Citrus Sinensis ID: 016772
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 383 | 2.2.26 [Sep-21-2011] | |||||||
| Q9SKX5 | 490 | Probable polyamine oxidas | yes | no | 0.968 | 0.757 | 0.822 | 0.0 | |
| Q9LYT1 | 488 | Polyamine oxidase 3 OS=Ar | no | no | 0.960 | 0.754 | 0.797 | 1e-172 | |
| Q8H191 | 497 | Probable polyamine oxidas | no | no | 0.968 | 0.746 | 0.610 | 1e-133 | |
| Q6YYZ1 | 763 | Lysine-specific histone d | no | no | 0.864 | 0.433 | 0.338 | 9e-40 | |
| Q9LID0 | 746 | Lysine-specific histone d | no | no | 0.744 | 0.382 | 0.360 | 2e-38 | |
| Q9CAE3 | 789 | Lysine-specific histone d | no | no | 0.840 | 0.408 | 0.331 | 8e-36 | |
| Q6ZQ88 | 853 | Lysine-specific histone d | yes | no | 0.699 | 0.314 | 0.343 | 2e-35 | |
| O60341 | 852 | Lysine-specific histone d | yes | no | 0.699 | 0.314 | 0.343 | 2e-35 | |
| Q6Z690 | 849 | Lysine-specific histone d | no | no | 0.882 | 0.398 | 0.307 | 1e-34 | |
| Q8VXV7 | 844 | Lysine-specific histone d | no | no | 0.859 | 0.389 | 0.323 | 3e-32 |
| >sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 649 bits (1673), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 305/371 (82%), Positives = 336/371 (90%)
Query: 13 SYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRL 72
SYALFDMDGNQVPQELVT++G FE IL+E +KVR+E D D+SI +A SIVF R+PELRL
Sbjct: 120 SYALFDMDGNQVPQELVTQIGVTFERILEEINKVRDEQDADISISQAFSIVFSRKPELRL 179
Query: 73 EGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLD 132
EGLAH VLQWY+CRMEGWFAADAETIS K WD+EELLPGGHGLMVRGY PVINTLAKGLD
Sbjct: 180 EGLAHNVLQWYVCRMEGWFAADAETISAKCWDQEELLPGGHGLMVRGYRPVINTLAKGLD 239
Query: 133 IRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAI 192
IR+GHRVTKI R Y GVKVT E G+TFVADA V+AVPLGVLK+ TIKFEP+LP+WK+ AI
Sbjct: 240 IRVGHRVTKIVRRYNGVKVTTENGQTFVADAAVIAVPLGVLKSGTIKFEPKLPEWKQEAI 299
Query: 193 DDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLA 252
+DLGVGIENKII+HF+KVFWP VEFLGVV++TSYGCSYFLNLHKATGH VLVYMPAGQLA
Sbjct: 300 NDLGVGIENKIILHFEKVFWPKVEFLGVVAETSYGCSYFLNLHKATGHPVLVYMPAGQLA 359
Query: 253 RDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYE 312
+DIEKMSDEAAANFA QL++ILPDA P+QYLVS WG+D NS+GSYSYD VGK HDLYE
Sbjct: 360 KDIEKMSDEAAANFAVLQLQRILPDALPPVQYLVSRWGSDVNSMGSYSYDIVGKPHDLYE 419
Query: 313 RLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEET 372
RLR+PVDNLFFAGEATS S+PGSVHGA+STGLMAAEDCRMRVLERYGELDLFQPVMGEE
Sbjct: 420 RLRVPVDNLFFAGEATSSSFPGSVHGAYSTGLMAAEDCRMRVLERYGELDLFQPVMGEEG 479
Query: 373 PISVPFLISRL 383
P SVP LISRL
Sbjct: 480 PASVPLLISRL 490
|
Flavoenzyme that catalyzes the oxidation of the secondary amino group of polyamines. Arabidopsis thaliana (taxid: 3702) EC: 1EC: .EC: 5EC: .EC: 3EC: .EC: - |
| >sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9CAE3|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 383 | ||||||
| 255561152 | 491 | amine oxidase, putative [Ricinus communi | 0.968 | 0.755 | 0.870 | 0.0 | |
| 224082614 | 482 | predicted protein [Populus trichocarpa] | 0.968 | 0.769 | 0.868 | 0.0 | |
| 356567482 | 490 | PREDICTED: probable polyamine oxidase 2- | 0.968 | 0.757 | 0.832 | 0.0 | |
| 224066525 | 513 | predicted protein [Populus trichocarpa] | 0.968 | 0.723 | 0.814 | 0.0 | |
| 225446763 | 490 | PREDICTED: probable polyamine oxidase 2 | 0.968 | 0.757 | 0.827 | 0.0 | |
| 15224204 | 490 | putative polyamine oxidase 2 [Arabidopsi | 0.968 | 0.757 | 0.822 | 0.0 | |
| 297824269 | 490 | ATPAO2 [Arabidopsis lyrata subsp. lyrata | 0.968 | 0.757 | 0.822 | 0.0 | |
| 18650598 | 490 | At2g43020/MFL8.12 [Arabidopsis thaliana] | 0.968 | 0.757 | 0.819 | 0.0 | |
| 449463595 | 489 | PREDICTED: probable polyamine oxidase 2- | 0.966 | 0.756 | 0.803 | 0.0 | |
| 356526932 | 490 | PREDICTED: probable polyamine oxidase 2- | 0.968 | 0.757 | 0.805 | 0.0 |
| >gi|255561152|ref|XP_002521588.1| amine oxidase, putative [Ricinus communis] gi|223539266|gb|EEF40859.1| amine oxidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 681 bits (1756), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 323/371 (87%), Positives = 345/371 (92%)
Query: 13 SYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRL 72
SYALFDMDGNQVPQELV++VGE FE ILKET+KVR+E+ EDMSI A SIVF+RRPELRL
Sbjct: 121 SYALFDMDGNQVPQELVSEVGETFEIILKETEKVRQEYSEDMSISNAFSIVFERRPELRL 180
Query: 73 EGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLD 132
EGLAHKVLQWYLCRMEGWFAADA+TISLK WD+EELLPGGHGLMVRGYLPVINTLAKGLD
Sbjct: 181 EGLAHKVLQWYLCRMEGWFAADADTISLKCWDQEELLPGGHGLMVRGYLPVINTLAKGLD 240
Query: 133 IRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAI 192
IRLGHRVTKI R + GVKVT E G+TF+ADA V+AVPLGVLK+RTI FEPRLPDWKE AI
Sbjct: 241 IRLGHRVTKIVRRHNGVKVTTEDGRTFMADAAVIAVPLGVLKSRTITFEPRLPDWKEEAI 300
Query: 193 DDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLA 252
DLGVGIENKI++HFDKVFWPNVEFLGVVS+TSYGCSYFLNLHKATGH VLVYMPAGQLA
Sbjct: 301 KDLGVGIENKIVLHFDKVFWPNVEFLGVVSETSYGCSYFLNLHKATGHSVLVYMPAGQLA 360
Query: 253 RDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYE 312
+DIEKMSDEAAANFAF QLKKILP+AS PIQYLVS WG+D NSLGSYSYDTVGK HDLYE
Sbjct: 361 KDIEKMSDEAAANFAFMQLKKILPEASDPIQYLVSRWGSDVNSLGSYSYDTVGKPHDLYE 420
Query: 313 RLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEET 372
RLR+PVDNLFFAGEATS SYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEE
Sbjct: 421 RLRVPVDNLFFAGEATSASYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEEA 480
Query: 373 PISVPFLISRL 383
+SVP LISR+
Sbjct: 481 AVSVPLLISRM 491
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224082614|ref|XP_002306765.1| predicted protein [Populus trichocarpa] gi|222856214|gb|EEE93761.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356567482|ref|XP_003551948.1| PREDICTED: probable polyamine oxidase 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224066525|ref|XP_002302123.1| predicted protein [Populus trichocarpa] gi|222843849|gb|EEE81396.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225446763|ref|XP_002282970.1| PREDICTED: probable polyamine oxidase 2 [Vitis vinifera] gi|302143503|emb|CBI22064.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15224204|ref|NP_181830.1| putative polyamine oxidase 2 [Arabidopsis thaliana] gi|75206576|sp|Q9SKX5.1|PAO2_ARATH RecName: Full=Probable polyamine oxidase 2; Short=AtPAO2; AltName: Full=Amine oxidase 1 gi|29468124|gb|AAO85404.1|AF364952_1 putative amine oxidase 1 [Arabidopsis thaliana] gi|4531444|gb|AAD22129.1| putative amine oxidase [Arabidopsis thaliana] gi|115311507|gb|ABI93934.1| At2g43020 [Arabidopsis thaliana] gi|330255105|gb|AEC10199.1| putative polyamine oxidase 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297824269|ref|XP_002880017.1| ATPAO2 [Arabidopsis lyrata subsp. lyrata] gi|297325856|gb|EFH56276.1| ATPAO2 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18650598|gb|AAL75899.1| At2g43020/MFL8.12 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449463595|ref|XP_004149519.1| PREDICTED: probable polyamine oxidase 2-like [Cucumis sativus] gi|449505802|ref|XP_004162572.1| PREDICTED: probable polyamine oxidase 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356526932|ref|XP_003532069.1| PREDICTED: probable polyamine oxidase 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 383 | ||||||
| TAIR|locus:2053723 | 490 | PAO2 "AT2G43020" [Arabidopsis | 0.968 | 0.757 | 0.822 | 2.2e-167 | |
| TAIR|locus:2077670 | 488 | PAO3 "polyamine oxidase 3" [Ar | 0.960 | 0.754 | 0.797 | 7.7e-158 | |
| TAIR|locus:2018571 | 497 | PAO4 "polyamine oxidase 4" [Ar | 0.968 | 0.746 | 0.610 | 2.4e-122 | |
| TAIR|locus:2130454 | 1628 | LDL3 "LSD1-like 3" [Arabidopsi | 0.798 | 0.187 | 0.353 | 1.1e-44 | |
| TAIR|locus:2091501 | 746 | LDL2 "LSD1-like2" [Arabidopsis | 0.900 | 0.462 | 0.341 | 3.3e-38 | |
| UNIPROTKB|F1LVQ3 | 735 | Kdm1 "Protein Kdm1" [Rattus no | 0.791 | 0.412 | 0.334 | 1.6e-37 | |
| UNIPROTKB|F1NDF4 | 755 | KDM1A "Uncharacterized protein | 0.791 | 0.401 | 0.334 | 1.9e-37 | |
| RGD|1562975 | 755 | Kdm1a "lysine (K)-specific dem | 0.791 | 0.401 | 0.334 | 1.9e-37 | |
| UNIPROTKB|F1STX7 | 853 | KDM1A "Uncharacterized protein | 0.851 | 0.382 | 0.326 | 3e-37 | |
| UNIPROTKB|F1STX8 | 873 | KDM1A "Uncharacterized protein | 0.851 | 0.373 | 0.326 | 3.3e-37 |
| TAIR|locus:2053723 PAO2 "AT2G43020" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1628 (578.1 bits), Expect = 2.2e-167, P = 2.2e-167
Identities = 305/371 (82%), Positives = 336/371 (90%)
Query: 13 SYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRL 72
SYALFDMDGNQVPQELVT++G FE IL+E +KVR+E D D+SI +A SIVF R+PELRL
Sbjct: 120 SYALFDMDGNQVPQELVTQIGVTFERILEEINKVRDEQDADISISQAFSIVFSRKPELRL 179
Query: 73 EGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLD 132
EGLAH VLQWY+CRMEGWFAADAETIS K WD+EELLPGGHGLMVRGY PVINTLAKGLD
Sbjct: 180 EGLAHNVLQWYVCRMEGWFAADAETISAKCWDQEELLPGGHGLMVRGYRPVINTLAKGLD 239
Query: 133 IRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAI 192
IR+GHRVTKI R Y GVKVT E G+TFVADA V+AVPLGVLK+ TIKFEP+LP+WK+ AI
Sbjct: 240 IRVGHRVTKIVRRYNGVKVTTENGQTFVADAAVIAVPLGVLKSGTIKFEPKLPEWKQEAI 299
Query: 193 DDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLA 252
+DLGVGIENKII+HF+KVFWP VEFLGVV++TSYGCSYFLNLHKATGH VLVYMPAGQLA
Sbjct: 300 NDLGVGIENKIILHFEKVFWPKVEFLGVVAETSYGCSYFLNLHKATGHPVLVYMPAGQLA 359
Query: 253 RDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYE 312
+DIEKMSDEAAANFA QL++ILPDA P+QYLVS WG+D NS+GSYSYD VGK HDLYE
Sbjct: 360 KDIEKMSDEAAANFAVLQLQRILPDALPPVQYLVSRWGSDVNSMGSYSYDIVGKPHDLYE 419
Query: 313 RLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEET 372
RLR+PVDNLFFAGEATS S+PGSVHGA+STGLMAAEDCRMRVLERYGELDLFQPVMGEE
Sbjct: 420 RLRVPVDNLFFAGEATSSSFPGSVHGAYSTGLMAAEDCRMRVLERYGELDLFQPVMGEEG 479
Query: 373 PISVPFLISRL 383
P SVP LISRL
Sbjct: 480 PASVPLLISRL 490
|
|
| TAIR|locus:2077670 PAO3 "polyamine oxidase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018571 PAO4 "polyamine oxidase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130454 LDL3 "LSD1-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091501 LDL2 "LSD1-like2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LVQ3 Kdm1 "Protein Kdm1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDF4 KDM1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1562975 Kdm1a "lysine (K)-specific demethylase 1A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STX7 KDM1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STX8 KDM1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9SKX5 | PAO2_ARATH | 1, ., 5, ., 3, ., - | 0.8221 | 0.9686 | 0.7571 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.5.3 | 0.976 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | estExt_fgenesh4_pm.C_LG_V0482 | polyamine oxidase (EC-1.5.3.11) (483 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 383 | |||
| PLN02268 | 435 | PLN02268, PLN02268, probable polyamine oxidase | 0.0 | |
| pfam01593 | 444 | pfam01593, Amino_oxidase, Flavin containing amine | 2e-64 | |
| PLN02976 | 1713 | PLN02976, PLN02976, amine oxidase | 2e-58 | |
| PLN02529 | 738 | PLN02529, PLN02529, lysine-specific histone demeth | 1e-46 | |
| PLN03000 | 881 | PLN03000, PLN03000, amine oxidase | 8e-42 | |
| PLN02328 | 808 | PLN02328, PLN02328, lysine-specific histone demeth | 5e-38 | |
| PLN02676 | 487 | PLN02676, PLN02676, polyamine oxidase | 1e-35 | |
| PLN02568 | 539 | PLN02568, PLN02568, polyamine oxidase | 2e-31 | |
| COG1231 | 450 | COG1231, COG1231, Monoamine oxidase [Amino acid tr | 1e-25 | |
| COG1232 | 444 | COG1232, HemY, Protoporphyrinogen oxidase [Coenzym | 5e-13 | |
| PRK07233 | 434 | PRK07233, PRK07233, hypothetical protein; Provisio | 8e-08 | |
| PLN02612 | 567 | PLN02612, PLN02612, phytoene desaturase | 4e-06 | |
| TIGR02731 | 453 | TIGR02731, phytoene_desat, phytoene desaturase | 6e-05 | |
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 3e-04 | |
| PRK11883 | 451 | PRK11883, PRK11883, protoporphyrinogen oxidase; Re | 3e-04 | |
| PRK06416 | 462 | PRK06416, PRK06416, dihydrolipoamide dehydrogenase | 7e-04 | |
| TIGR03467 | 411 | TIGR03467, HpnE, squalene-associated FAD-dependent | 0.002 |
| >gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase | Back alignment and domain information |
|---|
Score = 719 bits (1859), Expect = 0.0
Identities = 283/343 (82%), Positives = 310/343 (90%)
Query: 13 SYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRL 72
SYALFDMDGNQVPQELVTKVGE FE IL+ET+KVR+EH+EDMS+ +AISIV +R PELRL
Sbjct: 93 SYALFDMDGNQVPQELVTKVGETFERILEETEKVRDEHEEDMSLLQAISIVLERHPELRL 152
Query: 73 EGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLD 132
EGLAH+VLQWYLCRMEGWFAADA+TISLKSWD+EELL GGHGLMVRGY PVINTLAKGLD
Sbjct: 153 EGLAHEVLQWYLCRMEGWFAADADTISLKSWDQEELLEGGHGLMVRGYDPVINTLAKGLD 212
Query: 133 IRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAI 192
IRL HRVTKI R Y GVKVTVE G TFVADA ++AVPLGVLKA IKFEP LP+WKE AI
Sbjct: 213 IRLNHRVTKIVRRYNGVKVTVEDGTTFVADAAIIAVPLGVLKANIIKFEPELPEWKEEAI 272
Query: 193 DDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLA 252
DLGVGIENKI +HFD VFWPNVEFLGVV+ TSYGCSYFLNLHKATGH VLVYMPAG+LA
Sbjct: 273 SDLGVGIENKIALHFDSVFWPNVEFLGVVAPTSYGCSYFLNLHKATGHPVLVYMPAGRLA 332
Query: 253 RDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYE 312
RDIEK+SDEAAANFA +QLKK+LPDA+ P+QYLVS WG+D NSLG YSYD VGK HDLYE
Sbjct: 333 RDIEKLSDEAAANFAMSQLKKMLPDATEPVQYLVSRWGSDPNSLGCYSYDLVGKPHDLYE 392
Query: 313 RLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVL 355
RLR PVDNLFFAGEATS +PGSVHGA+STG+MAAE+CRMR+L
Sbjct: 393 RLRAPVDNLFFAGEATSSDFPGSVHGAYSTGVMAAEECRMRLL 435
|
Length = 435 |
| >gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|215527 PLN02976, PLN02976, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|178578 PLN03000, PLN03000, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 383 | |||
| PLN02268 | 435 | probable polyamine oxidase | 100.0 | |
| PLN02976 | 1713 | amine oxidase | 100.0 | |
| PLN03000 | 881 | amine oxidase | 100.0 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 100.0 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 100.0 | |
| PLN02676 | 487 | polyamine oxidase | 100.0 | |
| PLN02568 | 539 | polyamine oxidase | 100.0 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 100.0 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 100.0 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 100.0 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 99.97 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 99.96 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 99.96 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 99.96 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 99.95 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 99.95 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 99.95 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 99.93 | |
| PLN02612 | 567 | phytoene desaturase | 99.93 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 99.92 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 99.89 | |
| PLN02487 | 569 | zeta-carotene desaturase | 99.87 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 99.86 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 99.82 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 99.8 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 99.79 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 99.72 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 99.71 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 99.36 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 99.23 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 99.13 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 98.65 | |
| PF07156 | 368 | Prenylcys_lyase: Prenylcysteine lyase; InterPro: I | 98.26 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 98.13 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 98.02 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 97.48 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 97.32 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 97.04 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 97.0 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 97.0 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 96.97 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.95 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.91 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 96.89 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 96.78 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 96.72 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 96.56 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 96.52 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.5 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 96.36 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 96.34 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 96.31 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 96.3 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 96.17 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 96.16 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 95.89 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 95.78 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 95.68 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 95.56 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 95.51 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 95.48 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 95.4 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 95.37 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 95.17 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 95.05 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 95.01 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 94.94 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 94.8 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 94.78 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 94.66 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 94.64 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 94.47 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 94.27 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 93.85 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 93.34 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 93.24 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 93.23 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 93.22 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 92.74 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 92.73 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 92.3 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 92.17 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 91.92 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 91.71 | |
| PRK05868 | 372 | hypothetical protein; Validated | 91.66 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 91.53 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 91.5 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 91.24 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 90.61 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 90.58 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 90.52 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 90.4 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 90.33 | |
| PRK06116 | 450 | glutathione reductase; Validated | 90.11 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 90.11 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 90.02 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 89.95 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 89.78 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 89.44 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 89.33 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 89.27 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 89.18 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 88.99 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 88.98 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 88.62 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 88.61 | |
| PLN02507 | 499 | glutathione reductase | 88.55 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 88.36 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 88.05 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 87.88 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 87.87 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 87.38 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 87.37 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 87.29 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 87.19 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 87.03 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 87.01 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 86.74 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 85.89 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 84.64 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 84.42 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 84.14 | |
| PLN02463 | 447 | lycopene beta cyclase | 84.1 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 83.92 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 83.82 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 83.71 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 83.34 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 83.13 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 83.12 | |
| COG0562 | 374 | Glf UDP-galactopyranose mutase [Cell envelope biog | 83.09 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 83.03 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 82.7 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 82.38 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 82.05 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 81.79 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 81.54 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 81.35 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 81.3 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 81.3 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 81.3 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 80.41 | |
| PF03275 | 204 | GLF: UDP-galactopyranose mutase; InterPro: IPR0158 | 80.27 |
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.3e-48 Score=377.32 Aligned_cols=342 Identities=82% Similarity=1.333 Sum_probs=293.2
Q ss_pred ceeEEcCCCCccCHHHHHHHHHHHHHHHHHHHHHHhhCCCCCcHHHHHHHHHccCchhhhhhHHHHHHHHHHHhhhhhcC
Q 016772 13 SYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFA 92 (383)
Q Consensus 13 ~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~s~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 92 (383)
++.+++..++++|++....+...+..+++...+.......|+|+++++++++.+.+.++.++++++++++++.++.++++
T Consensus 93 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 172 (435)
T PLN02268 93 SYALFDMDGNQVPQELVTKVGETFERILEETEKVRDEHEEDMSLLQAISIVLERHPELRLEGLAHEVLQWYLCRMEGWFA 172 (435)
T ss_pred ccceecCCCCCCCHHHHHHHHHHHHHHHHHHHHHHhccCCCcCHHHHHHHHhhhCcccccchHHHHHHHHHHHHHHHHhC
Confidence 45566778889999888888777777776665543334568999999987765544344456888999888777788899
Q ss_pred CCCCccChhccccccccCCCceeccCChHHHHHHHHccCCcccCceeEEEEecCCeeEEEECCCcEEEcCEEEEecChHH
Q 016772 93 ADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGV 172 (383)
Q Consensus 93 ~~~~~~S~~~~~~~~~~~g~~~~~~gG~~~l~~~L~~~l~I~l~~~V~~I~~~~~~v~V~~~~G~~~~ad~VI~t~p~~~ 172 (383)
.+++++|+..+..+..+.|.+..+.+||++|+++|+++++|++|++|++|.+.+++|.|++.+|+++.||+||+|+|+++
T Consensus 173 ~~~~~ls~~~~~~~~~~~g~~~~~~~G~~~l~~~l~~~~~i~~~~~V~~i~~~~~~v~v~~~~g~~~~ad~VIva~P~~~ 252 (435)
T PLN02268 173 ADADTISLKSWDQEELLEGGHGLMVRGYDPVINTLAKGLDIRLNHRVTKIVRRYNGVKVTVEDGTTFVADAAIIAVPLGV 252 (435)
T ss_pred CChHhCchhhcCCccccCCCceeecCCHHHHHHHHhccCceeCCCeeEEEEEcCCcEEEEECCCcEEEcCEEEEecCHHH
Confidence 99999999887654445666778999999999999999999999999999999999999999998899999999999999
Q ss_pred HhcCCcccCCCCcHHHHHHHhhcCCcccceEEEEcCCCCCCCCCcceeecCCCCceeEeeeccCCCCCceEEEEecchhh
Q 016772 173 LKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLA 252 (383)
Q Consensus 173 l~~~~i~f~p~Lp~~~~~ai~~~~~~~~~kv~l~~~~~~w~~~~~~g~~~~~~~~~~~~~~~~~~~g~~~l~~~~~g~~a 252 (383)
|+...+.|.|+||+.++++++++.|++..|+++.|+++||++..++|.+.+....+.++.+.....+.++|++++.|+.+
T Consensus 253 l~~~~i~f~p~lp~~~~~ai~~~~~g~~~Kv~l~f~~~fw~~~~~~g~~~~~~~~~~~~~~~~~~~g~~~l~~~~~g~~a 332 (435)
T PLN02268 253 LKANIIKFEPELPEWKEEAISDLGVGIENKIALHFDSVFWPNVEFLGVVAPTSYGCSYFLNLHKATGHPVLVYMPAGRLA 332 (435)
T ss_pred HhcCcceecCCCCHHHHHHHHhCCccceeEEEEEeCCCCCCCCceeeccCCCCCCceEEEecccCCCCCEEEEEeccHHH
Confidence 98766889999999999999999999999999999999998767777766544445555555445567788899999988
Q ss_pred HHHhcCCHHHHHHHHHHHHHHhCCCCCCCcEEEEccCCCCCCCCCcCCCCCCCCChHHHHHHhCCCCCEEEeccccCCCC
Q 016772 253 RDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSY 332 (383)
Q Consensus 253 ~~~~~~~~ee~~~~v~~~L~~~~~~~~~~~~~~~~~W~~~~~~~g~y~~~~~g~~~~~~~~~~~p~~~l~faG~~~~~~~ 332 (383)
..+.+++++++++.++++|.++||...+|+.+.+++|..|||++|+|++..+|.....++.+++|+++||||||+|+..+
T Consensus 333 ~~~~~~~~~e~~~~v~~~L~~~~~~~~~p~~~~~~~W~~dp~~~G~~~~~~~g~~~~~~~~l~~p~~~l~FAGe~ts~~~ 412 (435)
T PLN02268 333 RDIEKLSDEAAANFAMSQLKKMLPDATEPVQYLVSRWGSDPNSLGCYSYDLVGKPHDLYERLRAPVDNLFFAGEATSSDF 412 (435)
T ss_pred HHHHhCCHHHHHHHHHHHHHHHcCCCCCccEEEecccCCCCCCCccCCCCCCCCCHHHHHHHhCCCCCeEEeeccCCCcc
Confidence 99999999999999999999999876789999999999999999999998999877778889999999999999999988
Q ss_pred CchhhHHHHHHHHHHHHHHHHH
Q 016772 333 PGSVHGAFSTGLMAAEDCRMRV 354 (383)
Q Consensus 333 ~g~v~gA~~SG~~aA~~i~~~l 354 (383)
.|+||||++||+|||++|++.|
T Consensus 413 ~g~~eGA~~sG~raA~~v~~~l 434 (435)
T PLN02268 413 PGSVHGAYSTGVMAAEECRMRL 434 (435)
T ss_pred cccHHHHHHHHHHHHHHHHHhh
Confidence 9999999999999999998764
|
|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF03275 GLF: UDP-galactopyranose mutase; InterPro: IPR015899 UDP-galactopyranose mutase (5 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 383 | ||||
| 2hko_A | 664 | Crystal Structure Of Lsd1 Length = 664 | 8e-37 | ||
| 2v1d_A | 730 | Structural Basis Of Lsd1-Corest Selectivity In Hist | 8e-37 | ||
| 2dw4_A | 660 | Crystal Structure Of Human Lsd1 At 2.3 A Resolution | 9e-37 | ||
| 2h94_A | 664 | Crystal Structure And Mechanism Of Human Lysine-Spe | 9e-37 | ||
| 2x0l_A | 734 | Crystal Structure Of A Neuro-Specific Splicing Vari | 9e-37 | ||
| 2iw5_A | 666 | Structural Basis For Corest-dependent Demethylation | 1e-36 | ||
| 2ejr_A | 662 | Lsd1-Tranylcypromine Complex Length = 662 | 1e-36 | ||
| 2xaf_A | 852 | Crystal Structure Of Lsd1-Corest In Complex With Pa | 2e-36 | ||
| 4gur_A | 776 | Crystal Structure Of Lsd2-npac With H3 In Space Gro | 3e-31 | ||
| 4gu1_A | 784 | Crystal Structure Of Lsd2 Length = 784 | 3e-31 | ||
| 4fwe_A | 796 | Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup | 3e-31 | ||
| 1b37_A | 472 | A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys | 4e-25 | ||
| 3kpf_A | 478 | X-Ray Structure Of The Mutant Lys300met Of Polyamin | 2e-24 | ||
| 4ech_A | 516 | Yeast Polyamine Oxidase Fms1, H67q Mutant Length = | 8e-12 | ||
| 1z6l_A | 516 | Crystal Structure Of Fms1 In Complex With Its Subst | 9e-12 | ||
| 4gdp_A | 516 | Yeast Polyamine Oxidase Fms1, N195a Mutant Length = | 1e-11 | ||
| 1yy5_A | 513 | Crystal Structure Of Fms1, A Polyamine Oxidase From | 1e-11 | ||
| 1rsg_A | 516 | Crystal Structure Of The Polyamine Oxidase Fms1 Fro | 4e-11 | ||
| 2bxr_A | 527 | Human Monoamine Oxidase A In Complex With Clorgylin | 4e-10 | ||
| 2z5x_A | 513 | Crystal Structure Of Human Monoamine Oxidase A With | 4e-10 | ||
| 2z5y_A | 513 | Crystal Structure Of Human Monoamine Oxidase A (G11 | 4e-10 | ||
| 3kve_A | 486 | Structure Of Native L-Amino Acid Oxidase From Viper | 1e-09 | ||
| 2c72_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 2e-09 | ||
| 1gos_A | 520 | Human Monoamine Oxidase B Length = 520 | 2e-09 | ||
| 2xfu_A | 519 | Human Monoamine Oxidase B With Tranylcypromine Leng | 2e-09 | ||
| 2c75_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 3e-09 | ||
| 2c73_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 3e-09 | ||
| 2c76_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 3e-09 | ||
| 2bk4_A | 520 | Human Monoamine Oxidase B: I199f Mutant In Complex | 5e-09 | ||
| 2xfo_A | 520 | Tranylcypromine-Inhibited Human Monoamine Oxidase B | 5e-09 | ||
| 4e0v_A | 497 | Structure Of L-Amino Acid Oxidase From The B. Jarar | 6e-09 | ||
| 1o5w_A | 534 | The Structure Basis Of Specific Recognitions For Su | 3e-08 | ||
| 3zyx_A | 519 | Crystal Structure Of Human Monoamine Oxidase B In C | 5e-08 | ||
| 1reo_A | 486 | L-Amino Acid Oxidase From Agkistrodon Halys Pallas | 1e-07 | ||
| 2yg7_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 6e-06 | ||
| 3k7m_X | 431 | Crystal Structure Of 6-Hydroxy-L-Nicotine Oxidase F | 1e-05 | ||
| 3k7t_A | 425 | Crystal Structure Of Apo-Form 6-Hydroxy-L-Nicotine | 1e-05 | ||
| 2yg3_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 3e-05 | ||
| 2yg6_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 5e-05 | ||
| 2yg5_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 5e-05 |
| >pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 | Back alignment and structure |
|
| >pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 | Back alignment and structure |
| >pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 | Back alignment and structure |
| >pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 | Back alignment and structure |
| >pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 | Back alignment and structure |
| >pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 | Back alignment and structure |
| >pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 | Back alignment and structure |
| >pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 | Back alignment and structure |
| >pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 | Back alignment and structure |
| >pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 | Back alignment and structure |
| >pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 | Back alignment and structure |
| >pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 | Back alignment and structure |
| >pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 | Back alignment and structure |
| >pdb|4ECH|A Chain A, Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 516 | Back alignment and structure |
| >pdb|1Z6L|A Chain A, Crystal Structure Of Fms1 In Complex With Its Substrate Length = 516 | Back alignment and structure |
| >pdb|4GDP|A Chain A, Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 516 | Back alignment and structure |
| >pdb|1YY5|A Chain A, Crystal Structure Of Fms1, A Polyamine Oxidase From Yeast Length = 513 | Back alignment and structure |
| >pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 | Back alignment and structure |
| >pdb|2BXR|A Chain A, Human Monoamine Oxidase A In Complex With Clorgyline, Crystal Form A Length = 527 | Back alignment and structure |
| >pdb|2Z5X|A Chain A, Crystal Structure Of Human Monoamine Oxidase A With Harmine Length = 513 | Back alignment and structure |
| >pdb|2Z5Y|A Chain A, Crystal Structure Of Human Monoamine Oxidase A (G110a) With Harmine Length = 513 | Back alignment and structure |
| >pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 | Back alignment and structure |
| >pdb|2C72|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|1GOS|A Chain A, Human Monoamine Oxidase B Length = 520 | Back alignment and structure |
| >pdb|2XFU|A Chain A, Human Monoamine Oxidase B With Tranylcypromine Length = 519 | Back alignment and structure |
| >pdb|2C75|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2C73|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2C76|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2BK4|A Chain A, Human Monoamine Oxidase B: I199f Mutant In Complex With Rasagiline Length = 520 | Back alignment and structure |
| >pdb|2XFO|A Chain A, Tranylcypromine-Inhibited Human Monoamine Oxidase B Ile199ala Mutant In Complex With 2-(2-Benzofuranyl)-2- Imidazoline Length = 520 | Back alignment and structure |
| >pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 | Back alignment and structure |
| >pdb|1O5W|A Chain A, The Structure Basis Of Specific Recognitions For Substrates And Inhibitors Of Rat Monoamine Oxidase A Length = 534 | Back alignment and structure |
| >pdb|3ZYX|A Chain A, Crystal Structure Of Human Monoamine Oxidase B In Complex With Methylene Blue And Bearing The Double Mutation I199a- Y326a Length = 519 | Back alignment and structure |
| >pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 | Back alignment and structure |
| >pdb|2YG7|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c-A396t-Q431g Triple Mutant Length = 453 | Back alignment and structure |
| >pdb|3K7M|X Chain X, Crystal Structure Of 6-Hydroxy-L-Nicotine Oxidase From Arthrobacter Nicotinovorans Length = 431 | Back alignment and structure |
| >pdb|3K7T|A Chain A, Crystal Structure Of Apo-Form 6-Hydroxy-L-Nicotine Oxidase, Crystal Form P3121 Length = 425 | Back alignment and structure |
| >pdb|2YG3|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: Wild Type Enzyme Length = 453 | Back alignment and structure |
| >pdb|2YG6|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: P15i-A394c Double Mutant Length = 453 | Back alignment and structure |
| >pdb|2YG5|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c Mutant Length = 453 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 | Back alignment and structure |
|---|
Score = 290 bits (743), Expect = 1e-94
Identities = 97/382 (25%), Positives = 159/382 (41%), Gaps = 34/382 (8%)
Query: 6 EDIYSFCSYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDE---DMSIQRAISI 62
+ + + ++ DG ++ V K E +S+ + +K+ D A+
Sbjct: 86 RSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQR 145
Query: 63 VFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLP--GGHGLMV--- 117
+ + +P V+ +Y + + FA SL++ G V
Sbjct: 146 LNEHQPNGPAT-PVDMVVDYY--KFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQ 202
Query: 118 RGYLPVINTLAKGL-------------DIRLGHRVTKITRHYIGVKVTVEGGKTFVADAV 164
RGY V+ LA ++L V +I GV V E + AD V
Sbjct: 203 RGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYV 262
Query: 165 VVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVE----FLGV 220
+V+ LGVL++ I+F+P+LP WK AI + + KI + F + FWP + FL
Sbjct: 263 MVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYA 322
Query: 221 VSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILP--DA 278
S Y + + VL+ + +R IE+ SDE L+K+ P D
Sbjct: 323 SSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDV 382
Query: 279 SSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHG 338
LV W +D G++S VG + Y++LR PV ++F GE TS Y G VHG
Sbjct: 383 PDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHG 442
Query: 339 AFSTGLMAAEDCRMRVLERYGE 360
A+ +G+ +AE ++ +
Sbjct: 443 AYLSGIDSAE----ILINCAQK 460
|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 130 | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 383 | |||
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 100.0 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 100.0 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 100.0 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 100.0 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 100.0 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 100.0 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 100.0 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 100.0 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 100.0 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 100.0 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 99.97 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 99.97 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 99.96 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 99.96 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 99.95 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 99.95 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 99.95 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 99.93 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 99.9 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 99.88 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 99.85 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 99.84 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.82 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 99.82 | |
| 2e1m_C | 181 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 99.79 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 99.75 | |
| 2e1m_B | 130 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 99.48 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 99.44 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 99.34 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 99.27 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 99.14 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 98.37 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 98.13 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 98.09 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 97.94 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 97.5 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 97.21 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 96.75 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 95.37 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 95.24 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 95.13 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 95.12 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 95.1 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 94.91 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 94.87 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 94.6 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 94.52 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 94.38 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 94.0 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 93.82 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 93.7 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 93.66 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 93.55 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 93.44 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 93.39 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 93.34 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 93.29 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 93.19 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 93.16 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 93.16 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 93.09 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 93.07 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 92.9 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 92.76 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 92.61 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 92.57 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 92.41 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 92.14 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 92.05 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 91.67 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 91.5 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 91.46 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 91.43 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 91.06 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 91.06 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 91.01 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 90.61 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 90.61 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 90.6 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 90.47 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 90.39 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 89.73 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 89.62 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 89.62 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 89.6 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 89.49 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 89.46 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 89.41 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 89.21 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 89.19 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 88.96 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 88.93 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 88.88 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 88.83 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 88.69 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 88.57 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 88.51 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 88.11 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 87.96 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 87.96 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 87.9 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 87.41 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 87.22 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 87.18 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 87.09 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 87.01 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 86.86 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 86.73 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 86.71 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 86.68 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 86.65 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 86.53 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 86.46 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 86.05 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 86.02 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 85.96 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 85.82 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 85.78 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 85.58 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 85.52 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 85.48 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 85.45 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 85.44 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 85.38 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 85.33 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 85.25 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 85.19 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 85.16 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 84.82 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 84.67 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 84.57 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 84.5 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 84.42 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 84.41 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 84.4 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 84.31 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 84.2 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 84.12 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 83.96 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 83.75 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 83.7 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 83.47 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 83.06 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 82.28 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 82.15 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 81.63 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 81.57 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 81.53 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 80.99 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 80.99 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 80.45 |
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-39 Score=329.67 Aligned_cols=275 Identities=35% Similarity=0.591 Sum_probs=231.7
Q ss_pred HHHHHHHHHhhhhhcCCCCCccChhccccc--cccCCCceeccCChHHHHHHHHccCCcccCceeEEEEecCCeeEEEEC
Q 016772 77 HKVLQWYLCRMEGWFAADAETISLKSWDKE--ELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVE 154 (383)
Q Consensus 77 ~~~~~~~~~~~~~~~~~~~~~~S~~~~~~~--~~~~g~~~~~~gG~~~l~~~L~~~l~I~l~~~V~~I~~~~~~v~V~~~ 154 (383)
+.+++|++..++...+.+.+.+|+..+.++ ..+.+.++.++|||++|+++|+++++|++|++|++|.+++++|.|++.
T Consensus 355 ~~~l~~~~~~~~~~~~~~l~~ls~~~~~~~~~~~~~g~~~~~~gG~~~l~~~La~~l~I~l~~~V~~I~~~~~~v~V~~~ 434 (662)
T 2z3y_A 355 RQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAV 434 (662)
T ss_dssp HHHHHHHHHHHHHHTTSCGGGBBTTTTTTTGGGCCBSCCEEETTCTTHHHHHHTTTCEEETTEEEEEEEEETTEEEEEEE
T ss_pred HHHHHHHHHHHHHhcCCChhhcCHhhcCCCcccccCCceeeecCcHHHHHHHHHhcCceecCCeEEEEEECCCcEEEEEe
Confidence 356666655444455778888998876543 235577889999999999999999999999999999999999999876
Q ss_pred C------CcEEEcCEEEEecChHHHhc--CCcccCCCCcHHHHHHHhhcCCcccceEEEEcCCCCCCC-CCcceeecCCC
Q 016772 155 G------GKTFVADAVVVAVPLGVLKA--RTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPN-VEFLGVVSDTS 225 (383)
Q Consensus 155 ~------G~~~~ad~VI~t~p~~~l~~--~~i~f~p~Lp~~~~~ai~~~~~~~~~kv~l~~~~~~w~~-~~~~g~~~~~~ 225 (383)
+ |++++||+||+|+|+++|+. ..+.|.|+||+.+.+++++++|+++.||+|.|+++||++ .+.+|.+.+..
T Consensus 435 ~~~~~~~~~~~~Ad~VI~tvP~~vL~~l~~~i~f~P~LP~~k~~Ai~~l~~g~~~KV~l~f~~~fW~~~~~~~G~l~~~~ 514 (662)
T 2z3y_A 435 NTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTT 514 (662)
T ss_dssp ESSCTTCEEEEEESEEEECCCHHHHHCSSCSSEEESCCCHHHHHHHHHSEECCCEEEEEECSSCCSCTTCSEEEECCSSS
T ss_pred ecccCCCCeEEEeCEEEECCCHHHHhcccCceEEcCCCCHHHHHHHHhCCccceeEEEEEcCcccccCCCCceeeecCCC
Confidence 5 56899999999999999987 347899999999999999999999999999999999974 46777764432
Q ss_pred C---ceeEeeeccCCCCCceEEEEecchhhHHHhcCCHHHHHHHHHHHHHHhCCC--CCCCcEEEEccCCCCCCCCCcCC
Q 016772 226 Y---GCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPD--ASSPIQYLVSHWGTDANSLGSYS 300 (383)
Q Consensus 226 ~---~~~~~~~~~~~~g~~~l~~~~~g~~a~~~~~~~~ee~~~~v~~~L~~~~~~--~~~~~~~~~~~W~~~~~~~g~y~ 300 (383)
. ....+++.. +.++|++|+.|+.+..+..++++++++.++++|+++||. .++|..+.+++|.++||++|+|+
T Consensus 515 ~~~~~~~~~~~~~---~~~vL~~~~~G~~a~~~~~lsdee~~~~~l~~L~~~~g~~~~~~p~~~~v~~W~~dp~~~Gsys 591 (662)
T 2z3y_A 515 ASRGELFLFWNLY---KAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYS 591 (662)
T ss_dssp TTTTEEEEEECCS---SSSEEEEEECTHHHHHHTTSCHHHHHHHHHHHHHHHHCTTSSCCCSEEEECCTTTCTTTSSSCE
T ss_pred CCCCceeEEEeCC---CCCEEEEEeccHhHHHHHhCCHHHHHHHHHHHHHHHhCCcccCCCceeEEEEECCCCCCCcccc
Confidence 1 122333322 456899999999999999999999999999999999986 46789999999999999999999
Q ss_pred CCCCCCChHHHHHHhCCC-------------CCEEEeccccCCCCCchhhHHHHHHHHHHHHHHHHH
Q 016772 301 YDTVGKSHDLYERLRIPV-------------DNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRV 354 (383)
Q Consensus 301 ~~~~g~~~~~~~~~~~p~-------------~~l~faG~~~~~~~~g~v~gA~~SG~~aA~~i~~~l 354 (383)
+.++|.....++.+.+|+ ++||||||+|+..+.|+||||++||++||++|++.+
T Consensus 592 ~~~pg~~~~~~~~l~~p~~~~~~~~~~~~~~grl~FAGe~ts~~~~g~v~GAi~SG~raA~~i~~~~ 658 (662)
T 2z3y_A 592 YVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQF 658 (662)
T ss_dssp ECBTTCCTHHHHHHHCCBCC---------CCCCEEECSGGGCTTSTTSHHHHHHHHHHHHHHHHHHH
T ss_pred cCCCCCchhhHHHHhCcCccccccccccCCCCcEEEEeccccCCCCcCHHHHHHHHHHHHHHHHHHc
Confidence 999998777777777775 689999999999888999999999999999998765
|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 383 | ||||
| d2dw4a3 | 109 | d.16.1.5 (A:655-763) Lysine-specific histone demet | 2e-21 | |
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 4e-21 | |
| d1b5qa2 | 112 | d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea | 9e-19 | |
| d2v5za2 | 112 | d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H | 6e-18 | |
| d2v5za1 | 383 | c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H | 4e-17 | |
| d2iida2 | 113 | d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan | 8e-16 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 4e-11 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 2e-07 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 5e-09 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 7e-07 | |
| d1m6ia2 | 137 | c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF | 3e-05 | |
| d1gesa2 | 116 | c.3.1.5 (A:147-262) Glutathione reductase {Escheri | 9e-05 | |
| d1aoga2 | 117 | c.3.1.5 (A:170-286) Trypanothione reductase {Trypa | 1e-04 | |
| d3lada2 | 119 | c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase | 8e-04 | |
| d1seza1 | 373 | c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox | 0.001 | |
| d1d7ya2 | 121 | c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu | 0.001 | |
| d1feca2 | 117 | c.3.1.5 (A:170-286) Trypanothione reductase {Crith | 0.002 |
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FAD-linked reductases, C-terminal domain superfamily: FAD-linked reductases, C-terminal domain family: L-aminoacid/polyamine oxidase domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 86.0 bits (212), Expect = 2e-21
Identities = 33/109 (30%), Positives = 49/109 (44%), Gaps = 3/109 (2%)
Query: 196 GVGIENKIIMHFDKVFWP-NVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARD 254
G G NK+++ FD+VFW +V G V T+ +L+ + AG+ A
Sbjct: 1 GFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGI 60
Query: 255 IEKMSDEAAANFAFTQLKKIL--PDASSPIQYLVSHWGTDANSLGSYSY 301
+E +SD+ LK I P + +VS W D + GSYSY
Sbjct: 61 MENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSY 109
|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 113 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 383 | |||
| d2v5za2 | 112 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.65 | |
| d2dw4a3 | 109 | Lysine-specific histone demethylase 1, LSD1 {Human | 99.65 | |
| d1b5qa2 | 112 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.6 | |
| d2iida2 | 113 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.51 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.46 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.4 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.37 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 98.67 | |
| d2ivda2 | 108 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.57 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 98.47 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.33 | |
| d1seza2 | 112 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 98.26 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 98.02 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 97.8 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 97.16 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 97.1 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.0 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 96.7 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 96.69 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 96.54 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 96.51 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 96.25 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 96.1 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 95.88 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 95.74 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 95.59 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 95.49 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 95.23 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 95.23 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 94.79 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 94.72 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 94.69 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 94.33 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 94.21 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 94.2 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 94.13 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 94.11 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 93.55 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 92.63 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 92.46 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 92.08 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 89.25 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 87.0 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 86.22 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 85.53 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 84.26 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 84.17 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 82.86 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 81.88 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 81.64 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 81.22 |
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FAD-linked reductases, C-terminal domain superfamily: FAD-linked reductases, C-terminal domain family: L-aminoacid/polyamine oxidase domain: Monoamine oxidase B species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65 E-value=2.7e-16 Score=120.16 Aligned_cols=106 Identities=17% Similarity=0.282 Sum_probs=86.0
Q ss_pred CCcccceEEEEcCCCCCCCCCcceeecCCC--C-ceeEeeeccCCCCCceEEEEecchhhHHHhcCCHHHHHHHHHHHHH
Q 016772 196 GVGIENKIIMHFDKVFWPNVEFLGVVSDTS--Y-GCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLK 272 (383)
Q Consensus 196 ~~~~~~kv~l~~~~~~w~~~~~~g~~~~~~--~-~~~~~~~~~~~~g~~~l~~~~~g~~a~~~~~~~~ee~~~~v~~~L~ 272 (383)
.||+++||+|.|+++||++.+..|...... . ....+++.....+.++|++|+.|+.+..++.++++++++.+++.|+
T Consensus 1 pmG~~~Kv~l~f~~~FW~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~vL~~~~~G~~a~~~~~ls~~e~~~~~l~~L~ 80 (112)
T d2v5za2 1 PLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEERLKKLCELYA 80 (112)
T ss_dssp CBCCEEEEEEECSSCGGGGGTEEEEEEECSTTCSCSEEEECCCTTSCSCEEEEEEETHHHHHHTTSCHHHHHHHHHHHHH
T ss_pred CchheEEEEEEcCCCCCCCCCceeeEEecCCCCcEEEEccCcCccCCCcEEEEEeCcHHHHHHHhCCHHHHHHHHHHHHH
Confidence 489999999999999998766666543222 1 2233333334455679999999999999999999999999999999
Q ss_pred HhCCC--CCCCcEEEEccCCCCCCCCCcCCC
Q 016772 273 KILPD--ASSPIQYLVSHWGTDANSLGSYSY 301 (383)
Q Consensus 273 ~~~~~--~~~~~~~~~~~W~~~~~~~g~y~~ 301 (383)
++||+ ++.|..+.+++|.+|||++|+|+.
T Consensus 81 ~~~g~~~~~~~~~~~~~~W~~dp~~~GsYs~ 111 (112)
T d2v5za2 81 KVLGSLEALEPVHYEEKNWCEEQYSGGCYTT 111 (112)
T ss_dssp HHHTCGGGGCCSEEEEEEGGGCTTTCSSSCB
T ss_pred HHhCccccCCccEEEEcccCCCCccCccccc
Confidence 99986 567899999999999999999984
|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|