteins, some prote 94.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 94.46
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 94.43
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 94.12
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 93.95
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 93.06
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 92.76
KOG3926332 consensus F-box proteins [Amino acid transport and 92.25
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.09
KOG0472565 consensus Leucine-rich repeat protein [Function un 91.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 91.79
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 91.61
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 91.48
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 91.15
KOG2982 418 consensus Uncharacterized conserved protein [Funct 90.77
PF06881109 Elongin_A: RNA polymerase II transcription factor 90.55
PLN03210 1153 Resistant to P. syringae 6; Provisional 90.27
KOG0472 565 consensus Leucine-rich repeat protein [Function un 89.75
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 89.02
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 88.68
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 87.68
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 83.24
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 82.79
KOG4341483 consensus F-box protein containing LRR [General fu 82.52
KOG4237498 consensus Extracellular matrix protein slit, conta 81.75
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 81.55
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.49
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 80.44
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.3
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information 
Probab=99.46  E-value=9.5e-15  Score=152.29  Aligned_cols=165  Identities=21%  Similarity=0.136  Sum_probs=146.7

Q ss_pred             ccccccccc-ccHHhHHHHHHHHhhCCCCCcEEEcccCCCChhHHHHHHHHhcCCCcccccccceeecccccccCCCcch
Q 016565          199 LQSLVLRWI-RFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPSSV  277 (387)
Q Consensus       199 Lq~L~l~~~-ls~~~~~~L~~~L~~n~~~Lt~L~L~~n~L~d~~v~~LCe~L~~p~C~~~~Lq~L~L~~c~l~~~~~~~~  277 (387)
                      +..+.+..+ +.+.+++.++.++.++ .+|+.|+|++|++++.|+..+|++|++|.|   .++.|.+..|.++...+.  
T Consensus        89 l~~L~L~~~~l~~~~~~~l~~~l~t~-~~L~~L~l~~n~l~~~g~~~l~~~l~~~~~---~l~~L~l~~c~l~~~g~~--  162 (478)
T KOG4308|consen   89 LLHLSLANNRLGDRGAEELAQALKTL-PTLGQLDLSGNNLGDEGARLLCEGLRLPQC---LLQTLELVSCSLTSEGAA--  162 (478)
T ss_pred             HHHhhhhhCccccchHHHHHHHhccc-ccHhHhhcccCCCccHhHHHHHhhcccchH---HHHHHHhhcccccccchH--
Confidence            344444433 6677999999999966 799999999999999999999999999999   999999999998665554  


Q ss_pred             hHHHHHHHhcCCCCceeeCCCCCCCchhHHHHHHHhcc---CCCccceEeccCcccCCcccccCCcchhhhhccCCCCCC
Q 016565          278 VVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLE---ASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSLQS  354 (387)
Q Consensus       278 ~~~L~s~L~~n~sL~~LdLs~N~L~D~GvklLC~~Ll~---psc~L~~L~L~~n~L~g~l~~~~c~~Ls~aL~~n~s~qs  354 (387)
                        .++.+|..+++|++||++.|.+.+.|...++.+|.+   |.|.+++|.|..|.+|.    .+|..++.+|...++  .
T Consensus       163 --~l~~~L~~~~~l~~l~l~~n~l~~~g~~~l~~~l~~~~~~~~~le~L~L~~~~~t~----~~c~~l~~~l~~~~~--~  234 (478)
T KOG4308|consen  163 --PLAAVLEKNEHLTELDLSLNGLIELGLLVLSQALESAASPLSSLETLKLSRCGVTS----SSCALLDEVLASGES--L  234 (478)
T ss_pred             --HHHHHHhcccchhHHHHHhcccchhhhHHHhhhhhhhhcccccHHHHhhhhcCcCh----HHHHHHHHHHhccch--h
Confidence              789999999999999999999999999999999998   99999999999999993    678889999998753  3


Q ss_pred             CCeeeCCCCCCCChHHHHHHhhh
Q 016565          355 LRLLNLRYDMIGNAVSLLLCKLF  377 (387)
Q Consensus       355 Lt~L~L~~N~LgD~GVk~LCeaL  377 (387)
                      +..|++..|.++|.|++.|+..|
T Consensus       235 ~~el~l~~n~l~d~g~~~L~~~l  257 (478)
T KOG4308|consen  235 LRELDLASNKLGDVGVEKLLPCL  257 (478)
T ss_pred             hHHHHHHhcCcchHHHHHHHHHh
Confidence            88899999999999999999877

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3926 consensus F-box proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06881 Elongin_A: RNA polymerase II transcription factor SIII (Elongin) subunit A; InterPro: IPR010684 This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-10
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-10
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-06
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
 Score = 59.7 bits (145), Expect = 4e-10
 Identities = 39/219 (17%), Positives = 72/219 (32%), Gaps = 34/219 (15%)

Query: 186 CVEETCQLLRESK--LQSLVLRWIRF-EEHVQALCKLLIQNSETLASLEFLHCKLSPSFV 242
              E  Q    +   + SL L       ++   L ++L      + SL      LS    
Sbjct: 38  STVELIQAFANTPASVTSLNLSGNSLGFKNSDELVQILAAIPANVTSLNLSGNFLSYKSS 97

Query: 243 EGICRSLCSKRKRIHKIENLS---------IDISSFIENCPSSV--------------VV 279
           + + ++L +    I  + +L           +      N P+S+                
Sbjct: 98  DELVKTLAAIPFTITVL-DLGWNDFSSKSSSEFKQAFSNLPASITSLNLRGNDLGIKSSD 156

Query: 280 ELVSFLSSG-RSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYD 338
           EL+  L++   ++ SL LR  +L       +   L    +S++ LDLS N +G       
Sbjct: 157 ELIQILAAIPANVNSLNLRGNNLASKNCAELAKFLASIPASVTSLDLSANLLG------L 210

Query: 339 RSGPLFSLGAGKSLQSLRLLNLRYDMIGNAVSLLLCKLF 377
           +S    +         +  LNL  + +       L  L 
Sbjct: 211 KSYAELAYIFSSIPNHVVSLNLCLNCLHGPSLENLKLLK 249
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.9
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.77
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.68
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.67
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.66
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.61
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.6
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.52
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.51
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.0
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.73
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.69
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.53
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.44
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.38
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.38
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.35
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.24
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.19
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.18
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.17
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.14
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.1
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.1
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.04
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.03
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.02
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.01
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.01
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.01
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.99
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.99
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.99
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.98
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.98
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.98
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.97
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.97
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.96
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.96
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.93
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.91
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.9
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.89
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.88
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 97.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.81
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.79
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.77
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 97.77
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.76
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.75
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.74
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.73
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.72
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.71
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.71
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.7
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 97.7
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.7
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.7
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.7
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.68
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.68
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.68
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.67
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.66
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.66
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.64
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.63
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.63
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 97.62
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.62
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.62
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.6
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.58
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 97.56
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.54
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.52
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.51
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 97.41
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.36
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.34
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.34
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.26
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.03
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.94
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 96.9
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.85
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.83
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.82
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 96.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 96.75
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 96.68
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 94.84
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 91.69
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 91.17
3sb4_A 329 Hypothetical leucine rich repeat protein; LRR, rig 89.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 82.24
4hfx_A97 Transcription elongation factor B polypeptide 3; s 81.56
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 80.16
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=2e-23  Score=207.22  Aligned_cols=214  Identities=15%  Similarity=0.101  Sum_probs=168.8

Q ss_pred             HHHHHHHHHHhhhhhhhhhhccccccccchhhhhhhhhhhhhhhhhcccccccchhcccCccceEEeeecccchhhhhhh
Q 016565          114 AHVQGCLDEAAELVVLPSFRGLISDINISDTILNYIGYEQQMNHLACDYSKLSYHCQQFGHYARCLRLQNALCVEETCQL  193 (387)
Q Consensus       114 ~hLf~CL~E~qEe~fv~~~m~~i~ei~i~~~I~~~~d~~~~~~Cl~~~l~~Ls~~c~~~~~~vr~L~L~~~L~~~~~~~~  193 (387)
                      -.+|+||+|++++.|++.++..+..+.+...-.+..+...-+..+.           .                      
T Consensus        52 lnl~~cl~e~~~~~l~~~~~~~L~~L~Ls~n~l~~~~~~~l~~~L~-----------~----------------------   98 (372)
T 3un9_A           52 LDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLG-----------S----------------------   98 (372)
T ss_dssp             HHHHHHHHHHHTHHHHHHHHTTCCEEECTTSCCCHHHHHHHHHHHS-----------S----------------------
T ss_pred             HHHHHHHHHhcCHHHHHHHHhhCCEEEecCCCCCHHHHHHHHHHHh-----------h----------------------
Confidence            4679999999999999999999988877532222221110000000           0                      


Q ss_pred             cccccccccccccc-ccHHhHHHHHHHHhhCCCCCcEEEcccCCCChhHHHHHHHHhcCCCcccccccceeecccccccC
Q 016565          194 LRESKLQSLVLRWI-RFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIEN  272 (387)
Q Consensus       194 ~~~C~Lq~L~l~~~-ls~~~~~~L~~~L~~n~~~Lt~L~L~~n~L~d~~v~~LCe~L~~p~C~~~~Lq~L~L~~c~l~~~  272 (387)
                       ....+++|.++++ +++.+...++..|.    +|++|+|++|.+++.++..++++|+++.+   +|+.|.|..|.+ . 
T Consensus        99 -~~~~L~~L~Ls~n~l~~~~~~~l~~~L~----~L~~L~Ls~n~l~~~~~~~L~~~L~~~~~---~L~~L~Ls~n~l-~-  168 (372)
T 3un9_A           99 -GRHALDEVNLASCQLDPAGLRTLLPVFL----RARKLGLQLNSLGPEACKDLRDLLLHDQC---QITTLRLSNNPL-T-  168 (372)
T ss_dssp             -CSSCEEEEECTTCCCCHHHHHHTHHHHH----TEEEEECCSSCCCHHHHHHHHHHHHSTTC---CCCEEECCSSCC-H-
T ss_pred             -CCCCceEEEecCCCCCHHHHHHHHHHHH----hccHhhcCCCCCCHHHHHHHHHHHHhcCC---ccceeeCCCCCC-C-
Confidence             0124555555433 66667777777776    69999999999999999999999999888   999999999998 4 


Q ss_pred             CCcchhHHHHHHHhcCCCCceeeCCCCCCCchhHHHHHHHhccCCCccceEeccCcccCCcccccCCcchhhhhccCCCC
Q 016565          273 CPSSVVVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSL  352 (387)
Q Consensus       273 ~~~~~~~~L~s~L~~n~sL~~LdLs~N~L~D~GvklLC~~Ll~psc~L~~L~L~~n~L~g~l~~~~c~~Ls~aL~~n~s~  352 (387)
                        ......|+.+|..+++|++|||++|.|+|.|++.|+++|.++. +|++|+|++|.|++    .++.+++.+|..+   
T Consensus       169 --~~~~~~l~~~L~~~~~L~~L~Ls~N~l~~~g~~~L~~~L~~~~-~L~~L~Ls~N~i~~----~g~~~l~~~L~~~---  238 (372)
T 3un9_A          169 --AAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNR-QLQELNVAYNGAGD----TAALALARAAREH---  238 (372)
T ss_dssp             --HHHHHHHHHHHHTCSSCCEEECTTSSCHHHHHHHHHHHGGGCS-CCCEEECCSSCCCH----HHHHHHHHHHHHC---
T ss_pred             --hHHHHHHHHHHhcCCCcCEEeCCCCCCCcHHHHHHHHHHhcCC-CcCeEECCCCCCCH----HHHHHHHHHHHhC---
Confidence              2344578999999999999999999999999999999999887 89999999999994    3457788999888   


Q ss_pred             CCCCeeeCCCCCCCChHHHHHHhhhccC
Q 016565          353 QSLRLLNLRYDMIGNAVSLLLCKLFFPT  380 (387)
Q Consensus       353 qsLt~L~L~~N~LgD~GVk~LCeaL~~~  380 (387)
                      ++|++|+|++|.|+|.|++.|+++..++
T Consensus       239 ~~L~~L~Ls~N~i~~~g~~~L~~~~~~~  266 (372)
T 3un9_A          239 PSLELLHLYFNELSSEGRQVLRDLGGAA  266 (372)
T ss_dssp             SSCCEEECTTSSCCHHHHHHHHHCC---
T ss_pred             CCCCEEeccCCCCCHHHHHHHHHHhcCC
Confidence            4699999999999999999999987654
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4hfx_A Transcription elongation factor B polypeptide 3; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.54A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.72
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.46
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.38
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.28
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.76
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.67
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.18
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.16
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.06
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.53
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.45
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.42
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.34
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.29
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.29
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.28
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.2
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.17
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.15
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.1
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.95
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.4
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.32
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 96.31
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.3
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 96.27
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.11
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 95.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 95.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 94.58
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 93.87
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 85.46
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.72  E-value=1.5e-17  Score=158.05  Aligned_cols=166  Identities=23%  Similarity=0.260  Sum_probs=142.8

Q ss_pred             ccccccccc-cccHHhHHHHHHHHhhCCCCCcEEEcccCCCChhHHHHHHHHhcCCCcccccccceeecccccccCCCcc
Q 016565          198 KLQSLVLRW-IRFEEHVQALCKLLIQNSETLASLEFLHCKLSPSFVEGICRSLCSKRKRIHKIENLSIDISSFIENCPSS  276 (387)
Q Consensus       198 ~Lq~L~l~~-~ls~~~~~~L~~~L~~n~~~Lt~L~L~~n~L~d~~v~~LCe~L~~p~C~~~~Lq~L~L~~c~l~~~~~~~  276 (387)
                      .++.+.+.. ..........+.++..+ +.++.+++++|.+++.|++.+++.+....+   +|+.+.+..+.+ .+.   
T Consensus       256 ~l~~l~l~~n~i~~~~~~~~~~~l~~~-~~l~~l~l~~n~i~~~~~~~l~~~l~~~~~---~L~~l~l~~~~l-~~~---  327 (460)
T d1z7xw1         256 RLRTLWIWECGITAKGCGDLCRVLRAK-ESLKELSLAGNELGDEGARLLCETLLEPGC---QLESLWVKSCSF-TAA---  327 (460)
T ss_dssp             CCCEEECTTSCCCHHHHHHHHHHHHHC-TTCCEEECTTCCCHHHHHHHHHHHHTSTTC---CCCEEECTTSCC-BGG---
T ss_pred             ccccccccccccccccccccccccccc-ccccccccccccccccccchhhcccccccc---ccccccccccch-hhh---
Confidence            455665553 35666667777888755 799999999999999999999999999888   899999999987 422   


Q ss_pred             hhHHHHHHHhcCCCCceeeCCCCCCCchhHHHHHHHhccCCCccceEeccCcccCCcccccCCcchhhhhccCCCCCCCC
Q 016565          277 VVVELVSFLSSGRSLCSLKLRHCHLDRDFGRMVFSSLLEASSSLSILDLSGNSIGGWLSKYDRSGPLFSLGAGKSLQSLR  356 (387)
Q Consensus       277 ~~~~L~s~L~~n~sL~~LdLs~N~L~D~GvklLC~~Ll~psc~L~~L~L~~n~L~g~l~~~~c~~Ls~aL~~n~s~qsLt  356 (387)
                      ....|+.++..+++|++|||++|.++|+|+..+++++.+....|++|+|++|+|+.    .++.+++.+|..+   ++|+
T Consensus       328 ~~~~l~~~~~~~~~L~~L~Ls~N~i~~~g~~~l~~~l~~~~~~L~~L~Ls~n~i~~----~~~~~l~~~l~~~---~~L~  400 (460)
T d1z7xw1         328 CCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSD----SSCSSLAATLLAN---HSLR  400 (460)
T ss_dssp             GHHHHHHHHHHCSSCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCCH----HHHHHHHHHHHHC---CCCC
T ss_pred             hhhhcccccccccchhhhheeeecccCcccchhhhhhhcccCCCCEEECCCCCCCh----HHHHHHHHHHhcC---CCCC
Confidence            33468889999999999999999999999999999998888899999999999993    3456788889888   5799


Q ss_pred             eeeCCCCCCCChHHHHHHhhhc
Q 016565          357 LLNLRYDMIGNAVSLLLCKLFF  378 (387)
Q Consensus       357 ~L~L~~N~LgD~GVk~LCeaL~  378 (387)
                      +|+|++|.|+|+|+..|++++.
T Consensus       401 ~L~Ls~N~i~~~g~~~l~~~l~  422 (460)
T d1z7xw1         401 ELDLSNNCLGDAGILQLVESVR  422 (460)
T ss_dssp             EEECCSSSCCHHHHHHHHHHHT
T ss_pred             EEECCCCcCCHHHHHHHHHHHH
Confidence            9999999999999999999984
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure