Citrus Sinensis ID: 016653

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-----
MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
ccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHcccHHHHHHHHHHHHHcccccEEEEccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccc
cccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHEEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHcccHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MDSEGTQQAHLVLAHKRFllthpdvqdiekvglkGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFeeggdwerknRLKVYEGLYCMSTRNFKKAASLFLDSistfttyelfpydtfIFYTVLTSIISLdrvslkqkvvdapeiltviGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQikldrylyphFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEEnlgesevreaHLAKSLFYIQIGDKEKALEQLKVTesktvavgqkMDLVFYTLQLGFFYMDFDLISKSIDKAKSLfeeggdwerknrLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
*********HLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEM*************************************AHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKL******
**SEGTQQAHLVLAHKRFLLTHPDVQ**EKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAK***********KNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
********AHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
****GTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMxxxxxxxxxxxxxxxxxxxxxxxxxxxxEAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query385 2.2.26 [Sep-21-2011]
Q93Y35387 Probable 26S proteasome n yes no 0.994 0.989 0.851 0.0
Q8W425389 26S proteasome non-ATPase yes no 0.992 0.982 0.842 0.0
Q15008389 26S proteasome non-ATPase yes no 0.994 0.984 0.525 1e-118
Q3T0B2389 26S proteasome non-ATPase yes no 0.994 0.984 0.528 1e-118
Q99JI4389 26S proteasome non-ATPase yes no 0.994 0.984 0.525 1e-118
Q9V3G7389 26S proteasome non-ATPase yes no 0.979 0.969 0.506 1e-113
Q55C75382 26S proteasome non-ATPase yes no 0.896 0.903 0.524 1e-108
Q20585410 26S proteasome non-ATPase yes no 0.971 0.912 0.477 3e-95
Q10335409 Probable 26S proteasome r yes no 0.979 0.921 0.409 1e-83
Q06103429 26S proteasome regulatory yes no 0.935 0.839 0.362 3e-68
>sp|Q93Y35|PSMD6_ARATH Probable 26S proteasome non-ATPase regulatory subunit 6 OS=Arabidopsis thaliana GN=At4g24820 PE=2 SV=1 Back     alignment and function desciption
 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/383 (85%), Positives = 360/383 (93%)

Query: 3   SEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMD 62
           +EG+QQ HL+LA+K FLLTHPDV DIEKV LK EV   +++H MA  YETL+A SVL++D
Sbjct: 5   AEGSQQPHLILANKLFLLTHPDVPDIEKVQLKSEVLDFIRSHGMAPLYETLIASSVLDLD 64

Query: 63  QSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKV 122
           QS+L+SMR   E+ELKKLD++IADAEENLGESEVREAHLAK+L++I+I DKEKALEQLK+
Sbjct: 65  QSLLESMRAANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLKL 124

Query: 123 TESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGL 182
           TE KTVAVGQKMD+VFYTLQL FFYMDFDL+SKSIDKAK LFEEGGDWERKNRLKVYEGL
Sbjct: 125 TEGKTVAVGQKMDVVFYTLQLAFFYMDFDLVSKSIDKAKKLFEEGGDWERKNRLKVYEGL 184

Query: 183 YCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEI 242
           YCMSTRNFKKAASLFLDSISTFTTYE+FPY+TFIFYTVLTSII+LDRVSLKQKVVDAPEI
Sbjct: 185 YCMSTRNFKKAASLFLDSISTFTTYEIFPYETFIFYTVLTSIITLDRVSLKQKVVDAPEI 244

Query: 243 LTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQ 302
           LTV+GKIP+LSEFLNSLY+CQYK+FFSAFAG+  QIK DRYLYPHFR+YMREVRTVVYSQ
Sbjct: 245 LTVLGKIPFLSEFLNSLYECQYKAFFSAFAGMAVQIKYDRYLYPHFRFYMREVRTVVYSQ 304

Query: 303 FLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALY 362
           FLESYKSVT+EAMAKAFGV+V+FID ELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALY
Sbjct: 305 FLESYKSVTVEAMAKAFGVSVDFIDQELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALY 364

Query: 363 QATIKQGDFLLNRIQKLSRVIDL 385
           QATIKQGDFLLNRIQKLSRVIDL
Sbjct: 365 QATIKQGDFLLNRIQKLSRVIDL 387
Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8W425|PSMD6_ORYSJ 26S proteasome non-ATPase regulatory subunit 6 OS=Oryza sativa subsp. japonica GN=RPN7 PE=2 SV=1 Back     alignment and function description
>sp|Q15008|PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens GN=PSMD6 PE=1 SV=1 Back     alignment and function description
>sp|Q3T0B2|PSMD6_BOVIN 26S proteasome non-ATPase regulatory subunit 6 OS=Bos taurus GN=PSMD6 PE=2 SV=1 Back     alignment and function description
>sp|Q99JI4|PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus GN=Psmd6 PE=1 SV=1 Back     alignment and function description
>sp|Q9V3G7|PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster GN=Rpn7 PE=2 SV=1 Back     alignment and function description
>sp|Q55C75|PSMD6_DICDI 26S proteasome non-ATPase regulatory subunit 6 OS=Dictyostelium discoideum GN=psmD6 PE=1 SV=1 Back     alignment and function description
>sp|Q20585|PSMD6_CAEEL 26S proteasome non-ATPase regulatory subunit 6 OS=Caenorhabditis elegans GN=rpn-7 PE=3 SV=1 Back     alignment and function description
>sp|Q10335|RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn7 PE=2 SV=1 Back     alignment and function description
>sp|Q06103|RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN7 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query385
225457441386 PREDICTED: 26S proteasome non-ATPase reg 0.992 0.989 0.929 0.0
255540369386 26S proteasome non-atpase regulatory sub 0.992 0.989 0.916 0.0
224133850386 predicted protein [Populus trichocarpa] 1.0 0.997 0.909 0.0
224119590386 predicted protein [Populus trichocarpa] 0.997 0.994 0.903 0.0
307136119386 26S proteasome non-ATPase regulatory sub 0.992 0.989 0.900 0.0
449469610386 PREDICTED: probable 26S proteasome non-A 0.992 0.989 0.903 0.0
449487714386 PREDICTED: LOW QUALITY PROTEIN: probable 0.992 0.989 0.897 0.0
363807644386 uncharacterized protein LOC100810692 [Gl 0.992 0.989 0.892 0.0
297799516387 hypothetical protein ARALYDRAFT_492356 [ 0.994 0.989 0.856 0.0
357477207387 26S proteasome non-ATPase regulatory sub 0.997 0.992 0.869 0.0
>gi|225457441|ref|XP_002262921.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Vitis vinifera] gi|297733617|emb|CBI14864.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/382 (92%), Positives = 368/382 (96%)

Query: 4   EGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQ 63
           +GTQQ HLVLAHK FLLTHPD QDIEKV LK EVF+ VK  DMAS YETL A+SVLEMDQ
Sbjct: 5   DGTQQPHLVLAHKLFLLTHPDAQDIEKVRLKEEVFAAVKVDDMASLYETLAADSVLEMDQ 64

Query: 64  SVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVT 123
           +VLD+MR KI+DELKKLD++IADAEENLGESEVREAHLAKSLFYI+IGDKEKALEQLKVT
Sbjct: 65  AVLDTMRAKIDDELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQLKVT 124

Query: 124 ESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLY 183
           ESKTVAVGQKMDLVFYTL LGFFYMDFDLISKSIDKAK+LFEEGGDWERKNRLKVYEGLY
Sbjct: 125 ESKTVAVGQKMDLVFYTLLLGFFYMDFDLISKSIDKAKNLFEEGGDWERKNRLKVYEGLY 184

Query: 184 CMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEIL 243
           CMSTRNFKKAA+LFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEIL
Sbjct: 185 CMSTRNFKKAANLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEIL 244

Query: 244 TVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQF 303
            VIGKIPYLSEFLNSLYDCQYKSFFSAFAGL EQIKLDRYL+PHFRYYMREVRTVVYSQF
Sbjct: 245 AVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLAEQIKLDRYLHPHFRYYMREVRTVVYSQF 304

Query: 304 LESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQ 363
           LESYKSVTIEAMAKAFGVTVEFID+ELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQ
Sbjct: 305 LESYKSVTIEAMAKAFGVTVEFIDLELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQ 364

Query: 364 ATIKQGDFLLNRIQKLSRVIDL 385
           ATIKQGDFLLNRIQKLSRVIDL
Sbjct: 365 ATIKQGDFLLNRIQKLSRVIDL 386

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255540369|ref|XP_002511249.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] gi|223550364|gb|EEF51851.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224133850|ref|XP_002321676.1| predicted protein [Populus trichocarpa] gi|222868672|gb|EEF05803.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224119590|ref|XP_002318111.1| predicted protein [Populus trichocarpa] gi|222858784|gb|EEE96331.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|307136119|gb|ADN33965.1| 26S proteasome non-ATPase regulatory subunit [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|449469610|ref|XP_004152512.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487714|ref|XP_004157764.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S proteasome non-ATPase regulatory subunit 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363807644|ref|NP_001242671.1| uncharacterized protein LOC100810692 [Glycine max] gi|255644637|gb|ACU22821.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297799516|ref|XP_002867642.1| hypothetical protein ARALYDRAFT_492356 [Arabidopsis lyrata subsp. lyrata] gi|297313478|gb|EFH43901.1| hypothetical protein ARALYDRAFT_492356 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357477207|ref|XP_003608889.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] gi|355509944|gb|AES91086.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query385
TAIR|locus:2126798387 AT4G24820 "AT4G24820" [Arabido 0.994 0.989 0.851 2.3e-174
ZFIN|ZDB-GENE-040426-1038386 psmd6 "proteasome (prosome, ma 0.987 0.984 0.538 4.3e-109
RGD|735127389 Psmd6 "proteasome (prosome, ma 0.994 0.984 0.528 3.5e-107
UNIPROTKB|F1MXE4389 PSMD6 "26S proteasome non-ATPa 0.994 0.984 0.531 4.4e-107
UNIPROTKB|F1N903398 PSMD6 "Uncharacterized protein 0.992 0.959 0.529 7.2e-107
UNIPROTKB|Q15008389 PSMD6 "26S proteasome non-ATPa 0.994 0.984 0.525 1.2e-106
MGI|MGI:1913663389 Psmd6 "proteasome (prosome, ma 0.994 0.984 0.525 1.5e-106
UNIPROTKB|Q3T0B2389 PSMD6 "26S proteasome non-ATPa 0.994 0.984 0.528 2.5e-106
UNIPROTKB|E2RN00516 PSMD6 "Uncharacterized protein 0.994 0.742 0.523 4e-106
UNIPROTKB|Q6UV22351 PSMD6 "KIAA0107 isoform" [Homo 0.888 0.974 0.564 6.7e-104
TAIR|locus:2126798 AT4G24820 "AT4G24820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1694 (601.4 bits), Expect = 2.3e-174, P = 2.3e-174
 Identities = 326/383 (85%), Positives = 360/383 (93%)

Query:     3 SEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMD 62
             +EG+QQ HL+LA+K FLLTHPDV DIEKV LK EV   +++H MA  YETL+A SVL++D
Sbjct:     5 AEGSQQPHLILANKLFLLTHPDVPDIEKVQLKSEVLDFIRSHGMAPLYETLIASSVLDLD 64

Query:    63 QSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKV 122
             QS+L+SMR   E+ELKKLD++IADAEENLGESEVREAHLAK+L++I+I DKEKALEQLK+
Sbjct:    65 QSLLESMRAANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLKL 124

Query:   123 TESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGL 182
             TE KTVAVGQKMD+VFYTLQL FFYMDFDL+SKSIDKAK LFEEGGDWERKNRLKVYEGL
Sbjct:   125 TEGKTVAVGQKMDVVFYTLQLAFFYMDFDLVSKSIDKAKKLFEEGGDWERKNRLKVYEGL 184

Query:   183 YCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEI 242
             YCMSTRNFKKAASLFLDSISTFTTYE+FPY+TFIFYTVLTSII+LDRVSLKQKVVDAPEI
Sbjct:   185 YCMSTRNFKKAASLFLDSISTFTTYEIFPYETFIFYTVLTSIITLDRVSLKQKVVDAPEI 244

Query:   243 LTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQ 302
             LTV+GKIP+LSEFLNSLY+CQYK+FFSAFAG+  QIK DRYLYPHFR+YMREVRTVVYSQ
Sbjct:   245 LTVLGKIPFLSEFLNSLYECQYKAFFSAFAGMAVQIKYDRYLYPHFRFYMREVRTVVYSQ 304

Query:   303 FLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALY 362
             FLESYKSVT+EAMAKAFGV+V+FID ELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALY
Sbjct:   305 FLESYKSVTVEAMAKAFGVSVDFIDQELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALY 364

Query:   363 QATIKQGDFLLNRIQKLSRVIDL 385
             QATIKQGDFLLNRIQKLSRVIDL
Sbjct:   365 QATIKQGDFLLNRIQKLSRVIDL 387
GO:0003674 "molecular_function" evidence=ND
GO:0008541 "proteasome regulatory particle, lid subcomplex" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
GO:0005634 "nucleus" evidence=TAS
GO:0030163 "protein catabolic process" evidence=TAS
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0000502 "proteasome complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009735 "response to cytokinin stimulus" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0042023 "DNA endoreduplication" evidence=RCA
GO:0043090 "amino acid import" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0043248 "proteasome assembly" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0051302 "regulation of cell division" evidence=RCA
GO:0051510 "regulation of unidimensional cell growth" evidence=RCA
GO:0051604 "protein maturation" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
ZFIN|ZDB-GENE-040426-1038 psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|735127 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXE4 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N903 PSMD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q15008 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913663 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0B2 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RN00 PSMD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6UV22 PSMD6 "KIAA0107 isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9V3G7PSMD6_DROMENo assigned EC number0.50650.97920.9691yesno
Q3T0B2PSMD6_BOVINNo assigned EC number0.52840.99480.9845yesno
Q20585PSMD6_CAEELNo assigned EC number0.47760.97140.9121yesno
Q93Y35PSMD6_ARATHNo assigned EC number0.85110.99480.9896yesno
Q06103RPN7_YEASTNo assigned EC number0.36250.93500.8391yesno
Q55C75PSMD6_DICDINo assigned EC number0.52460.89610.9031yesno
Q99JI4PSMD6_MOUSENo assigned EC number0.52590.99480.9845yesno
Q10335RPN7_SCHPONo assigned EC number0.40930.97920.9217yesno
Q8W425PSMD6_ORYSJNo assigned EC number0.84290.99220.9820yesno
Q15008PSMD6_HUMANNo assigned EC number0.52590.99480.9845yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query385
COG5187412 COG5187, RPN7, 26S proteasome regulatory complex c 1e-107
pfam10602174 pfam10602, RPN7, 26S proteasome subunit RPN7 6e-74
pfam01399100 pfam01399, PCI, PCI domain 8e-19
smart0075388 smart00753, PAM, PCI/PINT associated module 8e-16
smart0008888 smart00088, PINT, motif in proteasome subunits, In 8e-16
>gnl|CDD|227514 COG5187, RPN7, 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  320 bits (822), Expect = e-107
 Identities = 139/389 (35%), Positives = 229/389 (58%), Gaps = 12/389 (3%)

Query: 1   MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAE---- 56
                 Q   L+++   FLL    + + E   L+  +  ++    MA  Y+ L  +    
Sbjct: 13  PMDFDFQVPTLLVSDAIFLLHGTKLGNPESKALE-HLERLIIDKCMAPLYKYLAEKGNPK 71

Query: 57  ---SVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDK 113
              SV++ D+  ++++  K E+++++LD+RI + EE+ GE+E  EA    + +Y QI D 
Sbjct: 72  TSASVIKFDRGRMNTLLKKNEEKIEELDERIREKEEDNGETEGSEADRNIAEYYCQIMDI 131

Query: 114 EKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERK 173
           +   E ++      ++ G K+D+    ++LG  Y D  ++ +S++ A  + E+GGDWER+
Sbjct: 132 QNGFEWMRRLMRDAMSTGLKIDVFLCKIRLGLIYGDRKVVEESLEVADDIIEKGGDWERR 191

Query: 174 NRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLK 233
           NR KVY+G++ M  RNFK+AA L  D + TF + EL  Y   + Y +   ++ L+R  +K
Sbjct: 192 NRYKVYKGIFKMMRRNFKEAAILLSDILPTFESSELISYSRAVRYAIFCGLLRLERRDIK 251

Query: 234 QKVVDAPEILTVIG---KIPYLSEFLNSLYDCQYKSFFSAFAGL-TEQIKLDRYLYPHFR 289
            K++D+PE+L VIG   K+  L +   SLY+C Y   F     L    ++ D +L  H  
Sbjct: 252 TKILDSPEVLDVIGSSEKLGSLVQLATSLYECDYGGDFMNLLYLFCNSLQDDVFLGRHVD 311

Query: 290 YYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGV 349
            ++RE+R  VY+Q LESY+ +++E+MA+ FGV+VE++D +L  FI  G+L+C ID+V GV
Sbjct: 312 LFVREMRRRVYAQLLESYRLLSLESMAQTFGVSVEYVDRDLGEFIPEGRLNCVIDRVNGV 371

Query: 350 LETNRPDAKNALYQATIKQGDFLLNRIQK 378
           +ETNRPD KN  Y + +KQGD LL ++QK
Sbjct: 372 VETNRPDEKNQQYSSVVKQGDDLLRKLQK 400

Length = 412
>gnl|CDD|220821 pfam10602, RPN7, 26S proteasome subunit RPN7 Back     alignment and domain information
>gnl|CDD|216479 pfam01399, PCI, PCI domain Back     alignment and domain information
>gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module Back     alignment and domain information
>gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 385
KOG0687393 consensus 26S proteasome regulatory complex, subun 100.0
COG5187412 RPN7 26S proteasome regulatory complex component, 100.0
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 100.0
KOG2758432 consensus Translation initiation factor 3, subunit 100.0
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 100.0
KOG1463411 consensus 26S proteasome regulatory complex, subun 100.0
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 100.0
COG5159421 RPN6 26S proteasome regulatory complex component [ 100.0
KOG1498439 consensus 26S proteasome regulatory complex, subun 99.86
COG5071439 RPN5 26S proteasome regulatory complex component [ 99.78
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 99.77
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 99.69
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 99.54
smart0075388 PAM PCI/PINT associated module. 99.54
KOG2908380 consensus 26S proteasome regulatory complex, subun 99.43
KOG2581493 consensus 26S proteasome regulatory complex, subun 99.21
KOG2582422 consensus COP9 signalosome, subunit CSN3 [Posttran 98.84
PF09440133 eIF3_N: eIF3 subunit 6 N terminal domain; InterPro 98.57
KOG2753378 consensus Uncharacterized conserved protein, conta 98.45
KOG1076843 consensus Translation initiation factor 3, subunit 98.36
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.07
KOG2688394 consensus Transcription-associated recombination p 97.52
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.52
PF10075143 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro 97.25
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 97.07
COG5600413 Transcription-associated recombination protein [DN 97.06
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.79
PF09756188 DDRGK: DDRGK domain; InterPro: IPR019153 This is a 96.56
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.47
KOG2072 988 consensus Translation initiation factor 3, subunit 96.43
PF03399204 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; I 96.35
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.21
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.14
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 96.01
PF12688120 TPR_5: Tetratrico peptide repeat 95.83
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 95.76
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.72
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.64
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.41
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 95.37
PRK15331165 chaperone protein SicA; Provisional 95.24
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.09
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 94.94
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.91
CHL00033168 ycf3 photosystem I assembly protein Ycf3 94.9
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.89
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.52
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 94.41
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 94.37
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.36
KOG1586288 consensus Protein required for fusion of vesicles 94.33
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.25
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 94.13
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.08
PRK10803263 tol-pal system protein YbgF; Provisional 94.07
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 94.02
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 93.95
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 93.93
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 93.83
KOG3054299 consensus Uncharacterized conserved protein [Funct 93.75
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.6
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 93.44
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.39
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 93.23
KOG2003840 consensus TPR repeat-containing protein [General f 93.2
KOG1125579 consensus TPR repeat-containing protein [General f 93.19
PRK10370198 formate-dependent nitrite reductase complex subuni 93.06
KOG1861540 consensus Leucine permease transcriptional regulat 92.98
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 92.58
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.56
PRK11788389 tetratricopeptide repeat protein; Provisional 92.55
KOG3677525 consensus RNA polymerase I-associated factor - PAF 92.54
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.23
PRK1543178 ferrous iron transport protein FeoC; Provisional 92.12
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 92.03
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 91.89
PRK15359144 type III secretion system chaperone protein SscB; 91.54
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 91.33
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 91.22
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 91.13
COG184990 Uncharacterized protein conserved in archaea [Func 91.0
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 90.97
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 90.7
cd00189100 TPR Tetratricopeptide repeat domain; typically con 90.67
PF1342844 TPR_14: Tetratricopeptide repeat 90.65
COG4235287 Cytochrome c biogenesis factor [Posttranslational 90.53
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 90.51
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.36
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 90.06
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 89.86
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 89.7
PRK11189296 lipoprotein NlpI; Provisional 89.44
KOG0547 606 consensus Translocase of outer mitochondrial membr 89.44
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 88.86
KOG1585308 consensus Protein required for fusion of vesicles 88.85
cd05804355 StaR_like StaR_like; a well-conserved protein foun 88.67
PF13512142 TPR_18: Tetratricopeptide repeat 88.5
KOG2376 652 consensus Signal recognition particle, subunit Srp 88.11
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 87.94
PF1337173 TPR_9: Tetratricopeptide repeat 87.9
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 87.88
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 87.87
COG4700251 Uncharacterized protein conserved in bacteria cont 87.75
PF09743272 DUF2042: Uncharacterized conserved protein (DUF204 87.54
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 87.36
PRK10803263 tol-pal system protein YbgF; Provisional 86.71
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 86.69
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 86.09
PF1286294 Apc5: Anaphase-promoting complex subunit 5 86.06
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 85.75
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 85.42
KOG4414197 consensus COP9 signalosome, subunit CSN8 [Posttran 85.05
PRK12370553 invasion protein regulator; Provisional 84.83
CHL00033168 ycf3 photosystem I assembly protein Ycf3 84.8
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 84.52
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.48
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 84.43
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 84.06
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 83.99
PRK14574 822 hmsH outer membrane protein; Provisional 83.88
PF03704146 BTAD: Bacterial transcriptional activator domain; 83.75
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 83.74
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.47
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 83.44
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 83.28
PRK11189296 lipoprotein NlpI; Provisional 83.02
PRK15359144 type III secretion system chaperone protein SscB; 82.75
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Pr 82.69
PRK12370553 invasion protein regulator; Provisional 82.29
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 82.23
PRK04424185 fatty acid biosynthesis transcriptional regulator; 82.13
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 82.06
KOG3060289 consensus Uncharacterized conserved protein [Funct 82.06
PF1066860 Phage_terminase: Phage terminase small subunit; In 82.0
COG1729262 Uncharacterized protein conserved in bacteria [Fun 81.89
KOG0553304 consensus TPR repeat-containing protein [General f 81.75
PRK10411 240 DNA-binding transcriptional activator FucR; Provis 81.57
PRK11014141 transcriptional repressor NsrR; Provisional 81.56
PRK04841903 transcriptional regulator MalT; Provisional 81.38
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 81.14
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 80.93
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 80.82
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 80.78
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 80.71
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 80.44
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 80.4
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 80.34
COG1349 253 GlpR Transcriptional regulators of sugar metabolis 80.19
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 80.1
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-92  Score=649.84  Aligned_cols=384  Identities=60%  Similarity=1.011  Sum_probs=375.7

Q ss_pred             CCCCCCCCcchhHhHHhHhhcCCCCccchHHhHHHHHHHHHHhCCCHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHH
Q 016653            1 MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKL   80 (385)
Q Consensus         1 ~~~~~~~~p~l~l~~l~~~~~~~~~~~~~~~~~~~~~~~~ik~~~m~~~y~~~~~~~~~~~D~~~~~~~~~~~~~~l~~L   80 (385)
                      ++++++++||+.++++.|+++||..+. +.++++..+++.|+.++|+|||+.+|+...|..|.+.+++|.++|++++++|
T Consensus         9 ~~e~~~~~p~le~sq~~FlLt~p~~~~-~~~~~~e~l~~~Ird~~Map~Ye~lce~~~i~~D~~~l~~m~~~neeki~el   87 (393)
T KOG0687|consen    9 EEETLMRVPDLELSQLRFLLTHPEVLG-QKAAAREKLLAAIRDEDMAPLYEYLCESLVIKLDQDLLNSMKKANEEKIKEL   87 (393)
T ss_pred             cccccccCcchhHHHHHHHHcCccccC-cCHHHHHHHHHHHHhcccchHHHHHHhhcceeccHHHHHHHHHhhHHHHHHH
Confidence            467888999999999999999998876 5678888899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhCHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhhccchhHHHhHHHHHHHHHHhcCHHHHHhHHHHH
Q 016653           81 DDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKA  160 (385)
Q Consensus        81 e~~l~~~~~n~~~~~ir~a~~~la~~~~~~Gd~~~A~~~~~~~~~~~~~~~~~id~~l~~i~~~i~~~~~~~~~~~i~ka  160 (385)
                      ++++.++++|+|+.++|.|+.++|+||+++||.++|++++.+..++.++.|+++|+.+.+||++++++|...+.+.+.||
T Consensus        88 d~~iedaeenlGE~ev~ea~~~kaeYycqigDkena~~~~~~t~~ktvs~g~kiDVvf~~iRlglfy~D~~lV~~~ieka  167 (393)
T KOG0687|consen   88 DEKIEDAEENLGESEVREAMLRKAEYYCQIGDKENALEALRKTYEKTVSLGHKIDVVFYKIRLGLFYLDHDLVTESIEKA  167 (393)
T ss_pred             HHHHHHHHHhcchHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHhhcccchhhHHHHHHHHHhhccHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCChhhhhhhhHHHHHhccccCCHHHHHHHHHhccccCCcCccCCHhHHHHHHHHHHHhhCChhHHHhhccCCh
Q 016653          161 KSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAP  240 (385)
Q Consensus       161 ~~~~~~~~~~~~~~~l~~~~gl~~l~~r~~~~Aa~~f~e~~~t~~~~e~~~~~~~~~Y~~l~al~s~~R~~lk~~v~~~~  240 (385)
                      +.++++||||+|+||+|+|.|++.|+.|||++||.+|+|+++||+++|+++|.++++|+++|++++++|.+|+++|+++|
T Consensus       168 k~liE~GgDWeRrNRlKvY~Gly~msvR~Fk~Aa~Lfld~vsTFtS~El~~Y~~~v~Ytv~~g~i~leR~dlktKVi~~~  247 (393)
T KOG0687|consen  168 KSLIEEGGDWERRNRLKVYQGLYCMSVRNFKEAADLFLDSVSTFTSYELMSYETFVRYTVITGLIALERVDLKTKVIKCP  247 (393)
T ss_pred             HHHHHhCCChhhhhhHHHHHHHHHHHHHhHHHHHHHHHHHcccccceecccHHHHHHHHHHHhhheeccchHHhhhcCcH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCcchHHHHHHHHHhccHHHHHHHHHHh-HHHhhhchhHhHhHHHHHHHHHHHHHHHhccccccccHHHHHHHh
Q 016653          241 EILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGL-TEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAF  319 (385)
Q Consensus       241 e~~~~l~~~p~~~~li~~f~~~~y~~~~~~L~~~-~~~l~~D~~l~~h~~~l~~~iR~~~~~qy~~pY~~I~l~~mA~~f  319 (385)
                      |++.+++..|.++++++++|+|+|+.|+..|... .+.+..|.|+++|.++++++||.++|.|+++||++++|++||++|
T Consensus       248 Evl~vl~~l~~~~q~l~SLY~C~Y~~Ff~~L~~~~~~~lk~D~~l~~h~~yyvREMR~rvY~QlLESYrsl~l~~MA~aF  327 (393)
T KOG0687|consen  248 EVLEVLHKLPSVSQLLNSLYECDYSDFFNDLAAVEAKQLKDDRYLGPHYRYYVREMRRRVYAQLLESYRSLTLESMAKAF  327 (393)
T ss_pred             HHHHHhhcCchHHHHHHHHHhccHHHHHHHHHHHHHHhhccchhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            9999999999999999999999999999999666 888999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHHHHHHHhCCccceEEecCCCEEEEcCCCchhHHHHHHHHhhHHHHHHHHHhhhhhcC
Q 016653          320 GVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL  385 (385)
Q Consensus       320 g~s~~~iE~~L~~lI~~g~l~akID~~~giv~~~~~d~~~~~y~~~i~~g~~l~~r~q~l~~~~~~  385 (385)
                      |||+++++++|.+||.+|+|+||||++||+|++|+||.+|.+|+.+|++||.|+|||||++++|++
T Consensus       328 gVSVefiDreL~rFI~~grL~ckIDrVnGVVEtNrpD~KN~qyq~vikqGd~LLnriQK~~rvi~~  393 (393)
T KOG0687|consen  328 GVSVEFIDRELGRFIAAGRLHCKIDRVNGVVETNRPDEKNAQYQAVIKQGDLLLNRIQKLSRVINL  393 (393)
T ss_pred             CchHHHHHhHHHHhhccCceeeeeecccceeecCCccccchHHHHHHhhhHHHHHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999999999999999999999999975

>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09440 eIF3_N: eIF3 subunit 6 N terminal domain; InterPro: IPR019010 This entry represents the N-terminal domain of subunit 6 (or e) (eIF3e) of the translation initiation factor eIF3 Back     alignment and domain information
>KOG2753 consensus Uncharacterized conserved protein, contains PCI domain [General function prediction only] Back     alignment and domain information
>KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8 Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03399 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; InterPro: IPR005062 This large family includes diverse proteins involved in large complexes [, , ] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1861 consensus Leucine permease transcriptional regulator [Transcription] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG3677 consensus RNA polymerase I-associated factor - PAF67 [Translation, ribosomal structure and biogenesis; Transcription] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15431 ferrous iron transport protein FeoC; Provisional Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG1849 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4414 consensus COP9 signalosome, subunit CSN8 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query385
4b4t_R429 Near-Atomic Resolution Structural Model Of The Yeas 2e-69
>pdb|4B4T|R Chain R, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 429 Back     alignment and structure 
Iteration: 1

 Score =  259 bits (661), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 149/411 (36%), Positives = 234/411 (56%), Gaps = 51/411 (12%)
Query: 13  LAHKRFLLTHPDVQDIEKVGLKGE-VFSMVKAHDMASFYETLVAESV------------- 58
           ++ K FLLT   V  IE+     E V + +K  +MA +Y+ L  E +             
Sbjct: 26  VSEKAFLLTQSKVS-IEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEK 84
Query: 59  -------LEMDQSVLDSMRTKIEDELKKLDDRI-------------ADAEENLGESEVRE 98
                  ++ DQ + + +  K E ++K+L+++I             A A  NLGE     
Sbjct: 85  SDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGE----- 139
Query: 99  AHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSID 158
                  +Y QIGDK+ A + L  + SK ++ G K+D++    +LGFFY D   + + ++
Sbjct: 140 -------YYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLE 192
Query: 159 KAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFY 218
              S+ E+GGDWER+NR K Y G++C++ RNFK+AA L +DS++TFT+ EL  Y++   Y
Sbjct: 193 AVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATY 252
Query: 219 TVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYL---SEFLNSLYDCQYKSFFSAFAGLT 275
             +T + +L+R  LK KV+D+PE+L++I     L   S    SLY   Y S+F       
Sbjct: 253 ASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETY 312
Query: 276 EQIKLD-RYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFI 334
             + +  +YL  H  +++RE+R  VY+Q LESYK++++++MA AFGV+V F+D +L +FI
Sbjct: 313 ANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFI 372
Query: 335 AAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL 385
              +L+C ID+V G++ETNRPD KNA Y   +KQGD LL ++QK    + L
Sbjct: 373 PNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRL 423

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query385
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 6e-42
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 2e-04
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
 Score =  150 bits (380), Expect = 6e-42
 Identities = 49/322 (15%), Positives = 108/322 (33%), Gaps = 20/322 (6%)

Query: 73  IEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQ 132
              E++   D I  A++       +         Y       +AL        +     +
Sbjct: 75  TGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLREL----K 130

Query: 133 KMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGG--------DWERKNRLKVYEGLYC 184
           K+D     +++            ++ KA++                + +  L +  G+  
Sbjct: 131 KLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILH 190

Query: 185 M-STRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEIL 243
               R+FK A S F ++   F + +     T + Y +L  I+      + Q V     I 
Sbjct: 191 AADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAIT 250

Query: 244 TVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQF 303
                I  +     + +      F +A     +++  D  +  H       +      + 
Sbjct: 251 YSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRI 310

Query: 304 LESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQ 363
           +E Y  V +  +A++  + +  ++ +LS+ I   K    +D+  GVL        +  Y+
Sbjct: 311 IEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYE 370

Query: 364 ATIKQGDFLLNRIQKLSRVIDL 385
             ++        IQ + +V+D 
Sbjct: 371 RVLET-------IQSMGKVVDT 385
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Length = 84 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query385
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 100.0
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 100.0
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 100.0
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.97
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 99.86
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 99.61
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 99.61
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 99.57
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 99.31
3chm_A169 COP9 signalosome complex subunit 7; heat/ARM repea 98.49
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.21
4b0z_A229 RPN12, 26S proteasome regulatory subunit RPN12; pr 98.05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.94
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.94
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.85
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.64
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.54
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.42
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.41
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.39
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.38
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.36
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.35
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.35
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.33
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.32
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 97.31
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.3
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.27
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.27
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.26
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.26
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.18
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.16
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.16
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.14
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.1
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.09
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.01
3u4t_A272 TPR repeat-containing protein; structural genomics 96.93
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.91
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.9
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.84
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.83
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.82
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 96.78
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.75
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.73
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.69
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.69
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.62
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.62
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.55
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.53
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.5
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.48
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.46
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.44
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.39
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.37
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.35
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.32
4g1t_A 472 Interferon-induced protein with tetratricopeptide 96.31
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.24
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.2
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.17
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 96.17
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.11
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.01
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 96.0
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 95.99
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.92
4b4t_T274 26S proteasome regulatory subunit RPN12; hydrolase 95.92
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.9
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 95.89
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.84
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.81
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.72
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.66
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.66
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.63
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.62
3u4t_A272 TPR repeat-containing protein; structural genomics 95.62
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.54
1rz4_A226 Eukaryotic translation initiation factor 3 subuni; 95.52
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.51
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.5
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.46
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.39
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.39
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 95.36
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.31
4eqf_A365 PEX5-related protein; accessory protein, tetratric 95.2
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.18
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.15
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.01
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 94.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 94.94
3k9i_A117 BH0479 protein; putative protein binding protein, 94.86
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 94.83
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.82
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 94.8
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 94.78
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 94.77
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 94.75
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 94.72
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 94.7
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.69
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 94.64
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 94.63
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 94.62
2gw1_A 514 Mitochondrial precursor proteins import receptor; 94.6
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.54
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 94.51
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 94.44
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 94.35
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 94.29
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 94.25
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 94.24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 94.2
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 94.15
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 94.11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 93.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 93.79
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 93.76
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.75
3k9i_A117 BH0479 protein; putative protein binding protein, 93.69
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 93.68
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 93.37
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 93.11
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.08
2jt1_A77 PEFI protein; solution structure, winged helix-tur 93.02
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 92.97
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 92.91
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 92.86
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 92.76
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 92.75
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 92.7
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 92.67
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 92.58
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 92.58
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 92.44
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 92.39
2gw1_A514 Mitochondrial precursor proteins import receptor; 92.24
3qww_A433 SET and MYND domain-containing protein 2; methyltr 92.12
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 92.11
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 92.05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 92.02
3q49_B137 STIP1 homology and U box-containing protein 1; E3 92.01
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 91.98
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 91.75
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 91.62
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 91.47
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 91.28
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 91.23
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 91.17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 90.83
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 90.68
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 90.47
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 90.37
1qbj_A81 Protein (double-stranded RNA specific adenosine D 90.34
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 90.26
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 90.13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 90.1
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 89.91
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 89.9
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 89.35
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 89.31
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 89.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 88.95
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 88.91
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 88.9
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 88.19
3qww_A433 SET and MYND domain-containing protein 2; methyltr 88.01
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 87.92
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 87.49
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 87.47
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 87.21
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 86.84
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 86.78
1sfx_A109 Conserved hypothetical protein AF2008; structural 86.16
3by6_A126 Predicted transcriptional regulator; structural ge 85.64
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 85.56
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 85.51
3t5v_A316 Nuclear mRNA export protein SAC3; PCI, mRNA nuclea 85.06
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 84.42
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 84.41
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 84.22
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 83.99
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 83.78
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 83.27
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 82.49
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 82.42
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 82.32
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 82.19
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 81.82
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 81.68
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 81.6
2oqg_A114 Possible transcriptional regulator, ARSR family P; 81.58
1pc2_A152 Mitochondria fission protein; unknown function; NM 81.23
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 80.94
2oo2_A86 Hypothetical protein AF_1782; structural genomics, 80.75
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=4.4e-77  Score=598.31  Aligned_cols=384  Identities=38%  Similarity=0.677  Sum_probs=310.3

Q ss_pred             CCCCCCCcchhHhHHhHhhcCCCCccchHHhHHHHHHHHHHhCCCHHHHHHHHHhcCC--------------------CC
Q 016653            2 DSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVL--------------------EM   61 (385)
Q Consensus         2 ~~~~~~~p~l~l~~l~~~~~~~~~~~~~~~~~~~~~~~~ik~~~m~~~y~~~~~~~~~--------------------~~   61 (385)
                      |+.+.++|++.++++.|+++++.+++...+++.+.+++.|++++|+|||+.+|+++++                    |.
T Consensus        15 d~~~~k~P~~~la~~~f~l~~~~~~~~~~~~~~~~l~~~ik~~~ma~~y~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~   94 (429)
T 4b4t_R           15 DPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKF   94 (429)
T ss_dssp             ---------------------------CHHHHHHHHHHHHHHTCCHHHHHHHHHHSCCCCSCCSSCSHHHHHHHHHTTTT
T ss_pred             CcccccCCChHHHHHHHHhcCCCCChhhHHHHHHHHHHHHHHhCCHHHHHHHHHHHhhcccchhhhhhhhhhhhhhcchH
Confidence            6778899999999999999988776655566666799999999999999999998753                    68


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHH-hhCHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhhccchhHHHhHHHH
Q 016653           62 DQSVLDSMRTKIEDELKKLDDRIADAEE-NLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYT  140 (385)
Q Consensus        62 D~~~~~~~~~~~~~~l~~Le~~l~~~~~-n~~~~~ir~a~~~la~~~~~~Gd~~~A~~~~~~~~~~~~~~~~~id~~l~~  140 (385)
                      |++|++.++++|+.+++++++.++.+++ +.++.++|+++.+||+||+++||+++|.++|.+++++|++++++++++|++
T Consensus        95 d~~~~~~~~~~n~~~l~~l~~~~~~~~~~~~~e~e~~~~~~~la~~~~~~Gd~~~A~~~~~~~~~~~~~~~~kid~~l~~  174 (429)
T 4b4t_R           95 DQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTI  174 (429)
T ss_dssp             CCSSCTTTTCCSSCCHHHHHHHHHHHHHCCSCCCCCSSCCHHHHHHHHHHCCCTTHHHHHHHHHHHHTCCCSHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcCChHHHHHHHHHH
Confidence            9999999999999999999999999876 778888999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCHHHHHhHHHHHHHHHhcCCChhhhhhhhHHHHHhccccCCHHHHHHHHHhccccCCcCccCCHhHHHHHHH
Q 016653          141 LQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTV  220 (385)
Q Consensus       141 i~~~i~~~~~~~~~~~i~ka~~~~~~~~~~~~~~~l~~~~gl~~l~~r~~~~Aa~~f~e~~~t~~~~e~~~~~~~~~Y~~  220 (385)
                      +|++++.+||.++..+++|++..++++++|++++++++|.|+++++.|+|.+|+++|++++++|++.+.+++.++++|++
T Consensus       175 irl~l~~~d~~~~~~~~~ka~~~~~~~~d~~~~~~lk~~~gl~~l~~r~f~~Aa~~f~e~~~t~~~~e~~~~~~~~~y~~  254 (429)
T 4b4t_R          175 ARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYAS  254 (429)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHHTTCCCTHHHHHHHHHHHHGGGGTSCHHHHHHHHHHHHHHSCCSCHHHHHHHHHHHH
T ss_pred             HHHHHHhccHHHHHHHHHHHHHhhhcCCCHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHhccCCccchhhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhCChhHHHhhccCChHHHHHhcCcch---HHHHHHHHHhccHHHHHHHHH-HhHHHhhhchhHhHhHHHHHHHHH
Q 016653          221 LTSIISLDRVSLKQKVVDAPEILTVIGKIPY---LSEFLNSLYDCQYKSFFSAFA-GLTEQIKLDRYLYPHFRYYMREVR  296 (385)
Q Consensus       221 l~al~s~~R~~lk~~v~~~~e~~~~l~~~p~---~~~li~~f~~~~y~~~~~~L~-~~~~~l~~D~~l~~h~~~l~~~iR  296 (385)
                      ||++++++|++++.+|+++++++.+++..|.   +.+++.+|++++|..|++.+. .....+..|+|+++|++.|+++||
T Consensus       255 l~al~~~~r~~l~~~v~~~~~~~~~l~~~p~~~~~~~l~~~~~~~~~~~~~~~~l~~~~~~l~~d~~l~~h~~~l~~~ir  334 (429)
T 4b4t_R          255 VTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMR  334 (429)
T ss_dssp             HHHHHTTCHHHHHHSSSSSHHHHHGGGSHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHSTTTTTCTTSTTTHHHHHHHHH
T ss_pred             HHHHhcCCHHHHHHHHhcCHHHHhhccCChhHHHHHHHHHHHHhccHHHHHHHHHHHHHhhhccCHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999998886   466799999999999988754 456679999999999999999999


Q ss_pred             HHHHHHhccccccccHHHHHHHhCCChHHHHHHHHHHHhCCccceEEecCCCEEEEcCCCchhHHHHHHHHhhHHHHHHH
Q 016653          297 TVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRI  376 (385)
Q Consensus       297 ~~~~~qy~~pY~~I~l~~mA~~fg~s~~~iE~~L~~lI~~g~l~akID~~~giv~~~~~d~~~~~y~~~i~~g~~l~~r~  376 (385)
                      .+++.||++||++|+|++||+.||+|++++|++|++||.+|+|+||||+++|+|++++||+++++|++++++||.|+||+
T Consensus       335 ~~~l~q~~~~Ys~I~l~~mA~~l~~s~~~~E~~L~~lI~~g~l~akID~~~giv~~~~~d~~~~~y~~~i~~gd~Ll~ri  414 (429)
T 4b4t_R          335 RKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKL  414 (429)
T ss_dssp             HHHHHHHHHTCSEEEHHHHHHHHTSCHHHHHHHHHHHHHHTSSCEEEETTTTEEEECC----------------------
T ss_pred             HHHHHHHhHHhceeeHHHHHHHhCcCHHHHHHHHHHHHHcCCeEEEEcCCCCEEEECCCCchhHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhhhcC
Q 016653          377 QKLSRVIDL  385 (385)
Q Consensus       377 q~l~~~~~~  385 (385)
                      |||+++||+
T Consensus       415 qkl~~~i~l  423 (429)
T 4b4t_R          415 QKYGAAVRL  423 (429)
T ss_dssp             ---------
T ss_pred             HHHHHHHhh
Confidence            999999985
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_T 26S proteasome regulatory subunit RPN12; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1rz4_A Eukaryotic translation initiation factor 3 subuni; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} SCOP: a.4.5.53 a.118.1.18 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>3t5v_A Nuclear mRNA export protein SAC3; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2oo2_A Hypothetical protein AF_1782; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Archaeoglobus fulgidus dsm 4304} SCOP: a.8.11.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 385
d1ufma_84 a.4.5.47 (A:) COP9 signalosome complex subunit 4, 7e-13
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 61.3 bits (149), Expect = 7e-13
 Identities = 10/56 (17%), Positives = 25/56 (44%)

Query: 305 ESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNA 360
           + Y ++T E +     +     +   S+ I  G+++  ID++ G++     +A   
Sbjct: 26  KLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREASGP 81

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query385
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 99.53
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.38
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.49
d1wi9a_72 Hypothetical protein C20orf116 homolog {Mouse (Mus 97.08
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.5
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.48
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.37
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.13
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.08
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.9
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.83
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.78
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.42
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 95.41
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.33
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 95.29
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.25
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.24
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.16
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.12
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 93.83
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 93.83
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 93.32
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.05
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 92.83
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 92.47
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 92.42
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 92.15
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 92.14
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 91.59
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 91.4
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 91.2
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 91.17
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 90.9
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 90.8
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 89.6
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 89.53
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 89.4
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 88.96
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 88.71
d1hw1a174 Fatty acid responsive transcription factor FadR, N 88.34
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 88.27
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 87.22
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 87.16
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 86.92
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.47
d2oo2a175 Hypothetical protein AF1782 {Archaeoglobus fulgidu 85.72
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 85.56
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 85.12
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 85.08
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 84.9
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 84.44
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 84.01
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 82.06
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 82.02
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 80.38
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.53  E-value=5.4e-15  Score=111.44  Aligned_cols=67  Identities=18%  Similarity=0.278  Sum_probs=61.4

Q ss_pred             HHHHHHHHHHHHhccccccccHHHHHHHhCCChHHHHHHHHHHHhCCccceEEecCCCEEEEcCCCc
Q 016653          291 YMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDA  357 (385)
Q Consensus       291 l~~~iR~~~~~qy~~pY~~I~l~~mA~~fg~s~~~iE~~L~~lI~~g~l~akID~~~giv~~~~~d~  357 (385)
                      |.++++..++..+-++|++|+|++||+.||++++++|.+|++||.+|+|+|+||+++|+|++..++.
T Consensus        12 L~~~i~Ehni~~is~~Y~~Isl~~la~~l~l~~~evE~~l~~mI~~~~i~akIDq~~g~V~F~~~e~   78 (84)
T d1ufma_          12 LDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREA   78 (84)
T ss_dssp             CCHHHHHHHHHHHHHSCSEEEHHHHHHHTTSCHHHHHHHHHHHHHTTSSCEEEETTTTEEEECCSSC
T ss_pred             HHHHHHHHHHHHHHHhhceeeHHHHHHHHCCCHHHHHHHHHHHHhcCeEEEEEeCCCCEEEECCCCc
Confidence            4567777778888888999999999999999999999999999999999999999999999987654
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2oo2a1 a.8.11.1 (A:1-75) Hypothetical protein AF1782 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure