Citrus Sinensis ID: 016750

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380---
MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRFTLRTEGKTVAVGKVTELPTVSSSA
ccEEcccHHHHHHcccEEEEEcEEEccccEEEEEEccccccccccccccccccccEEEEEEEccccccccccccccccHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccccccccccccHHHHHccccccccccccccEEccccccccccEEEEEEEEEEEEccccEEEEEccccEEEEEEEEEccccccccccccEEEEEEccccccccccccEEcccccccccccEEEEEEEEEEcccccccccccccEEEEEccEEEHHHHHHHHHHcccccccccccccccccccEEEEEEEEccEEEEEEcccccccccEEEEccccEEEEEEEEEEEcccccc
cHHHHHHHHHHHHHccccccccEEEEcccEEEEEEEccccccHHHHHHHccccccEEEEEEEccHHHHHHHcccccHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHcccccccccccEEEcEEEcccEEEEEcccccEEEEEEEHHcHHHHHcccccccccEEEEEEEHHEcccccccccccccHHHHHcccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHccccccHcccccEEccccEEEEEEccccccEEcccccccccccEEHHccHcEEEEEEEEEEEcccccc
mayimdtneeerikgktvevgrahfetettrftildapghksyvpnmisgasqADIGVLVISArkgefetgfekggqTREHVMLAKTLGVTKLLLVVNKmddhtvnwsKERYDEIEskmtpflkasgynvkkdvqflpisglmglnmktrvdkslcpwwngpclfealdrieitprdpngpfrmpiidkfkdmgtVVMGkvesgsvregdsllvmpnkAQVKVLAIYcddnrvrhagpgenlrirlsgieeedilSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIdlktkkpmkkkvlfvKNGAIVVCRIQvnnsicteKFADFAQLGRftlrtegktvavgkvtelptvsssa
mayimdtneeerikgktvevgrahfetettrftildapgHKSYVPNMISGASQADIGVLVISARKGEFEtgfekggqtrEHVMLAKTLGVTKLLLVvnkmddhtvnwskerydeiESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVEsgsvregdsllvmpnKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHqidlktkkpmkKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRftlrtegktvavgkvtelptvsssa
MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARkgefetgfekggQTREHVMlaktlgvtklllvvnkMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIDlktkkpmkkkvlfvkNGAIVVCRIQVNNSICTEKFADFAQLGRFTLRTEGKTVAVGKVTELPTVSSSA
*****************VEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRFTLRTEGKTVAVGKV**********
MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLH***************FVKNGAIVVCRIQVNNSICTEKFADFAQLGRFTLRTEGKTVAVGKVTE*PT*****
MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRFTLRTEGKTVAVGKVTE********
MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRFTLRTEGKTVAVGKVTELPTV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHAVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRFTLRTEGKTVAVGKVTELPTVSSSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query383 2.2.26 [Sep-21-2011]
Q9HGI8700 Eukaryotic peptide chain yes no 0.976 0.534 0.543 1e-123
Q8R050636 Eukaryotic peptide chain yes no 0.971 0.584 0.563 1e-120
Q8IYD1628 Eukaryotic peptide chain no no 0.971 0.592 0.558 1e-120
Q5R4B3628 Eukaryotic peptide chain yes no 0.971 0.592 0.558 1e-120
P15170499 Eukaryotic peptide chain no no 0.971 0.745 0.563 1e-120
Q149F3632 Eukaryotic peptide chain no no 0.971 0.588 0.555 1e-119
Q9HGI4662 Eukaryotic peptide chain yes no 0.976 0.564 0.527 1e-119
Q9HGI7712 Eukaryotic peptide chain N/A no 0.973 0.523 0.527 1e-117
P23637741 Eukaryotic peptide chain N/A no 0.973 0.503 0.525 1e-116
O13354715 Eukaryotic peptide chain N/A no 0.973 0.521 0.517 1e-116
>sp|Q9HGI8|ERF3_KLULA Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 Back     alignment and function desciption
 Score =  441 bits (1133), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 273/377 (72%), Gaps = 3/377 (0%)

Query: 1   MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLV 60
           ++++MDTN+EER  GKT+EVGRA+FETE  R+TILDAPGHK YV  MI GASQADIG+LV
Sbjct: 323 LSWVMDTNKEERNDGKTIEVGRAYFETEKRRYTILDAPGHKMYVSEMIGGASQADIGILV 382

Query: 61  ISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMT 120
           ISARKGE+ETGFEKGGQTREH +LAKT GV K+++V+NKMDD TV W KERYD     +T
Sbjct: 383 ISARKGEYETGFEKGGQTREHALLAKTQGVNKMIVVINKMDDPTVGWDKERYDHCVGNLT 442

Query: 121 PFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNG 180
            FLKA GYNVK+DV F+P+SG  G  +K RVD   CPW+ GP L E LD ++ T R  N 
Sbjct: 443 NFLKAVGYNVKEDVIFMPVSGYTGAGLKERVDPKDCPWYTGPSLLEYLDNMKTTDRHINA 502

Query: 181 PFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCD-DNRVRHAGPG 239
           PF +PI  K KDMGTVV GK+ESG +R+G+  L+MPN+  V++L IY + ++ V  A  G
Sbjct: 503 PFMLPIASKMKDMGTVVEGKIESGHIRKGNQTLLMPNRTSVEILTIYNETESEVDMAVCG 562

Query: 240 ENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIH 299
           E +R+R+ G+EEE+I +GFVL+S   PV  VT F+AQ+ I+EL   +I +AG+  V+HIH
Sbjct: 563 EQVRLRIKGVEEEEISAGFVLTSPKNPVKNVTRFVAQIAIVEL--KSIMSAGFSCVMHIH 620

Query: 300 AVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRF 359
             +EE  +  LLH+++  + +  KK   F K G  ++  I+ N  +C E + D+ QLGRF
Sbjct: 621 TAIEEVTVTRLLHKLEKGSNRKSKKPPAFAKKGMKIIAVIETNEPVCVETYDDYPQLGRF 680

Query: 360 TLRTEGKTVAVGKVTEL 376
           TLR +G T+A+GK+ ++
Sbjct: 681 TLRDQGTTIAIGKIVKI 697
Involved in translation termination. Stimulates the activity of ERF1. Binds guanine nucleotides.
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (taxid: 284590)
>sp|Q8R050|ERF3A_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=2 Back     alignment and function description
>sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2 Back     alignment and function description
>sp|Q5R4B3|ERF3B_PONAB Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Pongo abelii GN=GSPT2 PE=2 SV=1 Back     alignment and function description
>sp|P15170|ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens GN=GSPT1 PE=1 SV=1 Back     alignment and function description
>sp|Q149F3|ERF3B_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus GN=Gspt2 PE=1 SV=1 Back     alignment and function description
>sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 Back     alignment and function description
>sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 Back     alignment and function description
>sp|P23637|ERF3_OGAPI Eukaryotic peptide chain release factor GTP-binding subunit OS=Ogataea pini GN=SUP2 PE=3 SV=1 Back     alignment and function description
>sp|O13354|ERF3_CANAX Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query383
224127856 524 predicted protein [Populus trichocarpa] 0.994 0.727 0.871 0.0
224126561434 predicted protein [Populus trichocarpa] 0.981 0.866 0.877 0.0
449439439 513 PREDICTED: eukaryotic peptide chain rele 0.994 0.742 0.842 0.0
15220940 532 G1 to S phase transition protein [Arabid 1.0 0.719 0.843 0.0
1009234409 SUP2, partial [Nicotiana tabacum] 1.0 0.936 0.859 0.0
255583544 497 eukaryotic peptide chain release factor 0.997 0.768 0.871 0.0
297850202 533 hypothetical protein ARALYDRAFT_472022 [ 1.0 0.718 0.832 0.0
225456085 512 PREDICTED: eukaryotic peptide chain rele 0.994 0.744 0.863 0.0
334182663 543 G1 to S phase transition protein [Arabid 1.0 0.705 0.819 0.0
297734283 8416 unnamed protein product [Vitis vinifera] 0.994 0.045 0.863 0.0
>gi|224127856|ref|XP_002329194.1| predicted protein [Populus trichocarpa] gi|222870975|gb|EEF08106.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/381 (87%), Positives = 363/381 (95%)

Query: 1   MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLV 60
           MAYIMDTNEEER+KGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLV
Sbjct: 143 MAYIMDTNEEERVKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLV 202

Query: 61  ISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMT 120
           ISARKGEFETG+E+GGQTREHV LAKTLGV+KLL+VVNKMD+ TVNWSKERYDEIESKM 
Sbjct: 203 ISARKGEFETGYERGGQTREHVQLAKTLGVSKLLVVVNKMDEPTVNWSKERYDEIESKMI 262

Query: 121 PFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNG 180
           PFLK+SGYNVKKDVQFLPISGLMG NMKTR+DK++CPWWNGPCLFEALD IE+ PRDPNG
Sbjct: 263 PFLKSSGYNVKKDVQFLPISGLMGTNMKTRLDKAVCPWWNGPCLFEALDSIEVPPRDPNG 322

Query: 181 PFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGE 240
           P RMPIIDKFKDMGTVVMGKVESGSV EGD+LLVMPNK QVKVLA++CD+N+VR AGPGE
Sbjct: 323 PLRMPIIDKFKDMGTVVMGKVESGSVTEGDTLLVMPNKTQVKVLAVFCDENKVRRAGPGE 382

Query: 241 NLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHA 300
           N+R++LSGI++EDILSGFVLSSVA+P+ AVTEF AQLQILELLDNAIFTAGYKAVLH+H+
Sbjct: 383 NVRVKLSGIDDEDILSGFVLSSVARPIFAVTEFDAQLQILELLDNAIFTAGYKAVLHVHS 442

Query: 301 VVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRFT 360
           VVEECEIV+LL QID KT+KPMKKKVLFVKNGAIV+CRIQVNN IC EKF+DF QLGRFT
Sbjct: 443 VVEECEIVQLLQQIDPKTRKPMKKKVLFVKNGAIVLCRIQVNNLICVEKFSDFPQLGRFT 502

Query: 361 LRTEGKTVAVGKVTELPTVSS 381
           LRTEGKTVAVGKVTELP+ S+
Sbjct: 503 LRTEGKTVAVGKVTELPSGSN 523

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224126561|ref|XP_002319868.1| predicted protein [Populus trichocarpa] gi|222858244|gb|EEE95791.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449439439|ref|XP_004137493.1| PREDICTED: eukaryotic peptide chain release factor GTP-binding subunit ERF3A-like [Cucumis sativus] gi|449503117|ref|XP_004161842.1| PREDICTED: eukaryotic peptide chain release factor GTP-binding subunit ERF3A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15220940|ref|NP_173247.1| G1 to S phase transition protein [Arabidopsis thaliana] gi|79318119|ref|NP_001031063.1| G1 to S phase transition protein [Arabidopsis thaliana] gi|21539549|gb|AAM53327.1| putative guanine nucleotide regulatory protein [Arabidopsis thaliana] gi|31711944|gb|AAP68328.1| At1g18070 [Arabidopsis thaliana] gi|332191549|gb|AEE29670.1| G1 to S phase transition protein [Arabidopsis thaliana] gi|332191550|gb|AEE29671.1| G1 to S phase transition protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|1009234|gb|AAA79033.1| SUP2, partial [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|255583544|ref|XP_002532529.1| eukaryotic peptide chain release factor GTP-binding subunit, putative [Ricinus communis] gi|223527760|gb|EEF29863.1| eukaryotic peptide chain release factor GTP-binding subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297850202|ref|XP_002892982.1| hypothetical protein ARALYDRAFT_472022 [Arabidopsis lyrata subsp. lyrata] gi|297338824|gb|EFH69241.1| hypothetical protein ARALYDRAFT_472022 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225456085|ref|XP_002280982.1| PREDICTED: eukaryotic peptide chain release factor GTP-binding subunit ERF3B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|334182663|ref|NP_001185026.1| G1 to S phase transition protein [Arabidopsis thaliana] gi|9719722|gb|AAF97824.1|AC034107_7 Strong similarity to EF-1-alpha-related GTP-binding protein (SUP1) from Nicotiana tabacum gb|L38828 and is a member of the elongation factor Tu PF|00009 family. ESTs gb|W43190, gb|W43332, gb|AI995372, gb|AV563399, gb|AV549134, gb|AV554843, gb|AV527836 come from this gene [Arabidopsis thaliana] gi|332191551|gb|AEE29672.1| G1 to S phase transition protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297734283|emb|CBI15530.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query383
ZFIN|ZDB-GENE-040822-36564 gspt1 "G1 to S phase transitio 0.971 0.659 0.489 3.4e-93
SGD|S000002579685 SUP35 "Translation termination 0.976 0.545 0.466 1.5e-92
UNIPROTKB|E2R0S8522 GSPT1 "Uncharacterized protein 0.971 0.712 0.494 3e-92
UNIPROTKB|Q9N2G7588 Q9N2G7 "Eukaryotic polypeptide 0.971 0.632 0.494 3e-92
MGI|MGI:1316728636 Gspt1 "G1 to S phase transitio 0.971 0.584 0.494 3e-92
UNIPROTKB|Q6AYD5636 Gspt1 "G1 to S phase transitio 0.971 0.584 0.494 3.9e-92
UNIPROTKB|F6Q087605 GSPT1 "Uncharacterized protein 0.971 0.614 0.494 6.3e-92
UNIPROTKB|J3KQG6637 GSPT1 "Eukaryotic peptide chai 0.971 0.583 0.494 8.1e-92
UNIPROTKB|P15170499 GSPT1 "Eukaryotic peptide chai 0.971 0.745 0.494 8.1e-92
UNIPROTKB|E1BYG8627 GSPT1 "Uncharacterized protein 0.971 0.593 0.492 1.3e-91
ZFIN|ZDB-GENE-040822-36 gspt1 "G1 to S phase transition 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 928 (331.7 bits), Expect = 3.4e-93, P = 3.4e-93
 Identities = 184/376 (48%), Positives = 239/376 (63%)

Query:     1 MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLV 60
             +++ +DTN+EER KGKTVEVGRA+FETE   FTILDAPGHKS+VPNMI GASQAD+ VLV
Sbjct:   188 LSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLV 247

Query:    61 ISARXXXXXXXXXXXXQTREHVMXXXXXXXXXXXXXXXXMDDHTVNWSKERYDEIESKMT 120
             ISAR            QTREH M                MDD TVNWS +RY+E + K+ 
Sbjct:   248 ISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSLDRYEECKEKLV 307

Query:   121 PFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNG 180
             PFLK  G+N KKD+ F+P SGL G N+K   D  LCPW+ G      LD + I  R  +G
Sbjct:   308 PFLKKVGFNPKKDIHFMPCSGLTGANLKESSD--LCPWYTGLPFIPHLDSLPIFSRSSDG 365

Query:   181 PFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGE 240
             P R+PI+DK+KDMGTVV+GK+ESGS+ +   L++MPN+  V+VL++  DD    +AGPGE
Sbjct:   366 PLRLPIVDKYKDMGTVVLGKLESGSIAKAQQLIMMPNRHTVEVLSLLSDDVETEYAGPGE 425

Query:   241 NLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHA 300
             NL++RL GIEEE+IL GF+L +      +   F AQ+ I+E    +I   GY AVLHIH 
Sbjct:   426 NLKLRLKGIEEEEILPGFILCNAENLCHSGRTFDAQIVIIE--HKSIICPGYNAVLHIHT 483

Query:   301 VVEECEIVELLHQIDXXXXXXXXXXXXXXXNGAIVVCRIQVNNSICTEKFADFAQLGRFT 360
              +EE +I  L+  +D                  + + R++   +IC E F DF Q+GRFT
Sbjct:   484 CIEEVQISALICLVDKKTGEKSKTRPRFVKQDQVCIARLRAAGTICLETFKDFPQMGRFT 543

Query:   361 LRTEGKTVAVGKVTEL 376
             LR EGKT+A+GKV +L
Sbjct:   544 LRDEGKTIAIGKVLKL 559
GO:0005525 "GTP binding" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0000166 "nucleotide binding" evidence=IEA
SGD|S000002579 SUP35 "Translation termination factor eRF3" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0S8 GSPT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9N2G7 Q9N2G7 "Eukaryotic polypeptide chain release factor 3" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
MGI|MGI:1316728 Gspt1 "G1 to S phase transition 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AYD5 Gspt1 "G1 to S phase transition 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6Q087 GSPT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQG6 GSPT1 "Eukaryotic peptide chain release factor GTP-binding subunit ERF3A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P15170 GSPT1 "Eukaryotic peptide chain release factor GTP-binding subunit ERF3A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYG8 GSPT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A0RUM4EF1A_CENSYNo assigned EC number0.36070.96080.8440yesno
A1RRJ3EF1A_PYRILNo assigned EC number0.39680.96340.8310yesno
O93729EF1A_PYRAENo assigned EC number0.38090.96340.8310yesno
P35021EF1A_SULSONo assigned EC number0.37300.96860.8528yesno
A4YCR6EF1A_METS5No assigned EC number0.37660.96600.8505yesno
Q976B1EF1A_SULTONo assigned EC number0.38190.96600.8505yesno
A3MV69EF1A_PYRCJNo assigned EC number0.38880.96340.8310yesno
A3DMQ1EF1A_STAMFNo assigned EC number0.39940.96860.8470yesno
Q9YAV0EF1A_AERPENo assigned EC number0.37830.96860.8489yesno
A8MAJ1EF1A_CALMQNo assigned EC number0.40840.96080.8288yesno
Q979T1EF1A_THEVONo assigned EC number0.37030.95030.8584yesno
P17196EF1A_SULACNo assigned EC number0.37130.96600.8505yesno
A1RXW9EF1A_THEPDNo assigned EC number0.39780.96340.8521yesno
P19486EF1A_THEACNo assigned EC number0.36770.95030.8584yesno
A4WKK8EF1A_PYRARNo assigned EC number0.39680.96340.8310yesno
A2BN41EF1A_HYPBUNo assigned EC number0.38350.96600.8409yesno
Q6L202EF1A_PICTONo assigned EC number0.37200.94770.8561yesno
A8ABM5EF1A_IGNH4No assigned EC number0.36410.96600.8371yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.125.204.1
hypothetical protein (449 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0049009201
hypothetical protein (57 aa)
  •     0.472
eugene3.00090130
hypothetical protein (562 aa)
  •     0.448
estExt_fgenesh4_pg.C_660100
hypothetical protein (562 aa)
  •     0.446
estExt_Genewise1_v1.C_LG_IX0481
annotation not avaliable (383 aa)
  •     0.438
fgenesh4_pm.C_LG_XVII000007
hypothetical protein (159 aa)
  •     0.428
gw1.70.125.1
annotation not avaliable (139 aa)
  •     0.425
GTF902
global transcription factor group (201 aa)
  •     0.425
grail3.0058004501
hypothetical protein (159 aa)
  •     0.424
GTF901
global transcription factor group (202 aa)
  •     0.423
estExt_Genewise1_v1.C_LG_IV3101
hypothetical protein (421 aa)
  •     0.420

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query383
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 1e-136
cd01883219 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1 1e-104
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 1e-101
PTZ00141446 PTZ00141, PTZ00141, elongation factor 1- alpha; Pr 1e-95
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation fact 9e-89
PLN00043447 PLN00043, PLN00043, elongation factor 1-alpha; Pro 2e-72
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transfe 1e-60
cd03704108 cd03704, eRF3c_III, This family represents eEF1alp 5e-52
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, larg 2e-51
PRK05506 632 PRK05506, PRK05506, bifunctional sulfate adenylylt 5e-46
PRK05124474 PRK05124, cysN, sulfate adenylyltransferase subuni 5e-44
cd0408982 cd04089, eRF3_II, eRF3_II: domain II of the eukary 8e-44
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 1e-43
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 2e-40
cd0369883 cd03698, eRF3_II_like, eRF3_II_like: domain simila 1e-37
COG0050394 COG0050, TufB, GTPases - translation elongation fa 4e-34
COG3276447 COG3276, SelB, Selenocysteine-specific translation 4e-31
CHL00071409 CHL00071, tufA, elongation factor Tu 2e-29
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 3e-29
TIGR00475 581 TIGR00475, selB, selenocysteine-specific elongatio 1e-28
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisio 3e-28
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 3e-27
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisio 5e-27
cd00881183 cd00881, GTP_translation_factor, GTP translation f 2e-26
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 8e-26
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 6e-24
cd04093107 cd04093, HBS1_C, HBS1_C: this family represents th 1e-22
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 6e-19
pfam0314391 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-ter 3e-18
cd03705104 cd03705, EF1_alpha_III, Domain III of EF-1 3e-18
COG5258527 COG5258, GTPBP1, GTPase [General function predicti 3e-18
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 2e-17
TIGR03680406 TIGR03680, eif2g_arch, translation initiation fact 4e-17
cd01513102 cd01513, Translation_factor_III, Domain III of Elo 8e-17
COG5257415 COG5257, GCD11, Translation initiation factor 2, g 2e-15
PRK10512 614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific 3e-15
PRK04000411 PRK04000, PRK04000, translation initiation factor 9e-15
cd0369683 cd03696, selB_II, selB_II: this subfamily represen 5e-12
cd01888197 cd01888, eIF2_gamma, Gamma subunit of initiation f 2e-11
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 2e-10
cd0369391 cd03693, EF1_alpha_II, EF1_alpha_II: this family r 1e-09
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 1e-09
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 2e-09
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 3e-09
TIGR00487 587 TIGR00487, IF-2, translation initiation factor IF- 3e-09
cd04168237 cd04168, TetM_like, Tet(M)-like family includes Te 5e-08
TIGR01394 594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 2e-07
COG0532 509 COG0532, InfB, Translation initiation factor 2 (IF 2e-07
COG1217 603 COG1217, TypA, Predicted membrane GTPase involved 2e-06
PTZ00327460 PTZ00327, PTZ00327, eukaryotic translation initiat 3e-06
PRK12740 668 PRK12740, PRK12740, elongation factor G; Reviewed 4e-06
cd0369487 cd03694, GTPBP_II, Domain II of the GP-1 family of 1e-05
cd0369581 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamil 2e-05
COG0480 697 COG0480, FusA, Translation elongation factors (GTP 6e-05
cd0369787 cd03697, EFTU_II, EFTU_II: Elongation factor Tu do 1e-04
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) fam 2e-04
PRK10218 607 PRK10218, PRK10218, GTP-binding protein; Provision 5e-04
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 0.002
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 0.004
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  395 bits (1017), Expect = e-136
 Identities = 162/377 (42%), Positives = 233/377 (61%), Gaps = 9/377 (2%)

Query: 2   AYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVI 61
           A+++D  +EER +G T++V  + FET+   FTI+DAPGH+ +V NMI+GASQAD+ VLV+
Sbjct: 57  AWVLDKTKEERERGVTIDVAHSKFETDKYNFTIIDAPGHRDFVKNMITGASQADVAVLVV 116

Query: 62  SARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTP 121
            AR GEFE GF  GGQTREH  LA+TLG+ +L++ VNKMD   V+W +ER++EI S+++ 
Sbjct: 117 DARDGEFEAGFGVGGQTREHAFLARTLGIKQLIVAVNKMDL--VSWDEERFEEIVSEVSK 174

Query: 122 FLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNGP 181
            LK  GYN  KDV F+PISG  G N+  + +    PW+ GP L EALD++E   R  + P
Sbjct: 175 LLKMVGYN-PKDVPFIPISGFKGDNLTKKSEN--MPWYKGPTLLEALDQLEPPERPLDKP 231

Query: 182 FRMPIIDKF--KDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPG 239
            R+PI D +    +GTV +G+VESG ++ G  +  MP     +V +I      +  A PG
Sbjct: 232 LRLPIQDVYSISGIGTVPVGRVESGVIKPGQKVTFMPAGVVGEVKSIEMHHEEISQAEPG 291

Query: 240 ENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIH 299
           +N+   + G+E+ DI  G V+     P     EF AQ+ +L      I T+GY  VLH H
Sbjct: 292 DNVGFNVRGVEKNDIRRGDVIGHSDNPPTVSPEFTAQIIVLWH--PGIITSGYTPVLHAH 349

Query: 300 AVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRF 359
                C I ELL ++D +T K +++   F+K G   + +I+    +C EK ++  QLGRF
Sbjct: 350 TAQVACRIAELLSKLDPRTGKKLEENPQFLKRGDAAIVKIEPEKPLCLEKVSEIPQLGRF 409

Query: 360 TLRTEGKTVAVGKVTEL 376
            LR  G+T+A GKV E+
Sbjct: 410 ALRDMGQTIAAGKVLEV 426

Length = 428
>gnl|CDD|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional Back     alignment and domain information
>gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|239675 cd03704, eRF3c_III, This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|235349 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|239756 cd04089, eRF3_II, eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|239669 cd03698, eRF3_II_like, eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|239760 cd04093, HBS1_C, HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|217387 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-terminal domain Back     alignment and domain information
>gnl|CDD|239676 cd03705, EF1_alpha_III, Domain III of EF-1 Back     alignment and domain information
>gnl|CDD|227583 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|238771 cd01513, Translation_factor_III, Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|239667 cd03696, selB_II, selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma) Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|239664 cd03693, EF1_alpha_II, EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|239665 cd03694, GTPBP_II, Domain II of the GP-1 family of GTPase Back     alignment and domain information
>gnl|CDD|239666 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239668 cd03697, EFTU_II, EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>gnl|CDD|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 383
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 100.0
PLN00043447 elongation factor 1-alpha; Provisional 100.0
PTZ00141446 elongation factor 1- alpha; Provisional 100.0
KOG0459501 consensus Polypeptide release factor 3 [Translatio 100.0
KOG0458603 consensus Elongation factor 1 alpha [Translation, 100.0
PRK12317425 elongation factor 1-alpha; Reviewed 100.0
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 100.0
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 100.0
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 100.0
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 100.0
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 100.0
PLN03126478 Elongation factor Tu; Provisional 100.0
CHL00071409 tufA elongation factor Tu 100.0
PRK12735396 elongation factor Tu; Reviewed 100.0
PRK00049396 elongation factor Tu; Reviewed 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
PLN03127447 Elongation factor Tu; Provisional 100.0
TIGR00485394 EF-Tu translation elongation factor TU. This align 100.0
COG0050394 TufB GTPases - translation elongation factors [Tra 100.0
KOG0460449 consensus Mitochondrial translation elongation fac 100.0
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 100.0
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 100.0
COG3276 447 SelB Selenocysteine-specific translation elongatio 100.0
PRK04000411 translation initiation factor IF-2 subunit gamma; 100.0
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 100.0
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 100.0
COG5258527 GTPBP1 GTPase [General function prediction only] 100.0
KOG0463641 consensus GTP-binding protein GP-1 [General functi 100.0
COG5257415 GCD11 Translation initiation factor 2, gamma subun 100.0
KOG1143591 consensus Predicted translation elongation factor 100.0
KOG0052391 consensus Translation elongation factor EF-1 alpha 100.0
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 100.0
KOG0461 522 consensus Selenocysteine-specific elongation facto 100.0
PRK10218 607 GTP-binding protein; Provisional 100.0
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 100.0
PRK05433 600 GTP-binding protein LepA; Provisional 100.0
COG1217 603 TypA Predicted membrane GTPase involved in stress 100.0
KOG0462 650 consensus Elongation factor-type GTP-binding prote 100.0
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 100.0
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.97
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.96
PRK07560 731 elongation factor EF-2; Reviewed 99.96
PRK00007 693 elongation factor G; Reviewed 99.96
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.96
PRK00741526 prfC peptide chain release factor 3; Provisional 99.96
PRK12739 691 elongation factor G; Reviewed 99.96
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 99.96
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 99.96
PRK05306 787 infB translation initiation factor IF-2; Validated 99.95
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.95
TIGR00503527 prfC peptide chain release factor 3. This translat 99.95
KOG0466466 consensus Translation initiation factor 2, gamma s 99.95
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.95
PRK13351 687 elongation factor G; Reviewed 99.95
PRK12740 668 elongation factor G; Reviewed 99.94
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 99.93
CHL00189 742 infB translation initiation factor 2; Provisional 99.93
KOG0465 721 consensus Mitochondrial elongation factor [Transla 99.93
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.92
PRK14845 1049 translation initiation factor IF-2; Provisional 99.92
KOG1145 683 consensus Mitochondrial translation initiation fac 99.92
PRK04004 586 translation initiation factor IF-2; Validated 99.92
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.91
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.91
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.91
PTZ00416 836 elongation factor 2; Provisional 99.91
cd03704108 eRF3c_III This family represents eEF1alpha-like C- 99.9
cd04093107 HBS1_C HBS1_C: this family represents the C-termin 99.89
cd03705104 EF1_alpha_III Domain III of EF-1. Eukaryotic elong 99.88
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.86
KOG0469 842 consensus Elongation factor 2 [Translation, riboso 99.86
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.85
cd04095103 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily repres 99.84
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.84
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.83
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.83
PF0314399 GTP_EFTU_D3: Elongation factor Tu C-terminal domai 99.82
KOG0464 753 consensus Elongation factor G [Translation, riboso 99.82
cd01513102 Translation_factor_III Domain III of Elongation fa 99.8
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 99.79
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.78
KOG0467 887 consensus Translation elongation factor 2/ribosome 99.78
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.77
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 99.77
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.76
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 99.75
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.74
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.74
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 99.73
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 99.71
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.7
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 99.69
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 99.69
cd00881189 GTP_translation_factor GTP translation factor fami 99.68
cd0369683 selB_II selB_II: this subfamily represents the dom 99.67
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 99.66
COG1160444 Predicted GTPases [General function prediction onl 99.62
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.61
cd0370693 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF 99.59
COG1159298 Era GTPase [General function prediction only] 99.56
cd0370790 EFTU_III Domain III of elongation factor (EF) Tu. 99.56
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.56
COG1160444 Predicted GTPases [General function prediction onl 99.55
cd0370887 GTPBP_III Domain III of the GP-1 family of GTPase. 99.54
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.5
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.47
PRK00093435 GTP-binding protein Der; Reviewed 99.47
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.44
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.44
PRK15494339 era GTPase Era; Provisional 99.43
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.43
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.42
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.41
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.37
PRK03003472 GTP-binding protein Der; Reviewed 99.37
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 99.36
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.33
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.33
PRK03003472 GTP-binding protein Der; Reviewed 99.31
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.31
PRK00089292 era GTPase Era; Reviewed 99.31
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.29
cd0409497 selB_III This family represents the domain of elon 99.29
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.28
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.28
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.28
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.27
PRK00093435 GTP-binding protein Der; Reviewed 99.27
PRK09866 741 hypothetical protein; Provisional 99.26
PTZ00099176 rab6; Provisional 99.26
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.25
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 99.25
COG2229187 Predicted GTPase [General function prediction only 99.24
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.24
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.22
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.22
PLN00223181 ADP-ribosylation factor; Provisional 99.22
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.21
PRK12298390 obgE GTPase CgtA; Reviewed 99.21
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.2
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.2
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.2
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.19
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.18
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.18
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.17
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.17
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.17
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.16
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.16
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.16
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.16
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.16
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.16
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.16
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.16
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.15
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.15
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.13
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.13
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.13
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.13
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.12
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.12
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.12
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.12
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.11
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.11
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.11
PTZ00133182 ADP-ribosylation factor; Provisional 99.11
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.1
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.1
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.1
PRK12299335 obgE GTPase CgtA; Reviewed 99.1
PRK04213201 GTP-binding protein; Provisional 99.1
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.1
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.1
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.09
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.09
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.08
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.08
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.08
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.08
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.08
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.08
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.08
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.07
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.07
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.07
COG0486454 ThdF Predicted GTPase [General function prediction 99.07
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.07
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.07
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.06
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.06
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.06
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.06
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.05
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.05
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.05
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.05
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.05
PRK12296500 obgE GTPase CgtA; Reviewed 99.05
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.04
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.04
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.04
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.04
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.04
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.03
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.03
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.03
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 99.03
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.03
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.03
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.03
PTZ00369189 Ras-like protein; Provisional 99.03
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.03
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.02
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.02
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.01
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.01
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.01
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.0
PRK12297424 obgE GTPase CgtA; Reviewed 99.0
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.0
PLN03118211 Rab family protein; Provisional 99.0
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.99
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.99
PRK11058426 GTPase HflX; Provisional 98.98
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.98
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.98
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 98.97
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.97
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.96
PF00025175 Arf: ADP-ribosylation factor family The prints ent 98.96
PLN03071219 GTP-binding nuclear protein Ran; Provisional 98.96
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.96
PLN03110216 Rab GTPase; Provisional 98.96
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.96
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 98.95
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.95
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.95
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.94
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 98.93
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 98.93
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.93
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.93
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 98.93
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.91
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.89
PLN03108210 Rab family protein; Provisional 98.88
KOG0093193 consensus GTPase Rab3, small G protein superfamily 98.88
COG0218200 Predicted GTPase [General function prediction only 98.87
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.87
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 98.86
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 98.85
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.85
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.85
KOG0095213 consensus GTPase Rab30, small G protein superfamil 98.83
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 98.82
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 98.82
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.81
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 98.81
KOG0086214 consensus GTPase Rab4, small G protein superfamily 98.81
cd04105203 SR_beta Signal recognition particle receptor, beta 98.81
PF1457881 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 98.8
cd0369085 Tet_II Tet_II: This subfamily represents domain II 98.8
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 98.8
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.79
cd01896233 DRG The developmentally regulated GTP-binding prot 98.79
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.79
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 98.79
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.78
KOG0088218 consensus GTPase Rab21, small G protein superfamil 98.77
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 98.77
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 98.74
KOG0080209 consensus GTPase Rab18, small G protein superfamil 98.74
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 98.74
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 98.73
KOG0097215 consensus GTPase Rab14, small G protein superfamil 98.72
cd0369986 lepA_II lepA_II: This subfamily represents the dom 98.7
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 98.7
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 98.7
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 98.7
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 98.69
cd0368985 RF3_II RF3_II: this subfamily represents the domai 98.67
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 98.65
COG1163365 DRG Predicted GTPase [General function prediction 98.63
KOG0079198 consensus GTP-binding protein H-ray, small G prote 98.62
KOG0081219 consensus GTPase Rab27, small G protein superfamil 98.62
COG1084346 Predicted GTPase [General function prediction only 98.61
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.6
KOG0394210 consensus Ras-related GTPase [General function pre 98.59
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 98.58
KOG0091213 consensus GTPase Rab39, small G protein superfamil 98.57
PRK13768253 GTPase; Provisional 98.57
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.56
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 98.54
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.53
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.52
PF09439181 SRPRB: Signal recognition particle receptor beta s 98.51
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.49
COG2262411 HflX GTPases [General function prediction only] 98.45
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.45
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.45
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 98.43
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 98.42
KOG1489366 consensus Predicted GTP-binding protein (ODN super 98.41
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.4
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.4
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.39
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.35
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.35
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami 98.35
PLN00023334 GTP-binding protein; Provisional 98.33
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.26
KOG0090238 consensus Signal recognition particle receptor, be 98.24
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.23
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.2
KOG0395196 consensus Ras-related GTPase [General function pre 98.19
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina 98.18
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.13
PRK09435332 membrane ATPase/protein kinase; Provisional 98.1
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.09
PRK12289352 GTPase RsgA; Reviewed 98.08
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 98.07
PRK09563287 rbgA GTPase YlqF; Reviewed 98.07
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.05
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.05
COG3596296 Predicted GTPase [General function prediction only 98.05
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.05
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 98.01
COG1100219 GTPase SAR1 and related small G proteins [General 98.0
PRK00098298 GTPase RsgA; Reviewed 97.91
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 97.84
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.82
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 97.81
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.8
KOG3886295 consensus GTP-binding protein [Signal transduction 97.79
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 97.79
CHL00189742 infB translation initiation factor 2; Provisional 97.77
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.76
KOG1673205 consensus Ras GTPases [General function prediction 97.75
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 97.75
PRK05306787 infB translation initiation factor IF-2; Validated 97.71
PRK12288347 GTPase RsgA; Reviewed 97.67
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 97.67
PRK13796365 GTPase YqeH; Provisional 97.61
COG0536369 Obg Predicted GTPase [General function prediction 97.58
PRK01889356 GTPase RsgA; Reviewed 97.57
cd03110179 Fer4_NifH_child This protein family's function is 97.47
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 97.47
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 97.46
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 97.45
KOG4252246 consensus GTP-binding protein [Signal transduction 97.45
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 97.43
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 97.43
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 97.42
COG1162301 Predicted GTPases [General function prediction onl 97.32
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 97.19
KOG1490620 consensus GTP-binding protein CRFG/NOG1 (ODN super 97.18
KOG2486320 consensus Predicted GTPase [General function predi 97.18
cd0370295 IF2_mtIF2_II This family represents the domain II 97.17
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.15
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 97.09
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.02
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.98
PRK09602396 translation-associated GTPase; Reviewed 96.92
PF0917388 eIF2_C: Initiation factor eIF2 gamma, C terminal; 96.87
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 96.82
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 96.8
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 96.79
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 96.77
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 96.74
cd03703110 aeIF5B_II aeIF5B_II: This family represents the do 96.69
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 96.67
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 96.65
cd0370195 IF2_IF5B_II IF2_IF5B_II: This family represents th 96.62
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 96.55
TIGR00064272 ftsY signal recognition particle-docking protein F 96.51
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 96.45
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 96.43
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 96.42
KOG0082354 consensus G-protein alpha subunit (small G protein 96.41
PRK10416318 signal recognition particle-docking protein FtsY; 96.35
cd02036179 MinD Bacterial cell division requires the formatio 96.33
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 96.2
KOG2484435 consensus GTPase [General function prediction only 96.04
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 96.03
KOG3883198 consensus Ras family small GTPase [Signal transduc 96.02
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 95.99
PRK14974336 cell division protein FtsY; Provisional 95.98
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 95.93
KOG0410410 consensus Predicted GTP binding protein [General f 95.88
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 95.81
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.81
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.73
cd03111106 CpaE_like This protein family consists of proteins 95.7
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 95.64
cd03115173 SRP The signal recognition particle (SRP) mediates 95.55
KOG0099379 consensus G protein subunit Galphas, small G prote 95.4
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.4
PRK04004586 translation initiation factor IF-2; Validated 95.29
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 95.23
COG1149284 MinD superfamily P-loop ATPase containing an inser 95.17
cd03114148 ArgK-like The function of this protein family is u 95.15
PHA02518211 ParA-like protein; Provisional 95.07
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 95.06
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 94.96
PTZ00258390 GTP-binding protein; Provisional 94.72
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 94.59
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 94.58
KOG11441064 consensus Translation initiation factor 5B (eIF-5B 94.58
COG1161322 Predicted GTPases [General function prediction onl 94.56
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 94.46
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 94.46
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 94.31
CHL00175281 minD septum-site determining protein; Validated 94.06
PRK148451049 translation initiation factor IF-2; Provisional 94.03
TIGR01968261 minD_bact septum site-determining protein MinD. Th 93.96
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 93.92
KOG0447 980 consensus Dynamin-like GTP binding protein [Genera 93.91
PRK09601364 GTP-binding protein YchF; Reviewed 93.9
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.88
cd03112158 CobW_like The function of this protein family is u 93.79
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 93.54
KOG3887347 consensus Predicted small GTPase involved in nucle 93.51
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 93.5
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 93.49
PRK13849231 putative crown gall tumor protein VirC1; Provision 93.33
KOG0780483 consensus Signal recognition particle, subunit Srp 93.27
PRK00771437 signal recognition particle protein Srp54; Provisi 93.23
TIGR00959428 ffh signal recognition particle protein. This mode 92.92
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 92.53
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 92.29
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 91.8
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 91.45
PRK10867433 signal recognition particle protein; Provisional 91.23
COG5019373 CDC3 Septin family protein [Cell division and chro 91.2
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 91.12
KOG2423572 consensus Nucleolar GTPase [General function predi 91.06
COG0552340 FtsY Signal recognition particle GTPase [Intracell 90.81
cd02032267 Bchl_like This family of proteins contains bchL an 90.81
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 90.58
PRK13505557 formate--tetrahydrofolate ligase; Provisional 90.35
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 89.74
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 89.68
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 88.89
PRK10037250 cell division protein; Provisional 88.42
PRK11670369 antiporter inner membrane protein; Provisional 87.84
KOG3905473 consensus Dynein light intermediate chain [Cell mo 87.8
TIGR03029274 EpsG chain length determinant protein tyrosine kin 87.47
PRK10818270 cell division inhibitor MinD; Provisional 87.36
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 87.3
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 87.24
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 87.2
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 87.15
KOG1145683 consensus Mitochondrial translation initiation fac 87.04
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 86.8
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 86.55
cd02117212 NifH_like This family contains the NifH (iron prot 86.18
CHL00072290 chlL photochlorophyllide reductase subunit L 85.9
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 85.87
KOG1534273 consensus Putative transcription factor FET5 [Tran 85.31
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 84.59
COG0012372 Predicted GTPase, probable translation factor [Tra 84.58
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 84.21
PHA02519387 plasmid partition protein SopA; Reviewed 83.94
PRK13705388 plasmid-partitioning protein SopA; Provisional 83.51
PF05783472 DLIC: Dynein light intermediate chain (DLIC); Inte 83.49
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 83.32
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 81.94
PRK13869405 plasmid-partitioning protein RepA; Provisional 81.25
PRK00090222 bioD dithiobiotin synthetase; Reviewed 81.04
TIGR03453387 partition_RepA plasmid partitioning protein RepA. 80.62
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-86  Score=611.59  Aligned_cols=370  Identities=44%  Similarity=0.791  Sum_probs=357.6

Q ss_pred             CceecCCCHHHHhhcceeeccceeeeecCcEEEEEeCCCCCChHHHHHHhhhhcCEEEEEEECCCCccccccccCCchHH
Q 016750            1 MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTRE   80 (383)
Q Consensus         1 ~a~~~D~~~~E~~rG~Ti~~~~~~~~~~~~~i~liDtPG~~~~~~~~~~~~~~ad~~ilvvda~~g~~~~~~~~~~~~~~   80 (383)
                      |||+||+++||||||+|++.+...|+++.+.|+++|||||+||+++|+.++++||+|||||||..+.||+||..++||+|
T Consensus        56 fawvlD~tkeERerGvTi~~~~~~fet~k~~~tIiDaPGHrdFvknmItGasqAD~aVLVV~a~~~efE~g~~~~gQtrE  135 (428)
T COG5256          56 FAWVLDKTKEERERGVTIDVAHSKFETDKYNFTIIDAPGHRDFVKNMITGASQADVAVLVVDARDGEFEAGFGVGGQTRE  135 (428)
T ss_pred             EEEEecCChhHHhcceEEEEEEEEeecCCceEEEeeCCchHHHHHHhhcchhhccEEEEEEECCCCccccccccCCchhH
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCeEEEEEecCCCCCCCccHHHHHHHHHHHHHHHHhcCCCCCCCceEEEccccccccccccccCCCCCCCC
Q 016750           81 HVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWN  160 (383)
Q Consensus        81 ~~~~~~~~~i~~~ivviNK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~iSa~~g~~i~~~~~~~~~~w~~  160 (383)
                      |+.+++.+|+.++||++||||+  .+|+++||+++++++..+++.+||++. +++|||+||++|+|+.+..+  .+|||+
T Consensus       136 H~~La~tlGi~~lIVavNKMD~--v~wde~rf~ei~~~v~~l~k~~G~~~~-~v~FIPiSg~~G~Nl~~~s~--~~pWY~  210 (428)
T COG5256         136 HAFLARTLGIKQLIVAVNKMDL--VSWDEERFEEIVSEVSKLLKMVGYNPK-DVPFIPISGFKGDNLTKKSE--NMPWYK  210 (428)
T ss_pred             HHHHHHhcCCceEEEEEEcccc--cccCHHHHHHHHHHHHHHHHHcCCCcc-CCeEEecccccCCcccccCc--CCcCcc
Confidence            9999999999999999999999  889999999999999999999999854 68999999999999999774  799999


Q ss_pred             cccHHHHhhccCCCCCCCCCCeeEEEEEEE--ccCCeEEEEEEEEeEEecCCEEEEecCCcEEEEEEEEECCccceecCC
Q 016750          161 GPCLFEALDRIEITPRDPNGPFRMPIIDKF--KDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGP  238 (383)
Q Consensus       161 g~~L~~~l~~~~~~~~~~~~p~~~~I~~~~--~~~G~vv~G~V~sG~l~~gd~v~i~p~~~~~~V~sI~~~~~~v~~a~a  238 (383)
                      ||+|++.|+.+.+|.+..+.|||++|.++|  .+.|++..|||++|.|++||++++.|.+...+|+||++|+++.++|.|
T Consensus       211 GpTLleaLd~~~~p~~~~d~Plr~pI~~v~~i~~~gtv~vGrVEsG~i~~g~~v~~~p~~~~~evksie~~~~~~~~a~~  290 (428)
T COG5256         211 GPTLLEALDQLEPPERPLDKPLRLPIQDVYSISGIGTVPVGRVESGVIKPGQKVTFMPAGVVGEVKSIEMHHEEISQAEP  290 (428)
T ss_pred             CChHHHHHhccCCCCCCCCCCeEeEeeeEEEecCCceEEEEEEeeeeeccCCEEEEecCcceEEEeeeeecccccccCCC
Confidence            999999999999999999999999999999  589999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEEecCCccCceeeEEEecCCCCcccccEEEEEEEEeccccc-ccccCCcEEEEEEeeeEEEEEEEEEEEEeecC
Q 016750          239 GENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDN-AIFTAGYKAVLHIHAVVEECEIVELLHQIDLK  317 (383)
Q Consensus       239 G~~v~l~l~g~~~~~i~~G~vl~~~~~~~~~~~~f~a~i~~~~~~~~-~~i~~g~~~~~~~~~~~~~~~i~~i~~~~d~~  317 (383)
                      ||.++++++|++.+|+++|++++++++++..+.+|.|++.+   +.+ ..|.+||++++|+|+...+|++.++..++|+.
T Consensus       291 GD~i~~~vrgv~~~dI~~Gdv~~~~~n~~t~s~~f~a~i~v---l~~p~~i~~Gyt~vlh~hta~~a~~~~~l~~k~d~~  367 (428)
T COG5256         291 GDNVGFNVRGVEKNDIRRGDVIGHSDNPPTVSPEFTAQIIV---LWHPGIITSGYTPVLHAHTAQVACRIAELLSKLDPR  367 (428)
T ss_pred             CCeEEEEecCCchhccCCccEeccCCCCcccccceEEEEEE---EecCccccCCCccEEEecccceeeeHHHHHHhhCcc
Confidence            99999999999999999999999999999999999999999   555 78999999999999999999999999999999


Q ss_pred             CCcccccccccccCCCEEEEEEEECceEEeeeccCccccceEEEEeCCcEEEEEEEEEcCC
Q 016750          318 TKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRFTLRTEGKTVAVGKVTELPT  378 (383)
Q Consensus       318 ~~~~~~~~~~~l~~g~~~~v~~~~~~pi~~~~~~~~~~lgr~ilr~~~~tvg~G~V~~~~~  378 (383)
                      ||+..+++|.++++|+.+.+++++.+|+|++.++++|.||||.|||.|+|||+|+|.++.+
T Consensus       368 t~k~~~~~p~f~k~g~~~iv~i~~~kP~~~e~~~~~~~Lgrfalrd~g~tIA~G~v~~v~~  428 (428)
T COG5256         368 TGKKLEENPQFLKRGDAAIVKIEPEKPLCLEKVSEIPQLGRFALRDMGQTIAAGKVLEVKK  428 (428)
T ss_pred             cccccccChhhhhcCceEEEEEEecCceEeeecccCCccceEEEEeCCCeEEeEEEEeccC
Confidence            9999999999999999999999999999999999999999999999999999999998763

>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd03704 eRF3c_III This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu Back     alignment and domain information
>cd04093 HBS1_C HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha Back     alignment and domain information
>cd03705 EF1_alpha_III Domain III of EF-1 Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd04095 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PF03143 GTP_EFTU_D3: Elongation factor Tu C-terminal domain; InterPro: IPR004160 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01513 Translation_factor_III Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU) Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd03707 EFTU_III Domain III of elongation factor (EF) Tu Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd03708 GTPBP_III Domain III of the GP-1 family of GTPase Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04094 selB_III This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PF09173 eIF2_C: Initiation factor eIF2 gamma, C terminal; InterPro: IPR015256 This entry represents a domain which is found in the initiation factors eIF2 and EF-Tu, adopting a beta barrel structure with Greek key topology Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query383
3j2k_7439 Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associ 1e-102
1r5b_A467 Crystal Structure Analysis Of Sup35 Length = 467 2e-92
1jny_A435 Crystal Structure Of Sulfolobus Solfataricus Elonga 4e-58
3vmf_A440 Archaeal Protein Length = 440 5e-58
3agj_A437 Crystal Structure Of Archaeal Pelota And Gtp-bound 5e-58
3e1y_E204 Crystal Structure Of Human Erf1ERF3 COMPLEX Length 8e-46
1f60_A458 Crystal Structure Of The Yeast Elongation Factor Co 5e-43
3e20_A201 Crystal Structure Of S.Pombe Erf1ERF3 COMPLEX Lengt 8e-39
3mca_A592 Structure Of The Dom34-Hbs1 Complex And Implication 1e-36
3p26_A483 Crystal Structure Of S. Cerevisiae Hbs1 Protein (Ap 1e-35
3izq_1611 Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To 2e-35
3p27_A483 Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gd 2e-33
1zun_B434 Crystal Structure Of A Gtp-Regulated Atp Sulfurylas 2e-19
2c78_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 5e-19
2c77_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 6e-19
1exm_A405 Crystal Structure Of Thermus Thermophilus Elongatio 6e-19
2y0u_Z405 The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bou 6e-19
1aip_A405 Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt 6e-19
2y0y_Z405 The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bo 6e-19
2wrn_Z406 The Crystal Structure Of The 70s Ribosome Bound To 7e-19
1ttt_A405 Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Com 2e-18
4abr_Z405 Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kir 2e-18
1eft_A405 The Crystal Structure Of Elongation Factor Ef-Tu Fr 2e-18
1mj1_A405 Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIB 2e-15
4ac9_A482 Crystal Structure Of Translation Elongation Factor 2e-15
1d2e_A397 Crystal Structure Of Mitochondrial Ef-Tu In Complex 3e-12
1xb2_A409 Crystal Structure Of Bos Taurus Mitochondrial Elong 3e-11
1kk3_A410 Structure Of The Wild-Type Large Gamma Subunit Of I 5e-09
1kjz_A410 Structure Of The Large Gamma Subunit Of Initiation 7e-09
3agp_A 1289 Structure Of Viral Polymerase Form I Length = 1289 8e-09
3agp_A 1289 Structure Of Viral Polymerase Form I Length = 1289 9e-04
1efu_A385 Elongation Factor Complex Ef-TuEF-Ts From Escherich 1e-08
1efu_A385 Elongation Factor Complex Ef-TuEF-Ts From Escherich 6e-04
1ob2_A393 E. Coli Elongation Factor Ef-Tu Complexed With The 1e-08
1ob2_A393 E. Coli Elongation Factor Ef-Tu Complexed With The 6e-04
3u6b_A394 Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 1e-08
3u6b_A394 Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 5e-04
1dg1_G394 Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len 1e-08
1dg1_G394 Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len 5e-04
1efc_A393 Intact Elongation Factor From E.Coli Length = 393 2e-08
1efc_A393 Intact Elongation Factor From E.Coli Length = 393 6e-04
1d8t_A393 Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M 2e-08
1d8t_A393 Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M 6e-04
3mmp_A678 Structure Of The Qb Replicase, An Rna-Dependent Rna 2e-08
3mmp_A678 Structure Of The Qb Replicase, An Rna-Dependent Rna 8e-04
2d74_A419 Crystal Structure Of Translation Initiation Factor 5e-08
1efm_A379 Structure Of The Gdp Domain Of Ef-Tu And Location O 9e-07
1efm_A379 Structure Of The Gdp Domain Of Ef-Tu And Location O 6e-04
1kk0_A410 Structure Of The Large Gamma Subunit Of Initiation 1e-06
2hdn_B335 Trypsin-Modified Elongation Factor Tu In Complex Wi 1e-06
2hdn_B335 Trypsin-Modified Elongation Factor Tu In Complex Wi 8e-04
2hcj_B335 "trypsin-Modified Elongation Factor Tu In Complex W 1e-06
2hcj_B335 "trypsin-Modified Elongation Factor Tu In Complex W 7e-04
1s0u_A408 Eif2gamma Apo Length = 408 3e-06
3j25_A 638 Structural Basis For Tetm-Mediated Tetracycline Res 3e-04
1zo1_I501 If2, If1, And Trna Fitted To Cryo-Em Data Of E. Col 4e-04
>pdb|3J2K|7 Chain 7, Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associated Termination Complex Length = 439 Back     alignment and structure 
Iteration: 1

 Score =  367 bits (941), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/376 (49%), Positives = 234/376 (62%), Gaps = 4/376 (1%)
Query: 1   MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLV 60
           +++ +DTN+EER KGKTVEVGRA+FETE   FTILDAPGHKS+VPNMI GASQAD+ VLV
Sbjct: 66  LSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLV 125
Query: 61  ISARXXXXXXXXXXXXQTREHVMXXXXXXXXXXXXXXXXMDDHTVNWSKERYDEIESKMT 120
           ISAR            QTREH M                MDD TVNWS ERY+E + K+ 
Sbjct: 126 ISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLV 185
Query: 121 PFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNG 180
           PFLK  G+N KKD+ F+P SGL G N+K + D   CPW+ G      LD +    R  +G
Sbjct: 186 PFLKKVGFNPKKDIHFMPCSGLTGANLKEQSD--FCPWYIGLPFIPYLDNLPNFNRSVDG 243
Query: 181 PFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGE 240
           P R+PI+DK+KDMGTVV+GK+ESGS+ +G  L++MPNK  V+VL I  DD       PGE
Sbjct: 244 PIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGE 303
Query: 241 NLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHIHA 300
           NL+IRL GIEEE+IL GF+L   +    +   F  Q+ I+E    +I   GY AVLHIH 
Sbjct: 304 NLKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVIIE--HKSIICPGYNAVLHIHT 361
Query: 301 VVEECEIVELLHQIDXXXXXXXXXXXXXXXNGAIVVCRIQVNNSICTEKFADFAQLGRFT 360
            +EE EI  L+  +D                  + + R++   +IC E F DF Q+GRFT
Sbjct: 362 CIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFT 421
Query: 361 LRTEGKTVAVGKVTEL 376
           LR EGKT+A+GKV +L
Sbjct: 422 LRDEGKTIAIGKVLKL 437
>pdb|1R5B|A Chain A, Crystal Structure Analysis Of Sup35 Length = 467 Back     alignment and structure
>pdb|1JNY|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Elongation Factor 1 Alpha In Complex With Gdp Length = 435 Back     alignment and structure
>pdb|3VMF|A Chain A, Archaeal Protein Length = 440 Back     alignment and structure
>pdb|3AGJ|A Chain A, Crystal Structure Of Archaeal Pelota And Gtp-bound Ef1 Alpha Complex Length = 437 Back     alignment and structure
>pdb|3E1Y|E Chain E, Crystal Structure Of Human Erf1ERF3 COMPLEX Length = 204 Back     alignment and structure
>pdb|1F60|A Chain A, Crystal Structure Of The Yeast Elongation Factor Complex Eef1a:eef1ba Length = 458 Back     alignment and structure
>pdb|3E20|A Chain A, Crystal Structure Of S.Pombe Erf1ERF3 COMPLEX Length = 201 Back     alignment and structure
>pdb|3MCA|A Chain A, Structure Of The Dom34-Hbs1 Complex And Implications For Its Role In No-Go Decay Length = 592 Back     alignment and structure
>pdb|3P26|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Apo-Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 Back     alignment and structure
>pdb|3IZQ|1 Chain 1, Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To A Translating Ribosome Length = 611 Back     alignment and structure
>pdb|3P27|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gdp-Bound Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 Back     alignment and structure
>pdb|1ZUN|B Chain B, Crystal Structure Of A Gtp-Regulated Atp Sulfurylase Heterodimer From Pseudomonas Syringae Length = 434 Back     alignment and structure
>pdb|2C78|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Pulvomycin Length = 405 Back     alignment and structure
>pdb|2C77|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Ge2270 A Length = 405 Back     alignment and structure
>pdb|1EXM|A Chain A, Crystal Structure Of Thermus Thermophilus Elongation Factor Tu (Ef-Tu) In Complex With The Gtp Analogue Gppnhp. Length = 405 Back     alignment and structure
>pdb|2Y0U|Z Chain Z, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1AIP|A Chain A, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 405 Back     alignment and structure
>pdb|2Y0Y|Z Chain Z, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2WRN|Z Chain Z, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 1 Of 4). Length = 406 Back     alignment and structure
>pdb|1TTT|A Chain A, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex Length = 405 Back     alignment and structure
>pdb|4ABR|Z Chain Z, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin With The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1EFT|A Chain A, The Crystal Structure Of Elongation Factor Ef-Tu From Thermus Aquaticus In The Gtp Conformation Length = 405 Back     alignment and structure
>pdb|1MJ1|A Chain A, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL PROTEINS Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome Length = 405 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure
>pdb|1D2E|A Chain A, Crystal Structure Of Mitochondrial Ef-Tu In Complex With Gdp Length = 397 Back     alignment and structure
>pdb|1XB2|A Chain A, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 409 Back     alignment and structure
>pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 Back     alignment and structure
>pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 Back     alignment and structure
>pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 Back     alignment and structure
>pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 Back     alignment and structure
>pdb|1EFU|A Chain A, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 385 Back     alignment and structure
>pdb|1EFU|A Chain A, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 385 Back     alignment and structure
>pdb|1OB2|A Chain A, E. Coli Elongation Factor Ef-Tu Complexed With The Antibiotic Kirromycin, A Gtp Analog, And Phe-Trna Length = 393 Back     alignment and structure
>pdb|1OB2|A Chain A, E. Coli Elongation Factor Ef-Tu Complexed With The Antibiotic Kirromycin, A Gtp Analog, And Phe-Trna Length = 393 Back     alignment and structure
>pdb|3U6B|A Chain A, Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 Length = 394 Back     alignment and structure
>pdb|3U6B|A Chain A, Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 Length = 394 Back     alignment and structure
>pdb|1DG1|G Chain G, Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Length = 394 Back     alignment and structure
>pdb|1DG1|G Chain G, Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Length = 394 Back     alignment and structure
>pdb|1EFC|A Chain A, Intact Elongation Factor From E.Coli Length = 393 Back     alignment and structure
>pdb|1EFC|A Chain A, Intact Elongation Factor From E.Coli Length = 393 Back     alignment and structure
>pdb|1D8T|A Chain A, Crystal Structure Of Elongation Factor, Tu (Ef-Tu-Mggdp) Complexed With Ge2270a, A Thiazolyl Peptide Antibiotic Length = 393 Back     alignment and structure
>pdb|1D8T|A Chain A, Crystal Structure Of Elongation Factor, Tu (Ef-Tu-Mggdp) Complexed With Ge2270a, A Thiazolyl Peptide Antibiotic Length = 393 Back     alignment and structure
>pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 Back     alignment and structure
>pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 Back     alignment and structure
>pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 Back     alignment and structure
>pdb|1EFM|A Chain A, Structure Of The Gdp Domain Of Ef-Tu And Location Of The Amino Acids Homologous To Ras Oncogene Proteins Length = 379 Back     alignment and structure
>pdb|1EFM|A Chain A, Structure Of The Gdp Domain Of Ef-Tu And Location Of The Amino Acids Homologous To Ras Oncogene Proteins Length = 379 Back     alignment and structure
>pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 Back     alignment and structure
>pdb|2HDN|B Chain B, Trypsin-Modified Elongation Factor Tu In Complex With Tetracycline At 2.8 Angstrom Resolution Length = 335 Back     alignment and structure
>pdb|2HDN|B Chain B, Trypsin-Modified Elongation Factor Tu In Complex With Tetracycline At 2.8 Angstrom Resolution Length = 335 Back     alignment and structure
>pdb|2HCJ|B Chain B, "trypsin-Modified Elongation Factor Tu In Complex With Tetracycline" Length = 335 Back     alignment and structure
>pdb|2HCJ|B Chain B, "trypsin-Modified Elongation Factor Tu In Complex With Tetracycline" Length = 335 Back     alignment and structure
>pdb|1S0U|A Chain A, Eif2gamma Apo Length = 408 Back     alignment and structure
>pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 Back     alignment and structure
>pdb|1ZO1|I Chain I, If2, If1, And Trna Fitted To Cryo-Em Data Of E. Coli 70s Initiation Complex Length = 501 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query383
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 0.0
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 0.0
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 0.0
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 1e-180
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 1e-176
1f60_A458 Elongation factor EEF1A; protein-protein complex, 1e-157
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 2e-87
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 1e-72
1wb1_A482 Translation elongation factor SELB; selenocysteine 2e-47
2elf_A370 Protein translation elongation factor 1A; tRNA, py 1e-40
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 3e-35
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 2e-31
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 1e-30
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 1e-30
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 6e-30
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 9e-30
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 2e-06
1xe1_A116 Hypothetical protein PF0907; structural genomics, 6e-06
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 1e-05
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 5e-04
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 Back     alignment and structure
 Score =  520 bits (1341), Expect = 0.0
 Identities = 139/379 (36%), Positives = 228/379 (60%), Gaps = 7/379 (1%)

Query: 1   MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLV 60
            A+++D  +EER +G T+ +    FET+   FTI+DAPGH+ +V NMI+GASQAD  +LV
Sbjct: 55  FAFLLDRLKEERERGVTINLTFMRFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILV 114

Query: 61  ISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMT 120
           +SA+KGE+E G    GQTREH++LAKT+G+ +L++ VNKMD     + ++RY EI  +++
Sbjct: 115 VSAKKGEYEAGMSVEGQTREHIILAKTMGLDQLIVAVNKMDLTEPPYDEKRYKEIVDQVS 174

Query: 121 PFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWNGPCLFEALDRIEITPRDPNG 180
            F+++ G+N    V+F+P+    G N+  + +     W+NGP L E LD++E+ P+  + 
Sbjct: 175 KFMRSYGFN-TNKVRFVPVVAPSGDNITHKSEN--MKWYNGPTLEEYLDQLELPPKPVDK 231

Query: 181 PFRMPIIDKFK--DMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGP 238
           P R+PI D +    +GTV +G+VESG ++ GD ++ MP     +V +I     ++  A P
Sbjct: 232 PLRIPIQDVYSISGVGTVPVGRVESGVLKVGDKIVFMPAGKVGEVRSIETHHTKMDKAEP 291

Query: 239 GENLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDNAIFTAGYKAVLHI 298
           G+N+   + G+E++DI  G V+     P     EF A++ ++          GY  VLH+
Sbjct: 292 GDNIGFNVRGVEKKDIKRGDVVGHPNNPPTVADEFTARIIVVWH--PTALANGYTPVLHV 349

Query: 299 HAVVEECEIVELLHQIDLKTKKPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGR 358
           H     C + EL+ ++D +T +  +K   F+K G + + + +    +C EK+ +F  LGR
Sbjct: 350 HTASVACRVSELVSKLDPRTGQEAEKNPQFLKQGDVAIVKFKPIKPLCVEKYNEFPPLGR 409

Query: 359 FTLRTEGKTVAVGKVTELP 377
           F +R  GKTV VG + ++ 
Sbjct: 410 FAMRDMGKTVGVGIIVDVK 428
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Length = 204 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Length = 116 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Length = 537 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Length = 501 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query383
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 100.0
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 100.0
1f60_A458 Elongation factor EEF1A; protein-protein complex, 100.0
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 100.0
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 100.0
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 100.0
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 100.0
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 100.0
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 100.0
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 100.0
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 100.0
1wb1_A482 Translation elongation factor SELB; selenocysteine 100.0
2elf_A370 Protein translation elongation factor 1A; tRNA, py 100.0
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 100.0
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 100.0
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 100.0
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 100.0
3vqt_A548 RF-3, peptide chain release factor 3; translation, 100.0
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 100.0
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.97
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.97
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.97
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.96
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.96
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.96
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.95
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.95
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.94
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.94
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.94
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.93
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.91
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.51
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.5
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.49
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.45
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.43
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.4
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.36
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.36
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.35
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.34
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.34
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.33
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.33
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.32
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.32
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.32
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.31
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.31
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.31
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.31
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.3
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.3
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.3
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.3
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.3
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.29
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.29
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.28
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.28
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.28
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.27
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.27
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.27
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.27
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.26
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.26
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.26
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.26
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.26
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.26
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.26
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.26
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.26
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.25
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.25
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.25
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.25
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.25
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.25
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.24
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.24
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.24
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.24
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.23
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.23
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.23
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.23
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.23
1xe1_A116 Hypothetical protein PF0907; structural genomics, 99.23
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.22
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.22
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.22
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.22
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.21
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.21
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.21
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.21
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.21
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.21
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.2
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.2
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.2
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.2
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.2
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.2
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.2
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.19
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.19
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.19
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.18
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.18
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.18
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.18
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.18
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.18
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.17
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.17
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.17
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.17
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.17
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.16
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.16
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.16
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.16
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.16
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.16
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.16
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.15
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.15
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.15
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.15
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.14
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.14
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.14
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.13
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.13
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.12
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.12
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.11
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.11
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.11
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.11
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.1
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.1
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.09
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.08
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.05
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.61
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.03
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.02
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.01
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.98
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.97
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.97
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.97
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.96
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.95
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.95
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 98.94
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.94
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.93
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.93
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.92
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.92
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.89
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 98.88
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.86
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.82
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.82
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.81
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.77
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.77
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.76
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.75
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.71
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 98.71
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.68
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.66
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.64
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.61
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 98.6
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.59
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.58
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.58
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 98.57
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.56
2ged_A193 SR-beta, signal recognition particle receptor beta 98.55
1wxq_A397 GTP-binding protein; structural genomics, riken st 98.55
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.54
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 98.5
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.5
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 98.48
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.47
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 98.42
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.42
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 98.42
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.36
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.33
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.32
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.31
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.31
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.16
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.12
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.04
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.03
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.0
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 97.96
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.87
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 97.82
1d1n_A99 Initiation factor 2; beta-barrel, gene regulation; 97.69
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.68
2crv_A120 IF-2MT, translation initiation factor IF-2; riboso 97.66
1jal_A363 YCHF protein; nucleotide-binding fold, structural 97.6
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 97.57
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 97.52
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 97.4
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 97.31
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.31
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 97.17
2hf9_A226 Probable hydrogenase nickel incorporation protein 96.97
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.93
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.93
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 96.87
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 96.69
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.68
3izy_P537 Translation initiation factor IF-2, mitochondrial; 96.57
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 96.06
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 96.02
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 95.6
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 95.43
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 95.21
2xxa_A433 Signal recognition particle protein; protein trans 95.18
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 95.14
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 95.1
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 95.0
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 94.89
3cwq_A209 Para family chromosome partitioning protein; alpha 94.48
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 93.65
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 93.59
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 93.45
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 93.33
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 93.22
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 92.85
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 92.8
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 92.65
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 92.57
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 92.0
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 91.92
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 91.41
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 91.26
1vma_A306 Cell division protein FTSY; TM0570, structural gen 90.16
3end_A307 Light-independent protochlorophyllide reductase ir 89.45
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 89.24
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 88.53
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 87.75
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 87.74
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 87.65
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 86.21
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 85.92
4he6_A89 Peptidase family U32; ultra-tight crystal packing, 85.15
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 85.05
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 84.91
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 83.99
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 83.75
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 83.31
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 82.62
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 81.71
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
Probab=100.00  E-value=9.3e-76  Score=575.33  Aligned_cols=373  Identities=56%  Similarity=0.942  Sum_probs=354.8

Q ss_pred             CceecCCCHHHHhhcceeeccceeeeecCcEEEEEeCCCCCChHHHHHHhhhhcCEEEEEEECCCCccccccccCCchHH
Q 016750            1 MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTRE   80 (383)
Q Consensus         1 ~a~~~D~~~~E~~rG~Ti~~~~~~~~~~~~~i~liDtPG~~~~~~~~~~~~~~ad~~ilvvda~~g~~~~~~~~~~~~~~   80 (383)
                      |||++|..++||+||+|++..+..+++++++++|||||||++|.++|..+++.+|++|||||+++|.++++|+..+|+++
T Consensus        66 ~a~~~d~~~~er~~GiTid~~~~~~~~~~~~~~iiDTPGh~~f~~~~~~~~~~aD~~ilVVDa~~g~~e~~~~~~~qt~e  145 (439)
T 3j2k_7           66 LSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTRE  145 (439)
T ss_pred             hhhhhccchhHhhcCceEEEeEEEEecCCeEEEEEECCChHHHHHHHHhhHhhCCEEEEEEECCCCccccccCCCchHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999888887889999


Q ss_pred             HHHHHHHcCCCeEEEEEecCCCCCCCccHHHHHHHHHHHHHHHHhcCCCCCCCceEEEccccccccccccccCCCCCCCC
Q 016750           81 HVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWN  160 (383)
Q Consensus        81 ~~~~~~~~~i~~~ivviNK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~iSa~~g~~i~~~~~~~~~~w~~  160 (383)
                      |+..+..+++|++|+++||||++..+|++.+++++.+++..+++.+++.+..+++++|+||++|.|+.++.+  .++||.
T Consensus       146 ~l~~~~~~~v~~iIvviNK~Dl~~~~~~~~~~~~i~~~~~~~l~~~g~~~~~~~~~i~iSA~~G~ni~~l~~--~~~w~~  223 (439)
T 3j2k_7          146 HAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSD--FCPWYI  223 (439)
T ss_pred             HHHHHHHcCCCeEEEEeecCCCcccchHHHHHHHHHHHHHHHHHHhcccccCCeeEEEeeccCCcccccccc--cccccC
Confidence            999999999998999999999976778888999999999999999998644467899999999999999876  589999


Q ss_pred             cccHHHHhhccCCCCCCCCCCeeEEEEEEEccCCeEEEEEEEEeEEecCCEEEEecCCcEEEEEEEEECCccceecCCCC
Q 016750          161 GPCLFEALDRIEITPRDPNGPFRMPIIDKFKDMGTVVMGKVESGSVREGDSLLVMPNKAQVKVLAIYCDDNRVRHAGPGE  240 (383)
Q Consensus       161 g~~L~~~l~~~~~~~~~~~~p~~~~I~~~~~~~G~vv~G~V~sG~l~~gd~v~i~p~~~~~~V~sI~~~~~~v~~a~aG~  240 (383)
                      |++|++.|+.++++.+..++|++|+|+++|++.|++++|+|.+|+|++||.|.++|.+..++|++|+++++++++|.|||
T Consensus       224 g~~L~~~l~~i~~~~~~~~~p~r~~v~~~~~~~G~v~~G~v~~G~l~~Gd~v~~~p~~~~~~V~~i~~~~~~~~~a~aG~  303 (439)
T 3j2k_7          224 GLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGE  303 (439)
T ss_pred             chHHHHHHHhCCCCccCCCCCeEEEEEEEEcCCCeEEEEEEEeeEEecCCEEEEccCCceEEEEEEEECCeEcCEecCCC
Confidence            99999999999988888899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEEecCCccCceeeEEEecCCCCcccccEEEEEEEEeccccc-ccccCCcEEEEEEeeeEEEEEEEEEEEEeecCCC
Q 016750          241 NLRIRLSGIEEEDILSGFVLSSVAKPVAAVTEFIAQLQILELLDN-AIFTAGYKAVLHIHAVVEECEIVELLHQIDLKTK  319 (383)
Q Consensus       241 ~v~l~l~g~~~~~i~~G~vl~~~~~~~~~~~~f~a~i~~~~~~~~-~~i~~g~~~~~~~~~~~~~~~i~~i~~~~d~~~~  319 (383)
                      +|+++|+|++..++++|++|++++.+++.++.|+|++.|   +++ +++..||++.+|+|+.+++|+|..|.+++|.+||
T Consensus       304 ~v~~~l~gi~~~~i~rG~vl~~~~~~~~~~~~f~a~v~~---l~~~~~i~~g~~~~~~~~t~~~~~~i~~i~~~~d~~t~  380 (439)
T 3j2k_7          304 NLKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVI---IEHKSIICPGYNAVLHIHTCIEEVEITALISLVDKKSG  380 (439)
T ss_pred             cceEEEeccchhhcCCcEEecCCCCCCceeeEEEEEEEE---eCCCCcCCCCCEEEEEEeceEEEEEEEEEEEeecCCch
Confidence            999999999999999999999999888889999999999   666 5699999999999999999999999999999999


Q ss_pred             cccccccccccCCCEEEEEEEECceEEeeeccCccccceEEEEeCCcEEEEEEEEEcCC
Q 016750          320 KPMKKKVLFVKNGAIVVCRIQVNNSICTEKFADFAQLGRFTLRTEGKTVAVGKVTELPT  378 (383)
Q Consensus       320 ~~~~~~~~~l~~g~~~~v~~~~~~pi~~~~~~~~~~lgr~ilr~~~~tvg~G~V~~~~~  378 (383)
                      +..+.+|++|+.||.+.|+|++.+|+|+|+|++++.+|||+|||+|+|+|+|+|+++.+
T Consensus       381 ~~~~~~~~~l~~~~~~~v~~~~~~p~~~e~~~~~~~~g~f~l~d~~~tv~~G~i~~v~~  439 (439)
T 3j2k_7          381 EKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVQ  439 (439)
T ss_pred             hhhccCcceecCCcEEEEEEEeCCeEEEeeccccccCCCEEEEECCceEEEEEEEEecC
Confidence            98888999999999999999999999999999999999999999999999999999863
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2crv_A IF-2MT, translation initiation factor IF-2; ribosome, beta barrel, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>4he6_A Peptidase family U32; ultra-tight crystal packing, unknown function; 1.10A {Geobacillus thermoleovorans} PDB: 4he5_A Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 383
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 7e-55
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 1e-43
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 6e-37
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 4e-35
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 2e-32
d1f60a2107 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, 7e-30
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 2e-27
d1jnya2107 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, 7e-26
d1r5ba195 b.43.3.1 (A:460-554) Eukaryotic peptide chain rele 6e-25
d2c78a1100 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), 8e-20
d1wb1a192 b.43.3.1 (A:180-271) Elongation factor SelB, domai 2e-19
d1d2ea198 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), 5e-19
d1efca192 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), 3e-18
d1f60a194 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, 2e-17
d1jnya195 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, 1e-16
d1r5ba268 b.44.1.1 (A:555-622) Eukaryotic peptide chain rele 6e-14
d1xe1a_91 b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococ 2e-13
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 3e-13
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 5e-12
d1zunb192 b.43.3.1 (B:238-329) Sulfate adenylate transferase 9e-12
d1zunb2105 b.44.1.1 (B:330-434) Sulfate adenylate transferase 7e-11
d1kk1a1121 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma 1e-10
d2qn6a1114 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma 1e-09
d1s0ua1118 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma 1e-09
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 5e-08
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 6e-08
d1g7sa2128 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, 4e-07
d2c78a293 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) 2e-06
d2dy1a1103 b.43.3.1 (A:275-377) Elongation factor G (EF-G), d 8e-04
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor eEF-1alpha, N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  179 bits (454), Expect = 7e-55
 Identities = 79/189 (41%), Positives = 110/189 (58%), Gaps = 17/189 (8%)

Query: 1   MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLV 60
            A+++D  + ER +G T+++    FET   + T++DAPGH+ ++ NMI+G SQAD  +L+
Sbjct: 55  YAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILI 114

Query: 61  ISARKGEFETGFEKGGQTREHVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMT 120
           I+   GEFE G  K GQTREH +LA TLGV +L++ VNKMD  +V W + R+ EI  + +
Sbjct: 115 IAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMD--SVKWDESRFQEIVKETS 172

Query: 121 PFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWW------------NGPCLFEAL 168
            F+K  GYN  K V F+PISG  G NM         PW+             G  L EA+
Sbjct: 173 NFIKKVGYN-PKTVPFVPISGWNGDNMIEATTN--APWYKGWEKETKAGVVKGKTLLEAI 229

Query: 169 DRIEITPRD 177
           D IE   R 
Sbjct: 230 DAIEQPSRP 238
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 107 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 107 Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 95 Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Length = 100 Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Length = 92 Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Length = 92 Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 94 Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 95 Back     information, alignment and structure
>d1r5ba2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 68 Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Length = 91 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 92 Back     information, alignment and structure
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 105 Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 121 Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Length = 114 Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 118 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 128 Back     information, alignment and structure
>d2c78a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} Length = 93 Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query383
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 100.0
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 100.0
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 100.0
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 100.0
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.97
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.96
d1f60a2107 Elongation factor eEF-1alpha, C-terminal domain {B 99.94
d1jnya2107 Elongation factor eEF-1alpha, C-terminal domain {A 99.93
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 99.88
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.87
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.87
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.86
d1zunb2105 Sulfate adenylate transferase subunit cysN/C, EF-T 99.85
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.85
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 99.85
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 99.84
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 99.84
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 99.82
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 99.82
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.81
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 99.79
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.79
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 99.78
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 99.76
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 99.75
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 99.74
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.74
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 99.62
d1d2ea2103 Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mi 99.61
d2c78a293 Elongation factor Tu (EF-Tu) {Thermus thermophilus 99.58
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.45
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.42
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.39
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 99.33
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.33
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.27
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 99.19
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.19
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.19
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1r5ba268 Eukaryotic peptide chain release factor ERF2, C-te 99.16
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.15
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.14
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.13
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.12
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.1
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.09
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.08
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.07
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.06
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.06
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 99.05
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.02
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.0
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.0
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.0
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.99
d1n0ua1138 Elongation factor 2 (eEF-2), domain II {Baker's ye 98.99
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.98
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.96
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.94
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.93
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.92
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.92
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.91
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.91
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.9
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.9
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.85
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.83
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.79
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.77
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.72
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.69
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.66
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.62
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.61
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.58
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.58
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.54
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.52
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.38
d2fh5b1207 Signal recognition particle receptor beta-subunit 98.38
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.28
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.25
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.2
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.17
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.11
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.09
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.08
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.9
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.87
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.77
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 97.72
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 97.72
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 97.44
d1kk1a289 Initiation factor eIF2 gamma subunit {Archaeon Pyr 97.14
d2qn6a295 Initiation factor eIF2 gamma subunit {Sulfolobus s 96.9
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.82
d1s0ua290 Initiation factor eIF2 gamma subunit {Archaeon Met 96.78
d1g7sa1101 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 96.62
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.34
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.31
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.17
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.71
d1okkd2207 GTPase domain of the signal recognition particle r 95.63
d1vmaa2213 GTPase domain of the signal recognition particle r 95.51
d1wb1a3116 Elongation factor SelB, domain 3 {Methanococcus ma 95.28
d2qy9a2211 GTPase domain of the signal recognition particle r 95.26
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.91
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 93.69
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 92.06
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 84.76
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 80.95
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor eEF-1alpha, N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=3.1e-38  Score=281.61  Aligned_cols=173  Identities=46%  Similarity=0.800  Sum_probs=160.4

Q ss_pred             CceecCCCHHHHhhcceeeccceeeeecCcEEEEEeCCCCCChHHHHHHhhhhcCEEEEEEECCCCccccccccCCchHH
Q 016750            1 MAYIMDTNEEERIKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGFEKGGQTRE   80 (383)
Q Consensus         1 ~a~~~D~~~~E~~rG~Ti~~~~~~~~~~~~~i~liDtPG~~~~~~~~~~~~~~ad~~ilvvda~~g~~~~~~~~~~~~~~   80 (383)
                      |+|+||.+++||+||+|++.+...|+|++++++|+|||||.+|.++|++|++.+|+|||||||..|++|.++..++||++
T Consensus        55 ~~~~~D~~~~Er~rGiTi~~~~~~~~~~~~~i~iiDtPGH~df~~~~~~g~~~~D~ailvvda~~G~~e~g~~~~~QT~e  134 (239)
T d1f60a3          55 YAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTRE  134 (239)
T ss_dssp             HHHHHHHHHHHHHTTCCCSCSCEEEECSSEEEEEEECCCCTTHHHHHHHSSSCCSEEEEEEECSHHHHHHHTCTTSHHHH
T ss_pred             eeeecccchhhhcceeccccceeEeccCCEEEEEEECCCcHHHHHHHHHHHHHhCEEEEEEECCCCccccccCchHhHHH
Confidence            57999999999999999999999999999999999999999999999999999999999999999999988887899999


Q ss_pred             HHHHHHHcCCCeEEEEEecCCCCCCCccHHHHHHHHHHHHHHHHhcCCCCCCCceEEEccccccccccccccCCCCCCCC
Q 016750           81 HVMLAKTLGVTKLLLVVNKMDDHTVNWSKERYDEIESKMTPFLKASGYNVKKDVQFLPISGLMGLNMKTRVDKSLCPWWN  160 (383)
Q Consensus        81 ~~~~~~~~~i~~~ivviNK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~iSa~~g~~i~~~~~~~~~~w~~  160 (383)
                      |+.+++.+|+|++||++||||+  .+|++++|+++.+++..++...++.+ ..++++|+||++|.|+.+...  .++||+
T Consensus       135 h~~~~~~~gv~~iiv~iNKmD~--~~~d~~~~~~~~~el~~~l~~~~~~~-~~i~~ipiSa~~G~ni~~~s~--~~~wyk  209 (239)
T d1f60a3         135 HALLAFTLGVRQLIVAVNKMDS--VKWDESRFQEIVKETSNFIKKVGYNP-KTVPFVPISGWNGDNMIEATT--NAPWYK  209 (239)
T ss_dssp             HHHHHHHTTCCEEEEEEECGGG--GTTCHHHHHHHHHHHHHHHHHHTCCG-GGCCEEECCTTTCBTTTBCCS--SCTTCC
T ss_pred             HHHHHHHcCCCeEEEEEECCCC--CCCCHHHHHHHHHHHHHHHHhcCCCC-CcEEEEEEEccCCCcceeccc--cCcccc
Confidence            9999999999999999999999  78889999999999999999998874 357899999999999998765  489996


Q ss_pred             c------------ccHHHHhhccCCCCCCC
Q 016750          161 G------------PCLFEALDRIEITPRDP  178 (383)
Q Consensus       161 g------------~~L~~~l~~~~~~~~~~  178 (383)
                      |            ++|+++|+.+++|.+++
T Consensus       210 g~~~~~~~~~~~~~TLlEaLD~I~~P~R~t  239 (239)
T d1f60a3         210 GWEKETKAGVVKGKTLLEAIDAIEQPSRPT  239 (239)
T ss_dssp             CEEEECSSSEEEESSHHHHHHTSCCCCCCT
T ss_pred             CcccccccCccccccHHHHhhCCCCCCCCC
Confidence            5            79999999999887753
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea2 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2c78a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s0ua2 b.44.1.1 (A:348-437) Initiation factor eIF2 gamma subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a3 b.44.1.1 (A:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure