Citrus Sinensis ID: 016708

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----
MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMGIDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKLRSHSFQLGLIPPPSASSSSVPPPASASAQFIVNKTSANNWTGIGGDLESPTSTVTFSENNNNNNSAPPMMMSMIEFVGSSGSSDHQASLIKEEGENNNLQKDWNKLGLENSLSFTSSTLHHHDMAISMEAAAEGPWNPDESFRVNNSTMEEGFTNLLLNDSIGDRPSLSDSGKDSENSGGGDGGDSGSDYYQDNKNYWNSILNLVNSSPSTSPMF
ccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccc
ccccccccccccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHcccccccccccccccccccccccccccHHHHccccHHHHHHHHHHccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccc
mgrspccdkvglkkgpwtpeeDQKLLAYIEEHghgswralpakaglqrcgkscrlrwtnylrpdikrgkfslQEEQTIIQLHALLGNRWSAIathlpkrtdnEIKNYWNTHLKKRLAkmgidpvthkpkndallssdgqnknsanLSHMAQWESARLEAEARLVRESKLrshsfqlglipppsassssvpppasasaQFIVNKtsannwtgiggdlesptstvtfsennnnnnsappmMMSMIEFvgssgssdhqASLIKeegennnlqKDWNklglenslsftsstlhhhdMAISMeaaaegpwnpdesfrvnnstmEEGFTNLLlndsigdrpslsdsgkdsensgggdggdsgsdyyqdNKNYWNSILNLvnsspstspmf
mgrspccdkvglkkgpwtpeEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIAThlpkrtdneiKNYWNTHLKKRLAKMGIDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKLRSHSFQLGLIPPPSASSSSVPPPASASAQFIVNKTSANNWTGIGGDLESPTSTVTFSENNNNNNSAPPMMMSMIEFVGSSGSSDHQASLIKEEGENNNLQKDWNKLGLENSLSFTSSTLHHHDMAISMEAAAEGPWNPDESFRVNNSTMEEGFTNLLLNDSIGDRPSLSDSGKDSENSGGGDGGDSGSDYYQDNKNYWNSILNlvnsspstspmf
MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMGIDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKLRSHSFQLGLIpppsassssvpppasasaQFIVNKTSANNWTGIGGDLESPTSTVTFSEnnnnnnSAPPMMMSMIEFVGSSGSSDHQASLIKEEGENNNLQKDWNKLGLENslsftsstlhhhDMAISMEAAAEGPWNPDESFRVNNSTMEEGFTNLLLNDSIGDRPSLsdsgkdsensgggdggdsgsdYYQDNKNYWNSILNLVNSSPSTSPMF
**********************QKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMGI***************************************************************************************WT********************************************************************************************************************************************************NKNYWNSILNLV**********
*GRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLA*****************************************************************************************************************************************************************************HDMAISMEAAA*G*WNPDESFRVNNSTMEEGFTNLLLND****************************DYYQDNKNYWNSILNLVNSS*******
MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMGIDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKLRSHSFQLGLIPP**************SAQFIVNKTSANNWTGIGGDLESPTSTVTFSENNNNNNSAPPMMMSMIEFV**********SLIKEEGENNNLQKDWNKLGLENSLSFTSSTLHHHDMAISMEAAAEGPWNPDESFRVNNSTMEEGFTNLLLNDSIGDR******************GDSGSDYYQDNKNYWNSILNLVN*********
****PCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMGIDPVTHKPKNDA************************************L*S*SFQLG**************************************************************************************************************LHHHDMAISM**AAEGPWNPDESFRVNNSTMEEGFTNLLLN*****************************DYYQDNKNYWNSILNLVNS********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMGIDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKLRSHSFQLGLIPPPSASSSSVPPPASASAQFIVNKTSANNWTGIGGDLESPTSTVTFSENNNNNNSAPPMMMSMIEFVGSSGSSDHQASLIKEEGENNNLQKDWNKLGLENSLSFTSSTLHHHDMAISMEAAAEGPWNPDESFRVNNSTMEEGFTNLLLNDSIGDRPSLSDSGKDSENSGGGDGGDSGSDYYQDNKNYWNSILNLVNSSPSTSPMF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query384 2.2.26 [Sep-21-2011]
Q8GWP0360 Transcription factor MYB3 no no 0.346 0.369 0.731 4e-57
Q9SPG2366 Transcription factor MYB2 no no 0.492 0.516 0.528 4e-57
Q9FLR1336 Transcription factor MYB2 no no 0.333 0.380 0.742 3e-56
Q9SPG5338 Transcription factor MYB7 no no 0.333 0.378 0.726 8e-55
O49608274 Transcription factor MYB3 no no 0.471 0.660 0.515 9e-54
Q50EX6294 Protein ODORANT1 OS=Petun N/A no 0.351 0.459 0.691 2e-53
Q7XBH4257 Myb-related protein Myb4 no no 0.302 0.451 0.784 8e-53
Q8LPH6352 Transcription factor MYB8 no no 0.333 0.363 0.703 9e-52
P80073421 Myb-related protein Pp2 O N/A no 0.348 0.318 0.686 1e-51
P81392316 Myb-related protein 306 O N/A no 0.309 0.376 0.722 2e-51
>sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 Back     alignment and function desciption
 Score =  222 bits (566), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 115/134 (85%), Gaps = 1/134 (0%)

Query: 1   MGRSPCCDK-VGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTN 59
           MGRSPCCD+  G+KKGPW PEED KL AYI E+G+G+WR+LP  AGL RCGKSCRLRW N
Sbjct: 1   MGRSPCCDQDKGVKKGPWLPEEDDKLTAYINENGYGNWRSLPKLAGLNRCGKSCRLRWMN 60

Query: 60  YLRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKM 119
           YLRPDI+RGKFS  EE TI++LHALLGN+WS IA HLP RTDNEIKNYWNTH++K+L +M
Sbjct: 61  YLRPDIRRGKFSDGEESTIVRLHALLGNKWSKIAGHLPGRTDNEIKNYWNTHMRKKLLQM 120

Query: 120 GIDPVTHKPKNDAL 133
           GIDPVTH+P+ + L
Sbjct: 121 GIDPVTHEPRTNDL 134

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SPG2|MYB28_ARATH Transcription factor MYB28 OS=Arabidopsis thaliana GN=MYB28 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLR1|MYB29_ARATH Transcription factor MYB29 OS=Arabidopsis thaliana GN=MYB29 PE=1 SV=1 Back     alignment and function description
>sp|Q9SPG5|MYB76_ARATH Transcription factor MYB76 OS=Arabidopsis thaliana GN=MYB76 PE=1 SV=1 Back     alignment and function description
>sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 Back     alignment and function description
>sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description
>sp|Q8LPH6|MYB86_ARATH Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1 Back     alignment and function description
>sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 Back     alignment and function description
>sp|P81392|MYB06_ANTMA Myb-related protein 306 OS=Antirrhinum majus GN=MYB306 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query384
224141017401 predicted protein [Populus trichocarpa] 0.921 0.882 0.668 1e-135
356572826410 PREDICTED: uncharacterized protein LOC10 0.934 0.875 0.625 1e-128
225452873393 PREDICTED: uncharacterized protein LOC10 0.942 0.921 0.624 1e-127
449447381371 PREDICTED: myb-related protein 306-like 0.929 0.962 0.643 1e-123
346425853378 MIXTA-like transcription factor [Lotus j 0.934 0.949 0.632 1e-118
356568684378 PREDICTED: uncharacterized protein LOC10 0.927 0.941 0.618 1e-117
20563421 protein 1 [Petunia x hybrida] 0.940 0.857 0.581 1e-116
224925916405 MYB transcription factor ML2 [Thalictrum 0.955 0.906 0.591 1e-115
356529916390 PREDICTED: uncharacterized protein LOC10 0.919 0.905 0.600 1e-114
357496483357 MYB transcription factor [Medicago trunc 0.867 0.932 0.600 1e-110
>gi|224141017|ref|XP_002323871.1| predicted protein [Populus trichocarpa] gi|222866873|gb|EEF04004.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 288/431 (66%), Positives = 312/431 (72%), Gaps = 77/431 (17%)

Query: 1   MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY 60
           MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY
Sbjct: 1   MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY 60

Query: 61  LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG 120
           LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG
Sbjct: 61  LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG 120

Query: 121 IDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKLRSHSFQLGLIP 180
           IDPVTHK KNDALLS DGQ+KN+ANLSHMAQWESARLEAEARLVRESKLRS S Q  L  
Sbjct: 121 IDPVTHKSKNDALLSIDGQSKNAANLSHMAQWESARLEAEARLVRESKLRSQSIQHQL-- 178

Query: 181 PPSASSSSVP-------------------PPASASAQFIVN----KTSANNW----TGIG 213
                SS+ P                   PP S  A    N    K+S  N      GIG
Sbjct: 179 -----SSTTPGYFPGSGSSPGSTSSTLAQPPRSLDALKAWNDGWSKSSEGNGGGLNMGIG 233

Query: 214 GDLESPTSTVTFSENNNNNNSAPPMM---------MSMIEFVGSSGSSDHQASLIKEEGE 264
             LESPTST+TFSEN      APP+M         +SMIEFVG+SGS+  +  +IKEEGE
Sbjct: 234 DVLESPTSTLTFSEN------APPVMNSGAVGENSISMIEFVGTSGST--ETGIIKEEGE 285

Query: 265 NNNLQKDWNKLG-----LENSLSFTSSTLHHHDMAISMEAAAEGPWNPD------ESFRV 313
           +     DW  L       +NS+S TS+    HDM ISMEA    PWNPD      ++  V
Sbjct: 286 H-----DWKSLSNSSHLPDNSVSLTSTL---HDMTISMEA----PWNPDSLRANCDNVHV 333

Query: 314 NNSTMEEGFTNLLLNDSIGDRPSLSDSGKDSENSGGGDGGDSGSDYYQDNKNYWNSILNL 373
             + MEEGFT+LLL+DS     SLSD GKDS++S GG G  SGS+YY+DNKNYWNSILNL
Sbjct: 334 GKNVMEEGFTHLLLSDSA--ERSLSDDGKDSDHS-GGSGSGSGSNYYEDNKNYWNSILNL 390

Query: 374 VNSSPSTSPMF 384
           VNSSPS SPMF
Sbjct: 391 VNSSPSNSPMF 401

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356572826|ref|XP_003554566.1| PREDICTED: uncharacterized protein LOC100101835 [Glycine max] Back     alignment and taxonomy information
>gi|225452873|ref|XP_002283843.1| PREDICTED: uncharacterized protein LOC100245564 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449447381|ref|XP_004141447.1| PREDICTED: myb-related protein 306-like [Cucumis sativus] gi|449527973|ref|XP_004170982.1| PREDICTED: myb-related protein 306-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|346425853|gb|AEO27487.1| MIXTA-like transcription factor [Lotus japonicus] Back     alignment and taxonomy information
>gi|356568684|ref|XP_003552540.1| PREDICTED: uncharacterized protein LOC100794047 [Glycine max] Back     alignment and taxonomy information
>gi|20563|emb|CAA78386.1| protein 1 [Petunia x hybrida] Back     alignment and taxonomy information
>gi|224925916|gb|ACN69972.1| MYB transcription factor ML2 [Thalictrum thalictroides] Back     alignment and taxonomy information
>gi|356529916|ref|XP_003533532.1| PREDICTED: uncharacterized protein LOC100781637 [Glycine max] Back     alignment and taxonomy information
>gi|357496483|ref|XP_003618530.1| MYB transcription factor [Medicago truncatula] gi|355493545|gb|AES74748.1| MYB transcription factor [Medicago truncatula] gi|388514371|gb|AFK45247.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query384
TAIR|locus:2102152388 MYB106 "myb domain protein 106 0.643 0.636 0.669 8.7e-98
TAIR|locus:2150891326 MYB16 "myb domain protein 16" 0.601 0.708 0.707 8.8e-96
TAIR|locus:2098906299 MYB17 "myb domain protein 17" 0.460 0.591 0.687 4.2e-67
TAIR|locus:2141231350 MYB102 "MYB-like 102" [Arabido 0.442 0.485 0.621 6.9e-61
TAIR|locus:2075387321 MYB107 "myb domain protein 107 0.445 0.532 0.645 2.4e-60
TAIR|locus:2023951365 MYB93 "myb domain protein 93" 0.416 0.438 0.699 3.1e-60
TAIR|locus:2115708324 MYB74 "myb domain protein 74" 0.385 0.456 0.724 9.3e-59
TAIR|locus:2149000336 MYB9 "myb domain protein 9" [A 0.424 0.485 0.662 5.1e-58
TAIR|locus:2171845310 MYB53 "myb domain protein 53" 0.440 0.545 0.617 1.2e-56
TAIR|locus:2132957282 MYB41 "myb domain protein 41" 0.416 0.567 0.666 2e-56
TAIR|locus:2102152 MYB106 "myb domain protein 106" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 860 (307.8 bits), Expect = 8.7e-98, Sum P(2) = 8.7e-98
 Identities = 184/275 (66%), Positives = 196/275 (71%)

Query:     4 SPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRP 63
             SPCCDK GLKKGPWTPEEDQKLLAYIEEHGHGSWR+LP KAGLQRCGKSCRLRWTNYLRP
Sbjct:    47 SPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNYLRP 106

Query:    64 DIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMGIDP 123
             DIKRGKF++QEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRL KMGIDP
Sbjct:   107 DIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLIKMGIDP 166

Query:   124 VTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKLRSHSFQLGLIXXXX 183
             VTHK KN+ L SS GQ+KN+A LSHMAQWESARLEAEARL RESKL         +    
Sbjct:   167 VTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKL---------LHLQH 217

Query:   184 XXXXXXXXXXXXXXQFIVNKTSANNWT--GIG-GD--LESPTSTVTFSEXXXXXXSAPP- 237
                           Q    + ++ NWT    G GD  LESPTSTVTFSE        P  
Sbjct:   218 YQNNNNLNKSAAPQQHCFTQKTSTNWTKPNQGNGDQQLESPTSTVTFSENLLMPLGIPTD 277

Query:   238 ----------MMMSMIEF-VGSSGSSDHQASLIKE 261
                          +MIE  V SS SSD   SL+KE
Sbjct:   278 SSRNRNNNNNESSAMIELAVSSSTSSD--VSLVKE 310
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0010091 "trichome branching" evidence=IMP
GO:0010093 "specification of floral organ identity" evidence=RCA
GO:0048440 "carpel development" evidence=RCA
GO:0048507 "meristem development" evidence=RCA
TAIR|locus:2150891 MYB16 "myb domain protein 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141231 MYB102 "MYB-like 102" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2023951 MYB93 "myb domain protein 93" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115708 MYB74 "myb domain protein 74" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149000 MYB9 "myb domain protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171845 MYB53 "myb domain protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132957 MYB41 "myb domain protein 41" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query384
PLN03091459 PLN03091, PLN03091, hypothetical protein; Provisio 2e-64
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 2e-56
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 2e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-15
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-14
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 7e-12
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 4e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-11
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-05
COG5147512 COG5147, REB1, Myb superfamily proteins, including 0.001
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 0.001
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  212 bits (540), Expect = 2e-64
 Identities = 103/225 (45%), Positives = 138/225 (61%), Gaps = 7/225 (3%)

Query: 1   MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY 60
           MGR  CC K  L+KG W+PEED+KLL +I ++GHG W ++P +AGLQRCGKSCRLRW NY
Sbjct: 1   MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINY 60

Query: 61  LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG 120
           LRPD+KRG FS QEE  II+LHA+LGNRWS IA  LP RTDNEIKN WN+ LKK+L + G
Sbjct: 61  LRPDLKRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRG 120

Query: 121 IDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKLRSHSFQLGLIP 180
           IDP THKP ++     +G++KN       +   S+ +  E  L++    +  +       
Sbjct: 121 IDPNTHKPLSEV---ENGEDKNPPT-DDKSDKASSVVSNELNLLKADNSKPLAALQEKRS 176

Query: 181 PPSASSSSVPPPASASAQFIVNKTSANNWTGIGGDLESPTSTVTF 225
              + +       S+S+  I N  + N+      +L +PT    F
Sbjct: 177 SSISPAGYQLEVESSSSSKINNSNNNNHSN---SNLMTPTPNKDF 218

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 384
PLN03091459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.79
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.74
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.62
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.58
PLN03212249 Transcription repressor MYB5; Provisional 99.57
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.53
PLN03091 459 hypothetical protein; Provisional 99.5
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.46
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.38
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.33
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.31
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.24
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.11
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.98
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.9
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.74
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.6
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.34
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.57
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.47
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.3
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.26
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.17
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 96.86
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.65
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.58
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.56
KOG1279506 consensus Chromatin remodeling factor subunit and 96.52
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.49
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.13
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 95.96
PRK13923170 putative spore coat protein regulator protein YlbO 95.78
KOG1279506 consensus Chromatin remodeling factor subunit and 95.65
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.39
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.36
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.16
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 94.87
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.59
PLN031421033 Probable chromatin-remodeling complex ATPase chain 93.12
KOG1194534 consensus Predicted DNA-binding protein, contains 91.63
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 91.62
PRK13923170 putative spore coat protein regulator protein YlbO 91.53
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 90.96
KOG2656445 consensus DNA methyltransferase 1-associated prote 90.9
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 89.91
KOG4282345 consensus Transcription factor GT-2 and related pr 89.53
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 87.36
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-39  Score=326.50  Aligned_cols=169  Identities=54%  Similarity=0.967  Sum_probs=150.3

Q ss_pred             CCCCCccCCCCCccCCCCHHHHHHHHHHHHHhCCCCcccccccccCccCccccccccccccCCCCCCCCCCHHHHHHHHH
Q 016708            1 MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQ   80 (384)
Q Consensus         1 mgr~~c~~k~~lkKg~WT~EEDe~L~~~V~~yG~~~W~~Iaa~~~~~Rt~kqCr~Rw~n~L~p~ikrg~WT~EED~~Ll~   80 (384)
                      |||++||+|..+||++||+|||++|+++|++||.++|..||..++++|+++|||+||.+||+|.+++++||+|||++|++
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe   80 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE   80 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999998888889999999999999999999999999999999999


Q ss_pred             HHHHhCCChhhhhhcCCCCCHHHHHHHHHHHhHHHHhhcCCCCCCCCCCCcccccCCCCCccccccccccccchhhhhHH
Q 016708           81 LHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMGIDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAE  160 (384)
Q Consensus        81 lv~~~G~kW~~IA~~lpgRT~~qcKnRW~~~Lkk~l~k~~~~p~~~k~~~~~~~~~~~~~k~~~~ls~~aqwesar~e~e  160 (384)
                      ++++||++|.+||++|||||+++||+||+.+|++++++.++++.++++........+    .......++++.+++++.|
T Consensus        81 L~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~~~I~p~t~kpl~e~E~~~d----~~p~~~~~~~~~s~~~~~e  156 (459)
T PLN03091         81 LHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPNTHKPLSEVENGED----KNPPTDDKSDKASSVVSNE  156 (459)
T ss_pred             HHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCccccccccc----cCCccccccccchhhhhhh
Confidence            999999999999999999999999999999999999999999999998875432222    1234456677888888888


Q ss_pred             HHHHHHhhccccc
Q 016708          161 ARLVRESKLRSHS  173 (384)
Q Consensus       161 ~R~~re~k~~~~s  173 (384)
                      ..+..+--+...+
T Consensus       157 l~~~~~~~~~~~~  169 (459)
T PLN03091        157 LNLLKADNSKPLA  169 (459)
T ss_pred             hhhhhhhccCccc
Confidence            8877665544443

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query384
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 4e-23
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 3e-22
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 6e-22
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 6e-22
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 7e-22
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 8e-16
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 8e-12
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 5e-09
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 4e-08
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 6e-08
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 5e-07
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 1e-06
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 1e-06
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (262), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 73/105 (69%), Gaps = 1/105 (0%)
Query: 12  LKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFS 71
           L KGPWT EEDQK++  ++++G   W  L AK    R GK CR RW N+L P++K+  ++
Sbjct: 5   LVKGPWTKEEDQKVIELVKKYGTKQW-TLIAKHLKGRLGKQCRERWHNHLNPEVKKSSWT 63
Query: 72  LQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRL 116
            +E++ I + H +LGNRW+ IA  LP RTDN +KN+WN+ +K+++
Sbjct: 64  EEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKV 108
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query384
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-69
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 2e-69
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 9e-68
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 5e-61
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 4e-57
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 8e-35
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-53
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 7e-29
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-23
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-22
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-15
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 1e-04
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-11
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 4e-05
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 9e-10
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-06
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-08
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-08
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 7e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 6e-08
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 8e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 9e-08
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-07
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 3e-07
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 6e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 8e-07
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 7e-06
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 9e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 3e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  212 bits (543), Expect = 2e-69
 Identities = 45/105 (42%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 12  LKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFS 71
           L KGPWT EEDQ+++  ++++G   W  +       R GK CR RW N+L P++K+  ++
Sbjct: 2   LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60

Query: 72  LQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRL 116
            +E++ I Q H  LGNRW+ IA  LP RTDN IKN+WN+ +++++
Sbjct: 61  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 105
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query384
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.98
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.97
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.88
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.82
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.7
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.7
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.69
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.67
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.67
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.66
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.65
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.64
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.64
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.62
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.62
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.62
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.61
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.59
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.58
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.58
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.58
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.56
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.54
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.54
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.54
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.53
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.53
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.51
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.51
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.49
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.49
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.49
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.47
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.46
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.16
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.41
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.4
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.39
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.36
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.34
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.26
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.25
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.19
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.19
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.81
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.18
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.17
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.17
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.14
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.14
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.11
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.88
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.88
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.82
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.8
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.64
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.59
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.49
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.4
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.34
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.32
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.3
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.26
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.03
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.97
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.96
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.91
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.74
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.87
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.59
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.58
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.48
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.44
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.36
2crg_A70 Metastasis associated protein MTA3; transcription 97.32
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 96.94
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 96.83
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.82
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.59
2crg_A70 Metastasis associated protein MTA3; transcription 96.42
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.32
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.06
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.03
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.6
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 95.37
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.04
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 92.21
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 91.76
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 91.02
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 88.83
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=99.98  E-value=3.4e-33  Score=232.61  Aligned_cols=105  Identities=43%  Similarity=0.864  Sum_probs=98.1

Q ss_pred             CCccCCCCHHHHHHHHHHHHHhCCCCcccccccccCccCccccccccccccCCCCCCCCCCHHHHHHHHHHHHHhCCChh
Q 016708           11 GLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPDIKRGKFSLQEEQTIIQLHALLGNRWS   90 (384)
Q Consensus        11 ~lkKg~WT~EEDe~L~~~V~~yG~~~W~~Iaa~~~~~Rt~kqCr~Rw~n~L~p~ikrg~WT~EED~~Ll~lv~~~G~kW~   90 (384)
                      +++||+||+|||++|+++|++||.++|..||..+ ++|+++||++||.++|+|.+++++||+|||++|++++.+||++|.
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l-~~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~   79 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHL-KGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA   79 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTS-TTCCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhh-cCCCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence            4789999999999999999999988999996655 599999999999999999999999999999999999999999999


Q ss_pred             hhhhcCCCCCHHHHHHHHHHHhHHHH
Q 016708           91 AIATHLPKRTDNEIKNYWNTHLKKRL  116 (384)
Q Consensus        91 ~IA~~lpgRT~~qcKnRW~~~Lkk~l  116 (384)
                      .||++|||||+++|++||+.++++++
T Consensus        80 ~Ia~~l~gRt~~~~k~rw~~~~~~~~  105 (105)
T 1gv2_A           80 EIAKLLPGRTDNAIKNHWNSTMRRKV  105 (105)
T ss_dssp             HHHTTCTTCCHHHHHHHHHHHTC---
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhccC
Confidence            99999999999999999999998764
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 384
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-22
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-20
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-09
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 2e-17
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-16
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-16
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-06
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 7e-16
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 5e-12
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-14
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 6e-12
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-14
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-12
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 9e-13
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-08
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 7e-12
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-11
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-11
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 5e-07
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-09
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 6e-04
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 9e-04
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 85.9 bits (213), Expect = 4e-22
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 12 LKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPD 64
          L KGPWT EEDQ+L+  ++++G   W  + AK    R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVI-AKHLKGRIGKQCRERWHNHLNPE 52
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query384
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.7
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.68
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.61
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.56
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.52
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.52
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.52
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.46
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.41
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.4
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.37
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.37
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.34
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.29
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.28
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.21
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.2
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.18
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.15
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.13
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.06
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.04
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.01
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.73
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.66
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.6
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.91
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.9
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.57
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.46
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.03
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.93
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.95
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.82
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 94.55
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.16
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 90.93
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 90.56
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 89.99
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 85.72
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.70  E-value=1.6e-18  Score=125.94  Aligned_cols=52  Identities=44%  Similarity=0.916  Sum_probs=48.6

Q ss_pred             CccCCCCHHHHHHHHHHHHHhCCCCcccccccccCccCccccccccccccCCC
Q 016708           12 LKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYLRPD   64 (384)
Q Consensus        12 lkKg~WT~EEDe~L~~~V~~yG~~~W~~Iaa~~~~~Rt~kqCr~Rw~n~L~p~   64 (384)
                      |+||+||+|||++|+++|++||.++|..||+.|+ +|++.||++||.+||+|+
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCCHHHHHHHHHhhCCCC
Confidence            6899999999999999999999889999977665 999999999999999995
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure