Citrus Sinensis ID: 016664

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-----
MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYEL
cccccccccccccccccccccccccccccccEEccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccEEEcccccccc
cccccccccccccccccccccEEEHcccccEEEEcccccHHHcccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHccEEEcccccEEEEcccEccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccEEEEEccccccc
mkkedapdkgrtlsvdpnvprwvcqncrhflcivgvdsyadkylndssrstmhgssihasnsvlgstrmdnsfvvlpkqrpqshgvpprprgssaqseasqsgkamdESFVVIYKsesasdgggphipppeggtngpmqpnnsgfhSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTnvlndafpiwhdgefgtinnfrlgrlpkipvewDEINAAWGQACLLLHTMCqyfrpkfpyrikiipmgsyprimdsnnntyel
mkkedapdkgrtlsvdpnvprwVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQrpqshgvpprprgssAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSqtqveqplCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIpmgsyprimdsnnntyel
MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRgssaqseasqsgKAMDESFVVIYKSESASDgggphipppeggTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLkeklkieeeerkleaaieeteKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYEL
*****************NVPRWVCQNCRHFLCIVGVDSYADKYL******************************************************************VVI********************************HSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVL**********************************************FKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPR***********
*******************PRWVCQNCRHFLCIVGVDSYADKY**************************************************************************************************************RAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEAC************************************************LK***L*********ERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNN*****
************LSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPK***************************MDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYEL
*************SVDPNVPRWVCQNCRHFLCIVGVDSYADKYLN***************************************************************SF****K*****************************FHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNN*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query385 2.2.26 [Sep-21-2011]
Q9M367 517 Beclin-1-like protein OS= yes no 1.0 0.744 0.770 1e-168
Q6GP52 445 Beclin-1 OS=Xenopus laevi N/A no 0.792 0.685 0.310 4e-41
Q54JI9 855 Beclin-1-like protein B O yes no 0.563 0.253 0.407 9e-41
Q4A1L3 445 Beclin-1 OS=Xenopus tropi yes no 0.802 0.694 0.314 1e-40
Q5ZKS6 447 Beclin-1 OS=Gallus gallus yes no 0.781 0.673 0.315 4e-39
O88597 448 Beclin-1 OS=Mus musculus yes no 0.828 0.712 0.314 6e-39
Q91XJ1 448 Beclin-1 OS=Rattus norveg yes no 0.779 0.669 0.316 7e-39
Q4A1L4 448 Beclin-1 OS=Bos taurus GN yes no 0.836 0.718 0.323 2e-38
Q14457 450 Beclin-1 OS=Homo sapiens yes no 0.784 0.671 0.311 2e-38
Q4A1L5 448 Beclin-1 OS=Sus scrofa GN yes no 0.823 0.707 0.315 3e-38
>sp|Q9M367|BECN1_ARATH Beclin-1-like protein OS=Arabidopsis thaliana GN=At3g61710 PE=2 SV=2 Back     alignment and function desciption
 Score =  592 bits (1527), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 298/387 (77%), Positives = 331/387 (85%), Gaps = 2/387 (0%)

Query: 1   MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHAS 60
           M+KE+ PDK RT+ +DPN+P+WVCQNC H L IVGVDSYA K+ ND   S   GSSIH +
Sbjct: 1   MRKEEIPDKSRTIPIDPNLPKWVCQNCHHSLTIVGVDSYAGKFFNDPPPSATQGSSIHGA 60

Query: 61  NSVLGSTRMDNSFVVLPKQRP-QSHGVPPRPRG-SSAQSEASQSGKAMDESFVVIYKSES 118
           NSVLGSTRMDNSFVVLP+ +P QS G+PPRPRG SS Q +A+QSGKAM+ESFVV+YKSE 
Sbjct: 61  NSVLGSTRMDNSFVVLPRHKPPQSQGIPPRPRGASSPQPDATQSGKAMEESFVVVYKSEP 120

Query: 119 ASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLS 178
            SD GG H    E G NGP+  N SGF++TI VL RAF+IA +QTQVEQPLCLECMRVLS
Sbjct: 121 VSDSGGSHNLSLEVGQNGPLHSNTSGFNATINVLTRAFDIARTQTQVEQPLCLECMRVLS 180

Query: 179 DKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEK 238
           DKL+KEV+DVTRD+EAYEAC+QRLEGE +DVLSEADFLKEK KIEEEERKL AAIEETEK
Sbjct: 181 DKLEKEVEDVTRDVEAYEACVQRLEGETQDVLSEADFLKEKKKIEEEERKLVAAIEETEK 240

Query: 239 QNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLEL 298
           QNAEVN +LKELE K  RF ELE+RYWQEFNNFQFQLIAHQEERDAI +KIEVSQAHLEL
Sbjct: 241 QNAEVNHQLKELEFKGNRFNELEDRYWQEFNNFQFQLIAHQEERDAILAKIEVSQAHLEL 300

Query: 299 LKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRP 358
           L +TNVL DAFPI +DGEFGTINNFRLGRLP I VEWDEINAAWGQACLLLHTMC YFRP
Sbjct: 301 LNKTNVLIDAFPIRNDGEFGTINNFRLGRLPAIKVEWDEINAAWGQACLLLHTMCNYFRP 360

Query: 359 KFPYRIKIIPMGSYPRIMDSNNNTYEL 385
           KF  ++KI PMGSYPRI+DSNN TYEL
Sbjct: 361 KFQCQVKIQPMGSYPRIVDSNNETYEL 387

Arabidopsis thaliana (taxid: 3702)
>sp|Q6GP52|BECN1_XENLA Beclin-1 OS=Xenopus laevis GN=becn1 PE=2 SV=1 Back     alignment and function description
>sp|Q54JI9|BECNB_DICDI Beclin-1-like protein B OS=Dictyostelium discoideum GN=atg6B PE=3 SV=1 Back     alignment and function description
>sp|Q4A1L3|BECN1_XENTR Beclin-1 OS=Xenopus tropicalis GN=becn1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKS6|BECN1_CHICK Beclin-1 OS=Gallus gallus GN=BECN1 PE=2 SV=1 Back     alignment and function description
>sp|O88597|BECN1_MOUSE Beclin-1 OS=Mus musculus GN=Becn1 PE=1 SV=3 Back     alignment and function description
>sp|Q91XJ1|BECN1_RAT Beclin-1 OS=Rattus norvegicus GN=Becn1 PE=1 SV=1 Back     alignment and function description
>sp|Q4A1L4|BECN1_BOVIN Beclin-1 OS=Bos taurus GN=BECN1 PE=2 SV=1 Back     alignment and function description
>sp|Q14457|BECN1_HUMAN Beclin-1 OS=Homo sapiens GN=BECN1 PE=1 SV=2 Back     alignment and function description
>sp|Q4A1L5|BECN1_PIG Beclin-1 OS=Sus scrofa GN=BECN1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query385
73587480 505 beclin 1 protein [Malus x domestica] 0.971 0.740 0.812 0.0
225454518 522 PREDICTED: beclin 1 protein [Vitis vinif 0.992 0.731 0.820 0.0
73587486479 beclin 1 protein [Vitis vinifera] 0.992 0.797 0.820 0.0
224067974 516 predicted protein [Populus trichocarpa] 1.0 0.746 0.821 0.0
73587476 511 beclin 1 protein [Gossypium raimondii] 1.0 0.753 0.836 1e-180
255564727 523 Beclin-1, putative [Ricinus communis] gi 1.0 0.736 0.833 1e-179
351724517 509 beclin 1 protein [Glycine max] gi|735874 0.989 0.748 0.787 1e-171
357456733 517 Beclin 1 protein [Medicago truncatula] g 0.987 0.735 0.803 1e-171
357456731 567 Beclin 1 protein [Medicago truncatula] g 0.987 0.670 0.694 1e-170
73587484 522 beclin 1 protein [Solanum tuberosum] 0.984 0.726 0.781 1e-169
>gi|73587480|emb|CAJ27522.1| beclin 1 protein [Malus x domestica] Back     alignment and taxonomy information
 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/378 (81%), Positives = 342/378 (90%), Gaps = 4/378 (1%)

Query: 8   DKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGST 67
           ++GR+ +VDPNVPR+VCQNCR+ LC+VG DSYA+K+ +D SRS M GSS+H + SVL S 
Sbjct: 3   ERGRSFTVDPNVPRYVCQNCRNSLCVVGADSYAEKFFHDFSRSGMQGSSMHGATSVLSSM 62

Query: 68  RMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHI 127
           RMDNSFVVLP+QR Q  GVPPRPRG +  +    SG AMDESFVV+ KSES++DGGG H+
Sbjct: 63  RMDNSFVVLPQQRAQ--GVPPRPRGGAVNT--GHSGNAMDESFVVVNKSESSADGGGAHL 118

Query: 128 PPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDD 187
           P P+GG NGP+QPNNSGFHSTI++LKRAFEIA++QTQVEQPLC+ECMRVLSDKLDKEV+D
Sbjct: 119 PSPDGGPNGPLQPNNSGFHSTISLLKRAFEIASTQTQVEQPLCVECMRVLSDKLDKEVED 178

Query: 188 VTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAEL 247
           V RDI+AYEACL+RLEGE R+VLSE DFLKEKLKIEEE+RKLEA IEE EKQNAEVN EL
Sbjct: 179 VNRDIKAYEACLKRLEGETREVLSETDFLKEKLKIEEEQRKLEAEIEEMEKQNAEVNNEL 238

Query: 248 KELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND 307
           K LELKS RFKELEE+YW +FNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND
Sbjct: 239 KGLELKSSRFKELEEQYWHKFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND 298

Query: 308 AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKII 367
           AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKF YRIKI+
Sbjct: 299 AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFQYRIKIL 358

Query: 368 PMGSYPRIMDSNNNTYEL 385
           PMGSYPRIMD+NNNTYEL
Sbjct: 359 PMGSYPRIMDNNNNTYEL 376

Source: Malus x domestica

Species: Malus x domestica

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225454518|ref|XP_002277370.1| PREDICTED: beclin 1 protein [Vitis vinifera] gi|297745431|emb|CBI40511.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|73587486|emb|CAJ27525.1| beclin 1 protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|224067974|ref|XP_002302626.1| predicted protein [Populus trichocarpa] gi|222844352|gb|EEE81899.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|73587476|emb|CAJ27520.1| beclin 1 protein [Gossypium raimondii] Back     alignment and taxonomy information
>gi|255564727|ref|XP_002523358.1| Beclin-1, putative [Ricinus communis] gi|223537446|gb|EEF39074.1| Beclin-1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351724517|ref|NP_001238340.1| beclin 1 protein [Glycine max] gi|73587474|emb|CAJ27519.1| beclin 1 protein [Glycine max] Back     alignment and taxonomy information
>gi|357456733|ref|XP_003598647.1| Beclin 1 protein [Medicago truncatula] gi|355487695|gb|AES68898.1| Beclin 1 protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357456731|ref|XP_003598646.1| Beclin 1 protein [Medicago truncatula] gi|355487694|gb|AES68897.1| Beclin 1 protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|73587484|emb|CAJ27524.1| beclin 1 protein [Solanum tuberosum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query385
TAIR|locus:2076715 517 ATG6 "AT3G61710" [Arabidopsis 1.0 0.744 0.687 2.1e-141
MGI|MGI:1891828 448 Becn1 "beclin 1, autophagy rel 0.587 0.504 0.354 2.4e-37
UNIPROTKB|Q14457 450 BECN1 "Beclin-1" [Homo sapiens 0.587 0.502 0.350 3.9e-37
UNIPROTKB|Q4A1L4 448 BECN1 "Beclin-1" [Bos taurus ( 0.587 0.504 0.350 4.9e-37
UNIPROTKB|E2RNW7 463 AARSD1 "Uncharacterized protei 0.587 0.488 0.350 4.9e-37
UNIPROTKB|Q4A1L5 448 BECN1 "Beclin-1" [Sus scrofa ( 0.587 0.504 0.350 4.9e-37
UNIPROTKB|Q5R878 450 BECN1 "Beclin-1" [Pongo abelii 0.587 0.502 0.350 4.9e-37
UNIPROTKB|F1S1F6 448 BECN1 "Beclin-1" [Sus scrofa ( 0.587 0.504 0.350 1.3e-36
RGD|620190 448 Becn1 "beclin 1, autophagy rel 0.587 0.504 0.350 1.7e-36
UNIPROTKB|E1C9A1 449 BECN1 "Beclin-1" [Gallus gallu 0.602 0.516 0.345 2.7e-36
TAIR|locus:2076715 ATG6 "AT3G61710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1383 (491.9 bits), Expect = 2.1e-141, P = 2.1e-141
 Identities = 266/387 (68%), Positives = 297/387 (76%)

Query:     1 MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHAS 60
             M+KE+ PDK RT+ +DPN+P+WVCQNC H L IVGVDSYA K+ ND   S   GSSIH +
Sbjct:     1 MRKEEIPDKSRTIPIDPNLPKWVCQNCHHSLTIVGVDSYAGKFFNDPPPSATQGSSIHGA 60

Query:    61 NSVLGSTRMDNSFVVLPKQRP-QSHGVPPRPRXXXXXX-XXXXXXKAMDESFVVIYKSES 118
             NSVLGSTRMDNSFVVLP+ +P QS G+PPRPR             KAM+ESFVV+YKSE 
Sbjct:    61 NSVLGSTRMDNSFVVLPRHKPPQSQGIPPRPRGASSPQPDATQSGKAMEESFVVVYKSEP 120

Query:   119 ASDXXXXXXXXXXXXTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLS 178
              SD             NGP+  N SGF++TI VL RAF+IA +QTQVEQPLCLECMRVLS
Sbjct:   121 VSDSGGSHNLSLEVGQNGPLHSNTSGFNATINVLTRAFDIARTQTQVEQPLCLECMRVLS 180

Query:   179 DKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLXXXXXXXXXXXXXXXXXXXXXK 238
             DKL+KEV+DVTRD+EAYEAC+QRLEGE +DVLSEADFL                     K
Sbjct:   181 DKLEKEVEDVTRDVEAYEACVQRLEGETQDVLSEADFLKEKKKIEEEERKLVAAIEETEK 240

Query:   239 QNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLEL 298
             QNAEVN +LKELE K  RF ELE+RYWQEFNNFQFQLIAHQEERDAI +KIEVSQAHLEL
Sbjct:   241 QNAEVNHQLKELEFKGNRFNELEDRYWQEFNNFQFQLIAHQEERDAILAKIEVSQAHLEL 300

Query:   299 LKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRP 358
             L +TNVL DAFPI +DGEFGTINNFRLGRLP I VEWDEINAAWGQACLLLHTMC YFRP
Sbjct:   301 LNKTNVLIDAFPIRNDGEFGTINNFRLGRLPAIKVEWDEINAAWGQACLLLHTMCNYFRP 360

Query:   359 KFPYRIKIIPMGSYPRIMDSNNNTYEL 385
             KF  ++KI PMGSYPRI+DSNN TYEL
Sbjct:   361 KFQCQVKIQPMGSYPRIVDSNNETYEL 387
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0006914 "autophagy" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0000045 "autophagic vacuole assembly" evidence=IGI
GO:0000407 "pre-autophagosomal structure" evidence=IDA
GO:0006623 "protein targeting to vacuole" evidence=IGI
GO:0009846 "pollen germination" evidence=IMP
GO:0050832 "defense response to fungus" evidence=IEP
MGI|MGI:1891828 Becn1 "beclin 1, autophagy related" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q14457 BECN1 "Beclin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4A1L4 BECN1 "Beclin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNW7 AARSD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q4A1L5 BECN1 "Beclin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R878 BECN1 "Beclin-1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1F6 BECN1 "Beclin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|620190 Becn1 "beclin 1, autophagy related" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9A1 BECN1 "Beclin-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M367BECN1_ARATHNo assigned EC number0.77001.00.7446yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query385
pfam04111 356 pfam04111, APG6, Autophagy protein Apg6 4e-56
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 1e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-05
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 3e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 0.001
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 0.003
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.004
pfam12325121 pfam12325, TMF_TATA_bd, TATA element modulatory fa 0.004
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 0.004
>gnl|CDD|217902 pfam04111, APG6, Autophagy protein Apg6 Back     alignment and domain information 
 Score =  187 bits (476), Expect = 4e-56
 Identities = 76/227 (33%), Positives = 131/227 (57%), Gaps = 1/227 (0%)

Query: 149 ITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARD 208
           +  +   F+I +SQT ++ PLC EC  +L ++LD E+ D  ++ + Y+  L +LE +  +
Sbjct: 2   VKAMTNLFDILSSQTNIDHPLCEECADILLERLDSELRDAEKERDTYKQYLSKLESQNVE 61

Query: 209 VLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEF 268
           + +      E  ++++EE +L   +EE EK++ +++ EL EL+ + ++ +  E +Y +E+
Sbjct: 62  ISNYEALDSELDELKKEEERLLDELEELEKEDDDLDGELVELQEEKEQLENEELQYLREY 121

Query: 269 NNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRL 328
           N F    +  ++   ++  + E S   L+ L++TN+ N  F I H G F TIN  RLGRL
Sbjct: 122 NLFDRNNLQLEDNLQSLELQYEYSLNQLDKLRKTNIFNATFHISHSGPFATINGLRLGRL 181

Query: 329 PKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRI 375
           P + V W EINAAWGQ  LLL  + +     F  R +++P GS+  I
Sbjct: 182 PSVVVPWKEINAAWGQTVLLLAALAKKLGLNFV-RYRLVPFGSHSYI 227

In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway. Length = 356
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|192987 pfam12325, TMF_TATA_bd, TATA element modulatory factor 1 TATA binding Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 385
KOG2751447 consensus Beclin-like protein [Signal transduction 100.0
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 100.0
PF10186302 Atg14: UV radiation resistance protein and autopha 99.28
KOG2751 447 consensus Beclin-like protein [Signal transduction 99.01
KOG2896377 consensus UV radiation resistance associated prote 98.27
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 96.95
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 96.83
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 96.81
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 96.55
PRK03918 880 chromosome segregation protein; Provisional 96.23
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 96.16
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 96.02
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 95.99
PHA02562562 46 endonuclease subunit; Provisional 95.87
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 95.77
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.68
PRK11637 428 AmiB activator; Provisional 95.65
PRK11637428 AmiB activator; Provisional 95.41
KOG0979 1072 consensus Structural maintenance of chromosome pro 95.41
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 95.38
KOG0996 1293 consensus Structural maintenance of chromosome pro 95.22
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 95.14
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 94.8
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 94.78
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 94.75
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 94.74
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 94.72
PRK09039343 hypothetical protein; Validated 94.68
PHA02562 562 46 endonuclease subunit; Provisional 94.58
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 94.5
COG4942 420 Membrane-bound metallopeptidase [Cell division and 94.47
PF13851201 GAS: Growth-arrest specific micro-tubule binding 94.4
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 94.4
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.27
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 94.25
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 94.24
PRK02224 880 chromosome segregation protein; Provisional 94.21
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 94.21
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.2
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 94.06
PRK02224 880 chromosome segregation protein; Provisional 94.02
PRK04863 1486 mukB cell division protein MukB; Provisional 94.02
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 93.8
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 93.71
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 93.66
COG4026290 Uncharacterized protein containing TOPRIM domain, 93.66
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 93.62
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 93.53
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 93.52
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 93.41
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 93.2
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 93.19
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 93.15
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 93.15
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 93.09
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.08
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 93.03
PRK04778569 septation ring formation regulator EzrA; Provision 93.0
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 92.96
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 92.92
PRK10884206 SH3 domain-containing protein; Provisional 92.87
PRK10884206 SH3 domain-containing protein; Provisional 92.74
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 92.72
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 92.58
PRK04863 1486 mukB cell division protein MukB; Provisional 92.47
COG4985289 ABC-type phosphate transport system, auxiliary com 92.39
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 92.3
KOG0971 1243 consensus Microtubule-associated protein dynactin 92.21
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 92.21
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 92.12
COG2433652 Uncharacterized conserved protein [Function unknow 92.07
PRK04778569 septation ring formation regulator EzrA; Provision 91.92
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 91.91
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 91.87
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 91.85
PF00038312 Filament: Intermediate filament protein; InterPro: 91.69
PF13851201 GAS: Growth-arrest specific micro-tubule binding 91.55
KOG0964 1200 consensus Structural maintenance of chromosome pro 91.54
COG2433652 Uncharacterized conserved protein [Function unknow 91.42
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 91.4
PRK01156 895 chromosome segregation protein; Provisional 91.22
PRK01156 895 chromosome segregation protein; Provisional 91.19
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 91.1
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 90.85
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 90.84
TIGR006061311 rad50 rad50. This family is based on the phylogeno 90.81
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 90.75
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 90.71
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 90.65
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 90.64
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 90.43
PF06120301 Phage_HK97_TLTM: Tail length tape measure protein; 90.41
KOG4673 961 consensus Transcription factor TMF, TATA element m 90.4
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 90.19
PF1528525 BH3: Beclin-1 BH3 domain, Bcl-2-interacting; PDB: 90.12
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 90.03
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 89.9
PRK09039343 hypothetical protein; Validated 89.87
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 89.84
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 89.58
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 89.53
PF00038312 Filament: Intermediate filament protein; InterPro: 89.43
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 89.39
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 89.12
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 88.96
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 88.81
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 88.63
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 88.59
COG5185 622 HEC1 Protein involved in chromosome segregation, i 88.54
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 88.45
KOG0964 1200 consensus Structural maintenance of chromosome pro 88.41
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 88.35
COG4942 420 Membrane-bound metallopeptidase [Cell division and 88.33
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 88.31
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 88.28
KOG0933 1174 consensus Structural maintenance of chromosome pro 88.22
TIGR02231 525 conserved hypothetical protein. This family consis 88.15
PRK11519 719 tyrosine kinase; Provisional 88.07
KOG1962216 consensus B-cell receptor-associated protein and r 87.98
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 87.92
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 87.85
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 87.74
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 87.73
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 87.36
PRK00409 782 recombination and DNA strand exchange inhibitor pr 87.22
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 87.12
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 86.92
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 86.86
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 86.64
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 86.49
KOG0288 459 consensus WD40 repeat protein TipD [General functi 86.39
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 85.97
PRK08032462 fliD flagellar capping protein; Reviewed 85.92
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 85.91
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 85.84
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 85.7
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 85.69
PRK13169110 DNA replication intiation control protein YabA; Re 85.66
PF14662193 CCDC155: Coiled-coil region of CCDC155 85.47
KOG4438 446 consensus Centromere-associated protein NUF2 [Cell 85.43
KOG3647338 consensus Predicted coiled-coil protein [General f 85.41
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 85.41
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 85.35
KOG2072 988 consensus Translation initiation factor 3, subunit 85.13
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 84.96
TIGR02231 525 conserved hypothetical protein. This family consis 84.73
PF10186302 Atg14: UV radiation resistance protein and autopha 84.66
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 84.56
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 84.45
PRK06798440 fliD flagellar capping protein; Validated 84.44
PF15066527 CAGE1: Cancer-associated gene protein 1 family 84.41
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 84.31
PF05278269 PEARLI-4: Arabidopsis phospholipase-like protein ( 84.15
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 84.05
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 84.04
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 83.84
KOG0996 1293 consensus Structural maintenance of chromosome pro 83.8
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 83.51
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 83.25
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 83.11
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 83.09
PRK11519 719 tyrosine kinase; Provisional 83.03
PRK00409 782 recombination and DNA strand exchange inhibitor pr 82.94
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 82.87
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 82.82
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 82.73
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 82.65
PLN031881320 kinesin-12 family protein; Provisional 82.37
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 82.34
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 82.31
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 82.16
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 82.08
KOG4673 961 consensus Transcription factor TMF, TATA element m 81.97
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 81.87
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 81.8
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 81.56
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 81.45
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 81.3
KOG0979 1072 consensus Structural maintenance of chromosome pro 81.05
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 80.9
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 80.86
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 80.8
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 80.64
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 80.51
COG1345483 FliD Flagellar capping protein [Cell motility and 80.44
PF05701522 WEMBL: Weak chloroplast movement under blue light; 80.33
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2e-81  Score=627.73  Aligned_cols=343  Identities=53%  Similarity=0.839  Sum_probs=317.3

Q ss_pred             EeecccccccccccccCcCCCCCcccccccccccCCCCCceeeccCCCC-CCCCCCCCCCCCCCCcccccCCCCcccceE
Q 016664           33 IVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRP-QSHGVPPRPRGSSAQSEASQSGKAMDESFV  111 (385)
Q Consensus        33 i~g~d~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~d~s~vvl~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~eSfV  111 (385)
                      +||+|+|+++++..|..+.-.+.++|+..++.+..+|+.+++|+|.+.+ ++.+.|++++++.. +++. ++.++.++||
T Consensus         1 ~~g~~~s~~~~~q~~~~~~r~~~~i~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~t~~~~a~~-~~~~-~~~~~~~~~~   78 (447)
T KOG2751|consen    1 IVGVDSSANKFFQVPFPCQRCLQPIHLDNSLLGSDRMDISELVLPLHKPPQSQGGPTRPRGASS-GDAT-SGKTPQESSV   78 (447)
T ss_pred             CcccccccccccCCChhhhhccchhhhhhhhccccccchhhccCCCCCCccccCCCccCccccC-cccc-CCcchhhccc
Confidence            5899999999999998888889999999999999999999999999965 99999999999887 5555 8899999999


Q ss_pred             EEecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccchHHHHHHHHHhhcCCCCcCCcchHHHHHHHHHHHHHHHHHHHHH
Q 016664          112 VIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRD  191 (385)
Q Consensus       112 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lss~i~~l~~lFdIlSs~s~IDhPLC~eC~d~Lle~Ld~qle~~~~E  191 (385)
                      +.+...+..+....+-+....+..++...+.+++++++++++++|+|||++++||||+|.||+|.|++.|+++++.+++|
T Consensus        79 ~~~~~~p~r~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~f~i~~~qt~~d~PlC~eC~d~l~~~ld~e~~~~~~e  158 (447)
T KOG2751|consen   79 VVYFSPPVRDSDTEHNLSFELGENGSDGSNTKTLSATINVLTRLFDILSSQTQVDHPLCEECMDVLLNKLDKEVEDAEDE  158 (447)
T ss_pred             eecccCcccccccccccccccccccchhhhhHHHHHHHHHHHHHHHHhhccCCcccchHHHHHHHHHHHHHHHHHHHHHH
Confidence            99877666655555544444444445567789999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhchhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 016664          192 IEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNF  271 (385)
Q Consensus       192 ~d~Y~~fL~~L~~~~~~~~~~e~l~~e~~~Le~EE~~L~~eLeelEke~~~l~~el~~le~e~~~l~~eE~~~w~e~n~~  271 (385)
                      +++|++|+++|+++..+. +++++.+|+++++.||++|.++|++++++.++++.++.+++.+..++.++|.+||++||.+
T Consensus       159 ~~~Y~~~l~~Le~~~~~~-~~~~~~~e~~~l~~eE~~L~q~lk~le~~~~~l~~~l~e~~~~~~~~~e~~~~~~~ey~~~  237 (447)
T KOG2751|consen  159 VDTYKACLQRLEQQNQDV-SEEDLLKELKNLKEEEERLLQQLEELEKEEAELDHQLKELEFKAERLNEEEDQYWREYNNF  237 (447)
T ss_pred             HHHHHHHHHHHhhcCccc-chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999765543 7889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCCceeeeecCCeeeeccccCCCCCCCCcchhhHHHHHHHHHHHHHH
Q 016664          272 QFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHT  351 (385)
Q Consensus       272 q~ql~~~~ee~~sl~~q~~~~~~qLdkL~ktNV~nd~F~I~hdG~fGTINglRLGrlp~~~V~W~EINAAwGQ~~LLL~t  351 (385)
                      ++++.+++++++||++++++++.||++|++|||||.+|||||+|+|||||||||||+|.+||+|+||||||||++|||++
T Consensus       238 ~~q~~~~~del~Sle~q~~~s~~qldkL~ktNv~n~~F~I~~~G~fgtIN~FRLG~lp~~pVew~EINAA~GQ~vLLL~~  317 (447)
T KOG2751|consen  238 QRQLIEHQDELDSLEAQIEYSQAQLDKLRKTNVFNATFHIWHDGEFGTINNFRLGRLPSVPVEWDEINAAWGQTVLLLHT  317 (447)
T ss_pred             HHhhhcccchHHHHHHHHHHHHHHHHHHHhhhhhhheeeEeecccccccccceeccccCCCcCHHHHHHHhhhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCCc-cceeeeecCCcceeeccCC
Q 016664          352 MCQYFRPKFP-YRIKIIPMGSYPRIMDSNN  380 (385)
Q Consensus       352 la~kl~l~F~-YrykLvPmGS~SkI~~~~~  380 (385)
                      |++|+|++|+ ||  ||||||||+|++.-.
T Consensus       318 l~~kig~~~~~y~--lvp~GshSyI~~~~~  345 (447)
T KOG2751|consen  318 LANKIGLNFVRYR--LVPMGSHSYIKKRMV  345 (447)
T ss_pred             HHHhcCcccceee--eecccchhHHHHhcc
Confidence            9999999998 66  999999999998644

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2896 consensus UV radiation resistance associated protein [General function prediction only] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG4985 ABC-type phosphate transport system, auxiliary component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF15285 BH3: Beclin-1 BH3 domain, Bcl-2-interacting; PDB: 3BL2_C 2P1L_H 3DVU_C 2PON_A Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PRK08032 fliD flagellar capping protein; Reviewed Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3647 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK06798 fliD flagellar capping protein; Validated Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1345 FliD Flagellar capping protein [Cell motility and secretion] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query385
4ddp_A 210 Crystal Structure Of Beclin 1 Evolutionarily Conser 2e-25
3vp7_A 220 Crystal Structure Of The Beta-Alpha Repeated, Autop 4e-11
>pdb|4DDP|A Chain A, Crystal Structure Of Beclin 1 Evolutionarily Conserved Domain(Ecd) Length = 210 Back     alignment and structure 
Iteration: 1

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 71/106 (66%), Gaps = 1/106 (0%)
Query: 280 EERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEIN 339
           +E  ++ +++  +Q  L+ LK+TNV N  F IWH G+FGTINNFRLGRLP +PVEW+EIN
Sbjct: 5   DELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEIN 64
Query: 340 AAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYEL 385
           AAWGQ  LLLH +      KF  R +++P G++  +    + + EL
Sbjct: 65  AAWGQTVLLLHALANKMGLKFQ-RYRLVPYGNHSYLESLTDKSKEL 109
>pdb|3VP7|A Chain A, Crystal Structure Of The Beta-Alpha Repeated, Autophagy-Specific (Bara) Domain Of Vps30ATG6 Length = 220 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query385
4ddp_A 210 Beclin-1; ECD, autophagy, membrane binding, membra 4e-48
3vp7_A 220 Vacuolar protein sorting-associated protein 30; ta 1e-38
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 4e-21
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 5e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 5e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>4ddp_A Beclin-1; ECD, autophagy, membrane binding, membrane protein; 1.55A {Homo sapiens} Length = 210 Back     alignment and structure
 Score =  161 bits (409), Expect = 4e-48
 Identities = 50/110 (45%), Positives = 72/110 (65%), Gaps = 1/110 (0%)

Query: 276 IAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEW 335
           +   +E  ++ +++  +Q  L+ LK+TNV N  F IWH G+FGTINNFRLGRLP +PVEW
Sbjct: 1   LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW 60

Query: 336 DEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYEL 385
           +EINAAWGQ  LLLH +      KF  R +++P G++  +    + + EL
Sbjct: 61  NEINAAWGQTVLLLHALANKMGLKFQ-RYRLVPYGNHSYLESLTDKSKEL 109
>3vp7_A Vacuolar protein sorting-associated protein 30; targeting, PI3-kinase complex I, PRE-autophagosomal structur protein transport; 2.30A {Saccharomyces cerevisiae} Length = 220 Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Length = 96 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query385
4ddp_A210 Beclin-1; ECD, autophagy, membrane binding, membra 100.0
3vp7_A 220 Vacuolar protein sorting-associated protein 30; ta 100.0
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 99.77
2p1l_B31 Beclin 1; apoptosis, autophagy, BH3 domain, BCL; 2 98.37
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 96.73
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.38
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 96.19
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 96.16
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 95.77
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.52
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.46
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.1
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.09
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 94.92
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 94.57
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 91.74
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 91.58
2v4h_A110 NF-kappa-B essential modulator; transcription, met 91.41
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 91.37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 90.95
3bas_A89 Myosin heavy chain, striated muscle/general contro 90.32
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 89.66
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 89.64
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 89.24
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 87.67
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 87.48
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 87.09
3bas_A89 Myosin heavy chain, striated muscle/general contro 86.67
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 86.25
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 85.93
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 85.83
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 85.55
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 85.22
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 85.14
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 84.15
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 83.92
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 83.77
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 80.98
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 80.94
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 80.93
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 80.81
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 80.16
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 80.11
>4ddp_A Beclin-1; ECD, autophagy, membrane binding, membrane protein; 1.55A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.3e-49  Score=366.11  Aligned_cols=109  Identities=45%  Similarity=0.885  Sum_probs=93.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhccccCCCceeeeecCCeeeeccccCCCCCCCCcchhhHHHHHHHHHHHHHHHHhh
Q 016664          276 IAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQY  355 (385)
Q Consensus       276 ~~~~ee~~sl~~q~~~~~~qLdkL~ktNV~nd~F~I~hdG~fGTINglRLGrlp~~~V~W~EINAAwGQ~~LLL~tla~k  355 (385)
                      +++++|++|+++||++++.|||+|+||||||++|||||||+|||||||||||+|++||+|+||||||||+||||++||++
T Consensus         1 ~~~~~e~~sl~~q~~~~~~~L~~L~~tNv~n~~F~I~hdG~fgtINglRLGrlp~~~V~W~EINAAwGq~~LLL~tla~~   80 (210)
T 4ddp_A            1 LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANK   80 (210)
T ss_dssp             -------CCHHHHHHHHHHHHHTC----CCSSCCCEEEETTEEEETTEECCCBTTBCCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHhcccccceeEEEecCCceeEcccccCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            36789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCccceeeeecCCcceeeccCC--CcccC
Q 016664          356 FRPKFPYRIKIIPMGSYPRIMDSNN--NTYEL  385 (385)
Q Consensus       356 l~l~F~YrykLvPmGS~SkI~~~~~--~tyel  385 (385)
                      ++++|+ +|+||||||||+|++..+  .+|+|
T Consensus        81 l~~~f~-~y~L~P~GS~S~I~~~~~~~~~l~L  111 (210)
T 4ddp_A           81 MGLKFQ-RYRLVPYGNHSYLESLTDKSKELPL  111 (210)
T ss_dssp             HTCCCS-SEEEECCGGGCEEEESSCTTCCEES
T ss_pred             cCCCcc-ceeEEecCCcceeeEecCCCeEEec
Confidence            999998 555999999999999754  47776
>3vp7_A Vacuolar protein sorting-associated protein 30; targeting, PI3-kinase complex I, PRE-autophagosomal structur protein transport; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2p1l_B Beclin 1; apoptosis, autophagy, BH3 domain, BCL; 2.50A {Homo sapiens} PDB: 3dvu_C 2pon_A Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00