Citrus Sinensis ID: 016813

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--
MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKLMQEDVQERVLDDEFPAHSWNFHEVKEKEVVKQQPLPKPEPMQRVLATGSNHNPKPNPPPAAAAPQMPVRTPSPVRVTPAVKPLKQPKPKAKDPNKREMSMEEKHKLGIGLQSLPQEKMEQVIHILKKRNGNLRQDEDEIELDIEALDTETLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANREVPMAEKIEVATDAKKAKKGEAGDEDVDIGDEIPMSSFPPVEIEKDNAHNNNAASSSSSSSSSSSSDSSSSSDSDSGSSSGSDSDADDARS
cccHHHHHHHHHccccccccccccccccccccccHHHccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcHHHHHHccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccc
cccHHHHHHHHHHccccccccccccHHHcccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHcccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcHHHHccccHHHHHHHHHHHcccccccccccEEEEEHHcccHHHHHHHHHHHHHHHHHHHccccHccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccc
MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDiiknpmdlgtvksklsknlydspasfaaDVRLTFnnamtynpkdhevHIIAEQFLARFEELFRPINEKLMQEDVQervlddefpahswnfhevkekevvkqqplpkpepmqrvlatgsnhnpkpnpppaaaapqmpvrtpspvrvtpavkplkqpkpkakdpnkremSMEEKHKLgiglqslpqeKMEQVIHILKKrngnlrqdedeiELDIEALDTETLWELDRFVTNYKKMVSKIKRQALMGinnvssadanrevpmaeKIEVATDAKkakkgeagdedvdigdeipmssfppveiekdnahnnnaassssssssssssdsssssdsdsgsssgsdsdaddars
MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKLMQEDVQERVLDDEFPAhswnfhevkekevvkqqplpkpEPMQRVLATGSNHNPKPNPPPAAAAPQMPVRTPSPVrvtpavkplkqpkpkakdpnkremSMEEKHKLgiglqslpqEKMEQVIHILKkrngnlrqdedEIELDiealdtetlwelDRFVTNYKKMVSKIKRQALMginnvssadanrevpmaEKIEvatdakkakkgeagdedvdigdeIPMSSFPPVEIEKDNAHNNnaassssssssssssdsssssdsdsgsssgsdsdaddars
MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKLMQEDVQERVLDDEFPAHSWNFHEVKEKEVVKQQPLPKPEPMQRVLATGSNHnpkpnpppaaaapQMpvrtpspvrvtpavKPLKQPKPKAKDPNKREMSMEEKHKLGIGLQSLPQEKMEQVIHILKKRNGNLRQdedeieldiealdTETLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANREVPMAEKIEVATdakkakkgeagdedVDIGDEIPMSSFPPVEIEKDNAHNNNaassssssssssssdsssssdsdsgsssgsdsdaddaRS
***CGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKLMQEDVQERVLDDEFPAHSWNFH**************************************************************************************************VIHILK***********EIELDIEALDTETLWELDRFVTNYKKMVSKIKRQALMGIN****************************************************************************************************
MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEK*********************************************************************************************************************KMEQVIHI****************LDIEALDTETLWELDRFV*********************************************************GDEIPM********************************************************
MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKLMQEDVQERVLDDEFPAHSWNFHEVKEKEVVKQQPLPKPEPMQRVLATGSNHNPKPNPPPAAAAPQMPVRTPSPVRVTPAVKP*******************EKHKLGIGLQSLPQEKMEQVIHILKKRNGNLRQDEDEIELDIEALDTETLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANREVPMAEKIEVAT************EDVDIGDEIPMSSFPPVEIEKDNAH******************************************
MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINE**************************************************************************************************EMSMEEKHKLGIGLQSLPQEKMEQVIHILKKRNGNLRQDEDEIELDIEALDTETLWELDRFVTNYKKMVSK******************************************DEDVDIGDEIPMSSFPPVEIEKD*********************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKLMQEDVQERVLDDEFPAHSWNFHEVKEKEVVKQQPLPKPEPMQRVLATGSNHNPKPNPPPAAAAPQMPVRTPSPVRVTPAVKPLKQPKPKAKDPNKREMSMEEKHKLGIGLQSLPQEKMEQVIHILKKRxxxxxxxxxxxxxxxxxxxxxTLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANREVPMAEKIEVATDAKKAKKGEAGDEDVDIGDEIPMSSFPPVEIEKDNAHNNNAASSSSSSSSSSSSDSSSSSDSDSGSSSGSDSDADDARS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query382 2.2.26 [Sep-21-2011]
Q9LXA7581 Transcription factor GTE2 no no 0.806 0.530 0.443 7e-78
Q9S7T1461 Transcription factor GTE3 no no 0.685 0.568 0.445 1e-54
Q9LNC4766 Transcription factor GTE4 no no 0.688 0.343 0.423 2e-54
Q8H1D7487 Transcription factor GTE5 no no 0.670 0.525 0.445 6e-50
Q7Y214590 Transcription factor GTE7 no no 0.379 0.245 0.622 2e-46
Q93YS6 688 Transcription factor GTE9 no no 0.764 0.424 0.323 6e-36
Q9LK27 813 Transcription factor GTE8 no no 0.554 0.260 0.363 1e-31
Q93ZB7 620 Transcription factor GTE1 no no 0.787 0.485 0.315 1e-31
Q9FGW9 1061 Transcription factor GTE1 no no 0.732 0.263 0.309 2e-30
Q9LS28494 Transcription factor GTE1 no no 0.319 0.246 0.460 2e-24
>sp|Q9LXA7|GTE2_ARATH Transcription factor GTE2 OS=Arabidopsis thaliana GN=GTE2 PE=2 SV=2 Back     alignment and function desciption
 Score =  291 bits (744), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 169/381 (44%), Positives = 215/381 (56%), Gaps = 73/381 (19%)

Query: 1   MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPA 60
           M  CGQIL KLMKHK  ++F +PVDVVG+ LHDY+ I+  PMDLGTVK  L K LY SP 
Sbjct: 175 MTTCGQILVKLMKHKWSWVFLNPVDVVGLGLHDYHRIVDKPMDLGTVKMNLEKGLYRSPI 234

Query: 61  SFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKLMQEDVQERVLDDEFP 120
            FA+DVRLTF NAM+YNPK  +V+++AE+ L++F+  F P  ++                
Sbjct: 235 DFASDVRLTFTNAMSYNPKGQDVYLMAEKLLSQFDVWFNPTLKRF--------------- 279

Query: 121 AHSWNFHEVKEKEVVKQQPLPKPEPMQRVLATGS-NHNPKPNPPPAAAAPQM-------- 171
                  E +E +V+     P PE  QRV    +   N +  P   + A ++        
Sbjct: 280 -------EAQEVKVMGSSSRPGPEDNQRVWNQNNVAENARKGPEQISIAKKLDSVKPLLP 332

Query: 172 -----------------------------------PVRTPSPVRVTPAVKPLKQPKPKAK 196
                                               V     VR T   +  K PKPKAK
Sbjct: 333 TLPPPPVIEITRDPSPPPSPVQPPPPPSPPPQPVNQVEASLEVRETNKGRKGKLPKPKAK 392

Query: 197 DPNKREMSMEEKHKLGIGLQSLPQEKMEQVIHILKKRNGNLRQDEDEIELDIEALDTETL 256
           DPNKREM+M+EK KLG+ LQ LP EK+ Q+I IL+KR  +L QD DEIELDIEALD ETL
Sbjct: 393 DPNKREMTMDEKGKLGVNLQELPPEKLGQLIQILRKRTRDLPQDGDEIELDIEALDNETL 452

Query: 257 WELDRFVTNYKKMVSKIKRQALMGINNVSSADANREVPMAEKIEVATDAKKAKK-GEAGD 315
           WELDRFVTNY+KM SKIKRQ    I NVS+   N    M    E+ +  K+ +K GEAG+
Sbjct: 453 WELDRFVTNYRKMASKIKRQGF--IQNVSTPPRN----MPPVTEMGSAEKRGRKGGEAGE 506

Query: 316 EDVDIGDEIPMSSFPPVEIEK 336
           EDVDIG++IP+  +P VEIE+
Sbjct: 507 EDVDIGEDIPVEDYPSVEIER 527

Arabidopsis thaliana (taxid: 3702)
>sp|Q9S7T1|GTE3_ARATH Transcription factor GTE3, chloroplastic OS=Arabidopsis thaliana GN=GTE3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LNC4|GTE4_ARATH Transcription factor GTE4 OS=Arabidopsis thaliana GN=GTE4 PE=2 SV=1 Back     alignment and function description
>sp|Q8H1D7|GTE5_ARATH Transcription factor GTE5, chloroplastic OS=Arabidopsis thaliana GN=GTE5 PE=1 SV=1 Back     alignment and function description
>sp|Q7Y214|GTE7_ARATH Transcription factor GTE7 OS=Arabidopsis thaliana GN=GTE7 PE=2 SV=1 Back     alignment and function description
>sp|Q93YS6|GTE9_ARATH Transcription factor GTE9 OS=Arabidopsis thaliana GN=GTE9 PE=1 SV=1 Back     alignment and function description
>sp|Q9LK27|GTE8_ARATH Transcription factor GTE8 OS=Arabidopsis thaliana GN=GTE8 PE=2 SV=2 Back     alignment and function description
>sp|Q93ZB7|GTE11_ARATH Transcription factor GTE11 OS=Arabidopsis thaliana GN=GTE11 PE=1 SV=1 Back     alignment and function description
>sp|Q9FGW9|GTE10_ARATH Transcription factor GTE10 OS=Arabidopsis thaliana GN=GTE10 PE=1 SV=2 Back     alignment and function description
>sp|Q9LS28|GTE12_ARATH Transcription factor GTE12 OS=Arabidopsis thaliana GN=GTE12 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query382
255554567 634 bromodomain-containing protein, putative 0.884 0.533 0.626 1e-119
449459556 533 PREDICTED: transcription factor GTE7-lik 0.842 0.604 0.644 1e-118
296088086 564 unnamed protein product [Vitis vinifera] 0.856 0.579 0.633 1e-115
356554838 536 PREDICTED: transcription factor GTE11-li 0.856 0.610 0.634 1e-114
356549487 531 PREDICTED: uncharacterized protein LOC10 0.853 0.613 0.621 1e-114
356554832 529 PREDICTED: uncharacterized protein LOC10 0.856 0.618 0.624 1e-113
359475584 561 PREDICTED: transcription factor GTE2-lik 0.845 0.575 0.600 1e-111
449438275 539 PREDICTED: uncharacterized protein LOC10 0.821 0.582 0.612 1e-110
357476127 533 Bromodomain-containing protein [Medicago 0.848 0.607 0.598 1e-107
224056335474 global transcription factor group [Popul 0.730 0.588 0.652 1e-105
>gi|255554567|ref|XP_002518322.1| bromodomain-containing protein, putative [Ricinus communis] gi|223542542|gb|EEF44082.1| bromodomain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 230/367 (62%), Positives = 271/367 (73%), Gaps = 29/367 (7%)

Query: 1   MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPA 60
           MK CGQ+LTKLMKHK GYIFN PVDV  M LHDY++IIK PMDLGTVK KL  N Y+SP 
Sbjct: 234 MKKCGQMLTKLMKHKFGYIFNEPVDVERMNLHDYFEIIKKPMDLGTVKKKLGSNEYESPI 293

Query: 61  SFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKL---MQEDVQERVL-- 115
            FAADVRLTFNNAM YNPK HEV+  AEQFL+RFEELFRPI EKL   + +D Q++++  
Sbjct: 294 DFAADVRLTFNNAMKYNPKGHEVYTFAEQFLSRFEELFRPIREKLGDFVLDDDQDQIVHH 353

Query: 116 DDEFP--------------AHSWNFHEVKEKEVVKQQPLPKPEPMQRVLATGSNHNP--K 159
           D E                A SW+ H +  +         K +    +  T  + +P  K
Sbjct: 354 DREIEHEQEHEHEQVHEVQASSWDHHSLNRRGGSGDIERVKKDQENVLQITSKSDHPIGK 413

Query: 160 PNPPPAAAAPQ----MPVRTPSPVRVTPAVKPLKQPKPKAKDPNKREMSMEEKHKLGIGL 215
             PP   + PQ    +PVRTPSP+R  P VKP+K PKPKAKDPNKREMS+EEKHKLG+GL
Sbjct: 414 SVPPSVLSNPQSTSQLPVRTPSPMR-APPVKPVKLPKPKAKDPNKREMSLEEKHKLGVGL 472

Query: 216 QSLPQEKMEQVIHILKKRNGNLRQDEDEIELDIEALDTETLWELDRFVTNYKKMVSKIKR 275
           QSLPQEKMEQV+ I++KRNG+LRQD DEIELDIEA+DTETLWELDRFVTNYKKMVSKIKR
Sbjct: 473 QSLPQEKMEQVVQIIRKRNGHLRQDGDEIELDIEAVDTETLWELDRFVTNYKKMVSKIKR 532

Query: 276 QALMGINNVSSA--DANREVPMAEKIEVATDAKKAKKGEAGDEDVDIGDEIPMSSFPPVE 333
           QALMGI    +A  + N++V + E+I++ T+AKK KKG+AGDEDVDIGDE+PMSSFPPVE
Sbjct: 533 QALMGIAPTGNAVSEGNKDVSVNERIDI-TEAKKPKKGDAGDEDVDIGDEMPMSSFPPVE 591

Query: 334 IEKDNAH 340
           IEKDN H
Sbjct: 592 IEKDNGH 598

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449459556|ref|XP_004147512.1| PREDICTED: transcription factor GTE7-like [Cucumis sativus] gi|449511376|ref|XP_004163939.1| PREDICTED: transcription factor GTE7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296088086|emb|CBI35445.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356554838|ref|XP_003545749.1| PREDICTED: transcription factor GTE11-like [Glycine max] Back     alignment and taxonomy information
>gi|356549487|ref|XP_003543125.1| PREDICTED: uncharacterized protein LOC100802622 [Glycine max] Back     alignment and taxonomy information
>gi|356554832|ref|XP_003545746.1| PREDICTED: uncharacterized protein LOC100819363 [Glycine max] Back     alignment and taxonomy information
>gi|359475584|ref|XP_003631709.1| PREDICTED: transcription factor GTE2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449438275|ref|XP_004136914.1| PREDICTED: uncharacterized protein LOC101209352 [Cucumis sativus] gi|449521741|ref|XP_004167888.1| PREDICTED: uncharacterized protein LOC101228592 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357476127|ref|XP_003608349.1| Bromodomain-containing protein [Medicago truncatula] gi|355509404|gb|AES90546.1| Bromodomain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224056335|ref|XP_002298808.1| global transcription factor group [Populus trichocarpa] gi|222846066|gb|EEE83613.1| global transcription factor group [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query382
TAIR|locus:2155715590 GTE7 "AT5G65630" [Arabidopsis 0.374 0.242 0.516 1.1e-64
TAIR|locus:2038565766 GTE4 "AT1G06230" [Arabidopsis 0.280 0.139 0.579 7.2e-50
TAIR|locus:2032692461 GTE3 "AT1G73150" [Arabidopsis 0.390 0.323 0.509 8.7e-49
TAIR|locus:2030958487 AT1G17790 "AT1G17790" [Arabido 0.685 0.537 0.397 6.6e-42
TAIR|locus:2158564 1061 NPX1 "nuclear protein X1" [Ara 0.392 0.141 0.364 1.7e-29
RGD|1306678 952 Brdt "bromodomain, testis-spec 0.272 0.109 0.476 4.1e-29
TAIR|locus:2086498 813 GTE8 "AT3G27260" [Arabidopsis 0.274 0.129 0.514 9.7e-29
UNIPROTKB|F1MMU3722 BRD3 "Uncharacterized protein" 0.256 0.135 0.445 5.2e-27
UNIPROTKB|F1S033726 BRD3 "Uncharacterized protein" 0.256 0.134 0.445 5.3e-27
TAIR|locus:2082289 620 BET10 "AT3G01770" [Arabidopsis 0.272 0.167 0.519 7.7e-27
TAIR|locus:2155715 GTE7 "AT5G65630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 354 (129.7 bits), Expect = 1.1e-64, Sum P(2) = 1.1e-64
 Identities = 77/149 (51%), Positives = 92/149 (61%)

Query:   189 KQPKPKAKDPNKREMSMEEKHKLGIGLQSLPQEKMEQVIHILKKRNGNLRQXXXXXXXXX 248
             K PKPKAKDPNKR M+MEEK KLG+ LQ LP EK+ Q++ IL+KRNG+L Q         
Sbjct:   390 KLPKPKAKDPNKRLMTMEEKSKLGMNLQDLPPEKLGQLLQILRKRNGHLAQDGDEIELDI 449

Query:   249 XXXXTETLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANREVPMAEKIEVATXXXXX 308
                  ETLWELDRFVTNYKKM SKIKRQ    I NVS+   N    MA   E+ +     
Sbjct:   450 EAVDNETLWELDRFVTNYKKMASKIKRQGF--IRNVSTPPRN----MASVAEMGSAEKRT 503

Query:   309 XXXXXXXXXVDIGDEIPMSSFPPVEIEKD 337
                      VDIG++IP+  +P VEIE+D
Sbjct:   504 RRGDAGEEDVDIGEDIPIEDYPSVEIERD 532
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0009294 "DNA mediated transformation" evidence=RCA;IMP
TAIR|locus:2038565 GTE4 "AT1G06230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032692 GTE3 "AT1G73150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030958 AT1G17790 "AT1G17790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158564 NPX1 "nuclear protein X1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1306678 Brdt "bromodomain, testis-specific" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2086498 GTE8 "AT3G27260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMU3 BRD3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S033 BRD3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2082289 BET10 "AT3G01770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00005742001
SubName- Full=Chromosome chr3 scaffold_157, whole genome shotgun sequence; (537 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query382
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 3e-51
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 7e-37
cd0436999 cd04369, Bromodomain, Bromodomain 7e-29
smart00297107 smart00297, BROMO, bromo domain 5e-27
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 4e-23
pfam0043984 pfam00439, Bromodomain, Bromodomain 2e-22
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 3e-19
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 2e-18
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 9e-18
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 3e-17
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 3e-16
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 3e-16
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 3e-15
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 9e-15
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 3e-14
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-12
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 4e-12
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 6e-12
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 7e-12
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 3e-11
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 4e-11
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 5e-10
COG5076371 COG5076, COG5076, Transcription factor involved in 8e-10
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 1e-09
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 5e-09
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 9e-09
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 1e-08
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 7e-08
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 4e-07
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 4e-06
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 6e-06
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 1e-05
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 1e-05
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 2e-05
pfam0765595 pfam07655, Secretin_N_2, Secretin N-terminal domai 2e-04
PHA02664534 PHA02664, PHA02664, hypothetical protein; Provisio 4e-04
pfam0765595 pfam07655, Secretin_N_2, Secretin N-terminal domai 8e-04
pfam0765595 pfam07655, Secretin_N_2, Secretin N-terminal domai 0.001
pfam05110 1154 pfam05110, AF-4, AF-4 proto-oncoprotein 0.001
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 0.001
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.001
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.001
pfam0765595 pfam07655, Secretin_N_2, Secretin N-terminal domai 0.002
pfam05110 1154 pfam05110, AF-4, AF-4 proto-oncoprotein 0.002
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information 
 Score =  165 bits (421), Expect = 3e-51
 Identities = 61/96 (63%), Positives = 72/96 (75%)

Query: 1  MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPA 60
          MK CG +L KLMKHK G++FN+PVDVV + L DY+DIIK PMDLGTVK KL K  Y SP 
Sbjct: 2  MKQCGTLLRKLMKHKWGWVFNAPVDVVALGLPDYFDIIKKPMDLGTVKKKLEKGEYSSPE 61

Query: 61 SFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEE 96
           FAADVRLTF NAM YNP  ++VH +A++ L  FE 
Sbjct: 62 EFAADVRLTFANAMRYNPPGNDVHTMAKELLKIFET 97

Might function as a global transcription factor. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 99
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain Back     alignment and domain information
>gnl|CDD|177447 PHA02664, PHA02664, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain Back     alignment and domain information
>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain Back     alignment and domain information
>gnl|CDD|218440 pfam05110, AF-4, AF-4 proto-oncoprotein Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain Back     alignment and domain information
>gnl|CDD|218440 pfam05110, AF-4, AF-4 proto-oncoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 382
KOG1474640 consensus Transcription initiation factor TFIID, s 100.0
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.96
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.96
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.96
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.96
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.95
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.95
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.95
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.95
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.95
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.95
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.94
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.94
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.94
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.94
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.94
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.93
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.93
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.93
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.93
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.93
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.92
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.91
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.91
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.91
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.91
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.9
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.9
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.9
smart00297107 BROMO bromo domain. 99.9
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.89
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.88
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.88
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.87
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.87
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.86
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 99.73
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.73
COG5076371 Transcription factor involved in chromatin remodel 99.7
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.49
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 99.47
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 99.17
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 99.15
KOG00081563 consensus Transcription initiation factor TFIID, s 98.99
KOG1474 640 consensus Transcription initiation factor TFIID, s 98.79
KOG00081563 consensus Transcription initiation factor TFIID, s 98.76
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 98.74
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 98.7
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 98.68
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 98.27
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 97.97
COG5076371 Transcription factor involved in chromatin remodel 97.0
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 96.83
KOG06441113 consensus Uncharacterized conserved protein, conta 94.75
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 89.94
PHA03308 1463 transcriptional regulator ICP4; Provisional 87.27
KOG2130407 consensus Phosphatidylserine-specific receptor Ptd 86.81
PF05110 1191 AF-4: AF-4 proto-oncoprotein; InterPro: IPR007797 86.55
PHA03308 1463 transcriptional regulator ICP4; Provisional 85.17
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=5.1e-41  Score=354.60  Aligned_cols=266  Identities=38%  Similarity=0.534  Sum_probs=179.6

Q ss_pred             ChHHHHHHHHHHhCCCCccccCCCCccccCCCccccccCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHhHhhhCCCC
Q 016813            1 MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKD   80 (382)
Q Consensus         1 mk~c~~il~~L~~~~~a~~F~~PVd~~~~~~pdY~~iIk~PMDL~tIk~kL~~~~Y~s~~eF~~Dv~Lif~Na~~yN~~~   80 (382)
                      |++|..||.+||+|+++|+|+.|||++.||+||||+||+|||||+|||+||.+|.|.++.+|++||||||.|||+||++|
T Consensus       224 lk~C~~iLk~l~~~k~awpF~~PVD~v~LgLpDY~~IIK~PMDLgTIK~kL~~~~Y~~~~eF~~DVRL~F~Ncm~YNp~g  303 (640)
T KOG1474|consen  224 LKQCLSILKRLMKHKHAWPFNEPVDVVKLGLPDYHDIIKHPMDLGTIKKKLEKGEYKSAEEFAADVRLTFDNCMTYNPEG  303 (640)
T ss_pred             HHHHHHHHHHHHhccCCCCcCCCcCHHhcCCcchhhhcCCCccHHHHHhhhcccccCCHHHHHHHHHHHHHHHHhcCCCC
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhcccCCC----C------CC--------c----CccCcchhhHHHhhh-c
Q 016813           81 HEVHIIAEQFLARFEELFRPINEKLMQEDVQERVLDD----E------FP--------A----HSWNFHEVKEKEVVK-Q  137 (382)
Q Consensus        81 s~v~~~A~~L~~~fe~~~~~~~~~~~~~~~~~~~~~~----e------~~--------~----~~~~~~~~~~r~~kk-~  137 (382)
                      ++||.||..|+++|+.+|..+...+............    +      ..        .    ..+............ .
T Consensus       304 ~dV~~Ma~~L~~~Fe~rw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~  383 (640)
T KOG1474|consen  304 SDVYAMAKKLQEVFEERWASMPLEIEESESAVKEEAGMASSDQIPSNSVEGPRSSSFESRESASEPSSELMSEEERKKLL  383 (640)
T ss_pred             CHHHHHHHHHHHHHHHHHhhccccccccccccccccccccccccccccccCcccccchhcccccCcccccccHHhhhhhH
Confidence            9999999999999999999877665432210000000    0      00        0    000000000000000 0


Q ss_pred             CC--CCCCCchhhhhh--cCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCHHHHHHH
Q 016813          138 QP--LPKPEPMQRVLA--TGSNHNPKPNPPPAAAAPQMPVRTPSPVRVTPA--VKPLKQPKPKAKDPNKREMSMEEKHKL  211 (382)
Q Consensus       138 ~~--~~~~~~q~~~~~--~~~~s~~~~~~~~~~~~~q~~~~~~s~~~~~~~--~k~~k~~k~~~~~~~~r~mT~eEK~~L  211 (382)
                      ..  ......+..+..  ......+     +...    ........+....  .-..+..+..+...+++.||..|+..|
T Consensus       384 ~~l~~~~~~~~~~l~~~~~~~~~~~-----~~~~----e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~t~~~~~~l  454 (640)
T KOG1474|consen  384 AELKLLLKDVPPQLIALLQRPVSKP-----PRKI----EEELESDKRPLVTGKLIKEKNKKEKAANENKRDMTAPEKAKL  454 (640)
T ss_pred             hhhhcchhhhhHHHHhhhhccccCc-----cccc----cccccccccccchhhhhhhhhccccccccccccccccccccc
Confidence            00  000000000000  0000000     0000    0000000000000  000122222334456899999999999


Q ss_pred             HHHhcC-CChhhHHHHHHHH--HhhcCCCCCCCCeEEEeCcCCC-------------HHHHHHHHHHHHHHHHHHHHHHH
Q 016813          212 GIGLQS-LPQEKMEQVIHIL--KKRNGNLRQDEDEIELDIEALD-------------TETLWELDRFVTNYKKMVSKIKR  275 (382)
Q Consensus       212 ~~~I~~-L~~e~l~~VI~II--~~~~p~~~~~~deiEiDid~L~-------------~~TL~eL~~~V~~~~k~~~~~kr  275 (382)
                      ...+.. +++..+..+++|+  ..+.+.+..+++++++|++.++             .+|+|++.+|+..+...+.+...
T Consensus       455 ~~~~~~~~~p~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~vd~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~s~~~~  534 (640)
T KOG1474|consen  455 KELLQNLLPPNKLESIVEILKPEKRQLDLSQNDDEIELDLDSVDGSQSREPSSNPLEIETIRETLKLSTERELELSKASS  534 (640)
T ss_pred             hhhccCCCCCccccCcccccchhhhcccccccccchhhcccccccccccCCCcccchhhhhhccccchhhHHHHHHHHhh
Confidence            999999 5999999999999  5577788888899999999999             99999999999999877665544

>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03308 transcriptional regulator ICP4; Provisional Back     alignment and domain information
>KOG2130 consensus Phosphatidylserine-specific receptor PtdSerR, contains JmjC domain [Chromatin structure and dynamics; Signal transduction mechanisms] Back     alignment and domain information
>PF05110 AF-4: AF-4 proto-oncoprotein; InterPro: IPR007797 This family consist of family member 1 (proto-oncogene AF4), family member 2 or FMR2 (Fragile X E mental retardation syndrome), family member 3 or LAF4 (lymphoid nuclear protein related to AF4) and family member 4 (protein lilliputian) Back     alignment and domain information
>PHA03308 transcriptional regulator ICP4; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query382
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 3e-19
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 2e-18
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 2e-18
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 2e-18
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 5e-18
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 8e-18
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 9e-18
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 9e-18
2e7n_A117 Solution Structure Of The Second Bromodomain From H 2e-17
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 2e-17
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 4e-15
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 2e-13
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 2e-13
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 5e-13
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 6e-13
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 6e-13
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 9e-13
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 2e-12
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 2e-12
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 2e-12
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 3e-12
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 3e-12
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 5e-12
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 7e-12
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 1e-11
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 2e-11
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 2e-11
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 2e-11
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 2e-11
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 5e-10
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 7e-10
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 1e-09
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-09
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 1e-09
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 2e-09
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 2e-09
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 3e-09
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 3e-09
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 4e-09
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 9e-09
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 2e-08
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 4e-08
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 7e-08
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 3e-07
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 3e-07
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 6e-07
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 6e-07
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 2e-06
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 2e-06
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 5e-06
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 6e-06
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 2e-05
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 4e-05
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 5e-05
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 9e-05
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 1e-04
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 1e-04
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 1e-04
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 3e-04
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 3e-04
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 3e-04
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 3e-04
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 3e-04
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 7e-04
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 61/104 (58%), Gaps = 3/104 (2%)
Query: 1   MKNCGQILTKLMKHK---LGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYD 57
           +K+C +IL +++  K     + F +PVD   + LH+YYD++KNPMDLGT+K K+    Y 
Sbjct: 16  LKHCSEILKEMLAKKHLPYAWPFYNPVDADALGLHNYYDVVKNPMDLGTIKGKMDNQEYK 75
Query: 58  SPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPI 101
               FAADVRL F N   YNP DHEV  +A      FE  F  I
Sbjct: 76  DAYEFAADVRLMFMNCYKYNPPDHEVVAMARTLQDVFELHFAKI 119
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query382
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 5e-44
3p1f_A119 CREB-binding protein; structural genomics consorti 2e-43
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 2e-42
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 2e-40
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 2e-40
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 5e-40
4alg_A154 Bromodomain-containing protein 2; signaling protei 6e-40
3fkm_X166 Signaling protein; bromodomain, malaria, structura 2e-39
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 4e-37
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 1e-36
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 5e-36
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 1e-35
3dai_A130 ATPase family AAA domain-containing protein 2; anc 4e-35
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 4e-35
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 3e-34
2d9e_A121 Peregrin; four-helix bundle, transcription activat 6e-34
3d7c_A112 General control of amino acid synthesis protein 5; 7e-34
3nxb_A116 CAT eye syndrome critical region protein 2; struct 6e-33
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 1e-32
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 2e-31
3rcw_A135 Bromodomain-containing protein 1; transcription, s 5e-31
3uv4_A158 Second bromodomain of human transcription initiat 2e-30
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 9e-30
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 1e-25
3aad_A292 Transcription initiation factor TFIID subunit 1; p 8e-29
3aad_A292 Transcription initiation factor TFIID subunit 1; p 1e-24
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 2e-25
2grc_A129 Probable global transcription activator SNF2L4; br 9e-25
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-24
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-24
2r0y_A311 Chromatin structure-remodeling complex protein RSC 7e-24
2r0y_A311 Chromatin structure-remodeling complex protein RSC 8e-17
2jns_A90 Bromodomain-containing protein 4; ET-domain, struc 8e-24
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-23
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 8e-23
2dat_A123 Possible global transcription activator SNF2L2; br 3e-22
2r10_A361 Chromatin structure-remodeling complex protein RSC 3e-22
2r10_A361 Chromatin structure-remodeling complex protein RSC 1e-13
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 3e-22
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 1e-21
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-15
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 3e-15
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
 Score =  147 bits (374), Expect = 5e-44
 Identities = 46/110 (41%), Positives = 61/110 (55%), Gaps = 3/110 (2%)

Query: 1   MKNCGQILTKLMKHK---LGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYD 57
           +K C  IL ++   K     + F  PVDV  + LHDY DIIK+PMD+ T+KSKL    Y 
Sbjct: 11  LKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYR 70

Query: 58  SPASFAADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKLMQ 107
               F ADVRL F+N   YNP DHEV  +A +    FE  F  + ++  +
Sbjct: 71  DAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEE 120
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2jns_A Bromodomain-containing protein 4; ET-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 90 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query382
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.96
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.96
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.96
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.96
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.96
3d7c_A112 General control of amino acid synthesis protein 5; 99.96
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.96
3p1f_A119 CREB-binding protein; structural genomics consorti 99.96
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.95
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.95
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.95
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.95
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.95
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.95
2dat_A123 Possible global transcription activator SNF2L2; br 99.95
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.95
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.95
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.95
2grc_A129 Probable global transcription activator SNF2L4; br 99.95
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.95
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.95
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.94
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.94
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.94
3uv4_A158 Second bromodomain of human transcription initiat 99.93
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.93
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.92
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.92
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.92
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.91
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.91
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.91
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.9
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.9
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.89
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.89
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.87
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.86
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.81
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.8
2jns_A90 Bromodomain-containing protein 4; ET-domain, struc 99.73
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.71
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.59
2lm0_A125 AF4/FMR2 family member 1/protein AF-9 chimera; int 96.56
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
Probab=99.96  E-value=1.9e-29  Score=211.50  Aligned_cols=101  Identities=32%  Similarity=0.536  Sum_probs=97.6

Q ss_pred             ChHHHHHHHHHHhCCCCccccCCCCccccCCCccccccCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHhHhhhCCCC
Q 016813            1 MKNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKD   80 (382)
Q Consensus         1 mk~c~~il~~L~~~~~a~~F~~PVd~~~~~~pdY~~iIk~PMDL~tIk~kL~~~~Y~s~~eF~~Dv~Lif~Na~~yN~~~   80 (382)
                      ++.|..||..|++++.+|+|..||++..  +|+||++|++||||+||++||.+|.|.++.+|.+||+|||.||++||+++
T Consensus        15 ~~~c~~il~~l~~~~~s~~F~~pv~~~~--~pdY~~~I~~Pmdl~tI~~kl~~~~Y~~~~~f~~D~~li~~Na~~yN~~~   92 (117)
T 3g0l_A           15 LALCSMILTEMETHEDAWPFLLPVNLKL--VPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDD   92 (117)
T ss_dssp             HHHHHHHHHHHHTSTTCGGGSSCCCTTT--STTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCSS
T ss_pred             HHHHHHHHHHHHhCCCchhhcCcCChhh--cCChHHHcCCCCCHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Confidence            4789999999999999999999999987  99999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHH
Q 016813           81 HEVHIIAEQFLARFEELFRPINE  103 (382)
Q Consensus        81 s~v~~~A~~L~~~fe~~~~~~~~  103 (382)
                      +.++.+|..|++.|++.|+.+..
T Consensus        93 s~~~~~A~~L~~~f~~~~~~~~~  115 (117)
T 3g0l_A           93 SDIGRAGHNMRKYFEKKWTDTFK  115 (117)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHc
Confidence            99999999999999999998753
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2jns_A Bromodomain-containing protein 4; ET-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2lm0_A AF4/FMR2 family member 1/protein AF-9 chimera; intrinsically disordered, nuclear protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 382
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 3e-26
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 1e-25
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 4e-24
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 7e-23
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 9e-23
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 3e-21
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: TAFII250 double bromodomain module
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  100 bits (249), Expect = 3e-26
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 2/104 (1%)

Query: 4   CGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFA 63
              I+  +      Y F++PV+     + DYY II  PMDL T++  + K LY S   F 
Sbjct: 31  LESIINDMRDLPNTYPFHTPVNAK--VVKDYYKIITRPMDLQTLRENVRKRLYPSREEFR 88

Query: 64  ADVRLTFNNAMTYNPKDHEVHIIAEQFLARFEELFRPINEKLMQ 107
             + L   N+ TYN   H +  I++  L   +E  +   +KL +
Sbjct: 89  EHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLAR 132
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query382
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.95
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.95
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.94
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.94
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.94
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.95  E-value=1.3e-28  Score=202.61  Aligned_cols=99  Identities=35%  Similarity=0.533  Sum_probs=95.5

Q ss_pred             hHHHHHHHHHHhCCCCccccCCCCccccCCCccccccCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHhHhhhCCCCC
Q 016813            2 KNCGQILTKLMKHKLGYIFNSPVDVVGMALHDYYDIIKNPMDLGTVKSKLSKNLYDSPASFAADVRLTFNNAMTYNPKDH   81 (382)
Q Consensus         2 k~c~~il~~L~~~~~a~~F~~PVd~~~~~~pdY~~iIk~PMDL~tIk~kL~~~~Y~s~~eF~~Dv~Lif~Na~~yN~~~s   81 (382)
                      +.|..||..|++|+.+|+|..|||+..  +|+|+++|++||||+||++||.+|.|.++.+|.+||+|||.||++||++++
T Consensus         6 ~~l~~il~~l~~~~~a~pF~~pvd~~~--~pdY~~vI~~PmdL~tI~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yN~~~s   83 (111)
T d1e6ia_           6 AAIQNILTELQNHAAAWPFLQPVNKEE--VPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENT   83 (111)
T ss_dssp             HHHHHHHHHHHHSTTCGGGSSCCCTTT--STTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHHSCTTS
T ss_pred             HHHHHHHHHHHhCCCChhhcCCCCchh--CcCHHHHcCCchhHHHHHHHHHccccchHHHHHHHHHHHHHHHHHHCCCCC
Confidence            579999999999999999999999877  999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q 016813           82 EVHIIAEQFLARFEELFRPIN  102 (382)
Q Consensus        82 ~v~~~A~~L~~~fe~~~~~~~  102 (382)
                      .++.+|..|++.|+++|+.+.
T Consensus        84 ~i~~~A~~l~~~f~~~~~~ip  104 (111)
T d1e6ia_          84 SYYKYANRLEKFFNNKVKEIP  104 (111)
T ss_dssp             HHHHHHHHHHHHHHHHHHTSG
T ss_pred             HHHHHHHHHHHHHHHHHHHhh
Confidence            999999999999999997654
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure