Citrus Sinensis ID: 016845
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 381 | ||||||
| 357447595 | 610 | F-box/LRR-repeat protein [Medicago trunc | 0.979 | 0.611 | 0.744 | 1e-157 | |
| 255551539 | 601 | TRANSPORT INHIBITOR RESPONSE 1 protein, | 0.955 | 0.605 | 0.752 | 1e-154 | |
| 359477463 | 611 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.963 | 0.600 | 0.740 | 1e-154 | |
| 356549029 | 607 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.973 | 0.611 | 0.721 | 1e-150 | |
| 449474752 | 438 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.952 | 0.828 | 0.742 | 1e-147 | |
| 449454438 | 602 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.952 | 0.602 | 0.742 | 1e-147 | |
| 356549027 | 620 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.973 | 0.598 | 0.691 | 1e-146 | |
| 356563680 | 584 | PREDICTED: F-box/LRR-repeat protein 4-li | 0.910 | 0.594 | 0.695 | 1e-140 | |
| 21536497 | 610 | F-box protein family, AtFBL4 [Arabidopsi | 0.963 | 0.601 | 0.699 | 1e-137 | |
| 18414458 | 610 | F-box/LRR-repeat protein 4 [Arabidopsis | 0.963 | 0.601 | 0.694 | 1e-136 |
| >gi|357447595|ref|XP_003594073.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355483121|gb|AES64324.1| F-box/LRR-repeat protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Score = 561 bits (1447), Expect = e-157, Method: Compositional matrix adjust.
Identities = 279/375 (74%), Positives = 323/375 (86%), Gaps = 2/375 (0%)
Query: 1 MRGHDRINTCLPDEVILEIFRHLDSKASRDACSLVCRRWLTLERLSRTTLRIGASGSPDL 60
M+GHD INTCLPDE+I+EIFR LDSK +RDA SLVC RWL LERL+R+++RIGA+GSPDL
Sbjct: 1 MKGHDWINTCLPDELIVEIFRRLDSKPTRDAASLVCNRWLRLERLTRSSIRIGATGSPDL 60
Query: 61 FVKLLSRRFANVKSIHIDERLSVSIPVQHGRRRGDQSKLSALQLHYLTKKTGSEDGQFQS 120
FV+LL+ RF N+ ++HIDERLS+S+PVQ GRRR + S S+L+LHY+ K+ GS ++
Sbjct: 61 FVQLLASRFFNITAVHIDERLSISLPVQLGRRRENSSPSSSLKLHYVNKRIGSSSSSEEN 120
Query: 121 E--SYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSLAQKCIHLKSLDLQGCYVGD 178
E S LSD+GL ALADGF KLEKL LIWCSN++S GL SLA KC LKSLDLQGCYVGD
Sbjct: 121 EFDSLCLSDNGLIALADGFPKLEKLKLIWCSNVTSFGLSSLASKCASLKSLDLQGCYVGD 180
Query: 179 QGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVG 238
QGLAAVG+ C QLEDLNLRFCEGLTDTGLV+LA G GKSLKSLG+AAC KITD+S+EAV
Sbjct: 181 QGLAAVGQRCKQLEDLNLRFCEGLTDTGLVELALGVGKSLKSLGVAACAKITDISMEAVA 240
Query: 239 SHCKSLETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQCLSLELLA 298
SHC SLETLSLDSEF+HN+GV AVA+GCP L+ LKLQCIN+TD+AL AVG CLSLELLA
Sbjct: 241 SHCGSLETLSLDSEFVHNQGVLAVAKGCPHLKSLKLQCINLTDDALKAVGVSCLSLELLA 300
Query: 299 LYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIG 358
LYSFQ+FTDKGL A+G GCKKLKNLTLSDCYFLSD GLEAIATGCKELTHLE+NGCHNIG
Sbjct: 301 LYSFQRFTDKGLRAIGNGCKKLKNLTLSDCYFLSDKGLEAIATGCKELTHLEVNGCHNIG 360
Query: 359 TMGLESIGKFCRYAS 373
T+GL+S+GK C + S
Sbjct: 361 TLGLDSVGKSCLHLS 375
|
Source: Medicago truncatula Species: Medicago truncatula Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255551539|ref|XP_002516815.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] gi|223543903|gb|EEF45429.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359477463|ref|XP_002279087.2| PREDICTED: F-box/LRR-repeat protein 4-like [Vitis vinifera] gi|297736957|emb|CBI26158.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356549029|ref|XP_003542901.1| PREDICTED: F-box/LRR-repeat protein 4-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449474752|ref|XP_004154275.1| PREDICTED: F-box/LRR-repeat protein 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449454438|ref|XP_004144962.1| PREDICTED: F-box/LRR-repeat protein 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356549027|ref|XP_003542900.1| PREDICTED: F-box/LRR-repeat protein 4-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356563680|ref|XP_003550089.1| PREDICTED: F-box/LRR-repeat protein 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|21536497|gb|AAM60829.1| F-box protein family, AtFBL4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18414458|ref|NP_567467.1| F-box/LRR-repeat protein 4 [Arabidopsis thaliana] gi|75333365|sp|Q9C5D2.1|FBL4_ARATH RecName: Full=F-box/LRR-repeat protein 4; Short=AtFBL4 gi|13430832|gb|AAK26038.1|AF360328_1 putative F-box protein family, AtFBL4 [Arabidopsis thaliana] gi|13605655|gb|AAK32821.1|AF361808_1 AT4g15470/dl3775w [Arabidopsis thaliana] gi|15810599|gb|AAL07187.1| putative F-box protein family protein FBL4 [Arabidopsis thaliana] gi|332658208|gb|AEE83608.1| F-box/LRR-repeat protein 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 381 | ||||||
| TAIR|locus:505006471 | 610 | AT4G15475 "AT4G15475" [Arabido | 0.963 | 0.601 | 0.662 | 4.3e-125 | |
| UNIPROTKB|Q5R3Z8 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.622 | 0.560 | 0.318 | 2.4e-35 | |
| UNIPROTKB|Q9UKC9 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.622 | 0.560 | 0.318 | 8.1e-35 | |
| MGI|MGI:1919429 | 423 | Fbxl2 "F-box and leucine-rich | 0.622 | 0.560 | 0.318 | 1.3e-34 | |
| RGD|1562243 | 422 | Fbxl2 "F-box and leucine-rich | 0.622 | 0.561 | 0.314 | 2.1e-34 | |
| UNIPROTKB|F1PWK1 | 422 | FBXL2 "Uncharacterized protein | 0.622 | 0.561 | 0.314 | 4.4e-34 | |
| UNIPROTKB|F1NHD2 | 423 | FBXL2 "Uncharacterized protein | 0.622 | 0.560 | 0.338 | 7.1e-34 | |
| MGI|MGI:1919444 | 436 | Fbxl20 "F-box and leucine-rich | 0.632 | 0.552 | 0.310 | 1.1e-33 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.632 | 0.552 | 0.306 | 2.4e-33 | |
| UNIPROTKB|Q96IG2 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.632 | 0.552 | 0.306 | 2.4e-33 |
| TAIR|locus:505006471 AT4G15475 "AT4G15475" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1229 (437.7 bits), Expect = 4.3e-125, P = 4.3e-125
Identities = 247/373 (66%), Positives = 285/373 (76%)
Query: 1 MRGHDRINTCLPDEVILEIFRHLDSKASRDACSLVCXXXXXXXXXXXXXXXIGASGSPDL 60
MRGHDRIN CLP+E+ILEIFR L+SK +RDACSLVC IGAS SPD
Sbjct: 1 MRGHDRINNCLPEELILEIFRRLESKPNRDACSLVCKRWLSLERFSRTTLRIGASFSPDD 60
Query: 61 FVKLLSRRFANVKSIHIDERLSVSIPV---QHGRRRG-DQSKLSALQLHYLTKKTGSEDG 116
F+ LLSRRF + SIH+DER+SVS+P R+RG D S S+ + LT KT S G
Sbjct: 61 FISLLSRRFLYITSIHVDERISVSLPSLSPSPKRKRGRDSSSPSSSKRKKLTDKTHS--G 118
Query: 117 QFQSESYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSLAQKCIHLKSLDLQGCYV 176
ES L+D+GL ALA+GF ++E LSLIWC N+SS+GL SLAQKC LKSLDLQGCYV
Sbjct: 119 AENVESSSLTDTGLTALANGFPRIENLSLIWCPNVSSVGLCSLAQKCTSLKSLDLQGCYV 178
Query: 177 GDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEA 236
GDQGLAAVGK C QLE+LNLRFCEGLTD G++DL GC KSLKS+G+AA KITD+SLEA
Sbjct: 179 GDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCSKSLKSIGVAASAKITDLSLEA 238
Query: 237 VGSHCKSLETLSLDSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQCLSLEL 296
VGSHCK LE L LDSE+IH+KG+ AVAQGC L+ LKLQC++VTD A AVG C SLE
Sbjct: 239 VGSHCKLLEVLYLDSEYIHDKGLIAVAQGCHRLKNLKLQCVSVTDVAFAAVGELCTSLER 298
Query: 297 LALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHN 356
LALYSFQ FTDKG+ A+GKG KKLK+LTLSDCYF+S GLEAIA GCKEL +EINGCHN
Sbjct: 299 LALYSFQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERVEINGCHN 358
Query: 357 IGTMGLESIGKFC 369
IGT G+E+IGK C
Sbjct: 359 IGTRGIEAIGKSC 371
|
|
| UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 381 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 3e-19 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 9e-18 | |
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 7e-06 | |
| smart00256 | 41 | smart00256, FBOX, A Receptor for Ubiquitination Ta | 2e-05 | |
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 7e-04 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 85.5 bits (212), Expect = 3e-19
Identities = 58/199 (29%), Positives = 86/199 (43%), Gaps = 14/199 (7%)
Query: 186 KVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSHCKSLE 245
+ + LE L L C D L L LK L + I D L A+ C +L+
Sbjct: 25 ILHSGLEWLELYMCPIS-DPPLDQL--SNCNKLKKLILPGSKLIDDEGLIALAQSCPNLQ 81
Query: 246 TLSLD-SEFIHNKGVHAVAQGCPLLRVLKL----QCINVTDEALVAVGNQCLSLELLALY 300
L L E I + G+ A+A CP L+ + L +TD +L A+G C L+ +
Sbjct: 82 VLDLRACENITDSGIVALATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTVGF- 140
Query: 301 SFQQFTDKGLHAVGKGC-KKLKNLTLSDCYFLSDMGLEAI--ATGCKELTHLEINGCHNI 357
+ TDKG+ + GC K L+ L+L++C L+D + AI + L+ LE GC I
Sbjct: 141 AGCDVTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLSVLEFRGCPLI 200
Query: 358 GTMGLESIGKFCRYASFCR 376
I F +
Sbjct: 201 --TDFSRIILFKLWQPRLN 217
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
| >gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 381 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 100.0 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.97 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.93 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.71 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.7 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.61 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.6 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.57 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.38 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.33 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.33 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.31 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.28 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.22 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 99.09 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.08 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.03 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.01 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.95 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.87 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.84 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.82 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.77 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.74 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.73 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.54 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.49 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.45 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.36 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.36 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.36 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.32 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.32 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.23 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.23 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.1 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.1 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.9 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.67 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.59 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.58 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.5 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.5 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.46 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.23 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 97.15 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.15 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 97.07 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 97.03 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.8 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.79 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.72 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 96.69 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.62 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.61 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.6 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.5 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.24 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.13 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.1 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.02 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 95.81 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.62 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.55 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.54 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 95.48 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.39 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 94.94 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 94.83 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 94.8 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 94.53 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 94.39 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 93.69 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 93.14 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 92.64 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 92.14 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 91.26 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 90.83 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 90.69 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 89.96 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 88.81 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 86.72 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 86.13 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 85.41 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 84.98 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 84.39 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 82.82 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-33 Score=233.82 Aligned_cols=353 Identities=27% Similarity=0.423 Sum_probs=235.9
Q ss_pred ccccCCCHHHHHHHHhcCCChhhhhhHHHhhhhHHHhhhcccceeeeccCCC----chHHHHHHHHhC-CCceEeeecCc
Q 016845 6 RINTCLPDEVILEIFRHLDSKASRDACSLVCRRWLTLERLSRTTLRIGASGS----PDLFVKLLSRRF-ANVKSIHIDER 80 (381)
Q Consensus 6 ~i~~~LP~eil~~If~~L~~~~d~~~~~~Vcr~W~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~-~~~~~l~~~~~ 80 (381)
.++..||+|++..||++|+ .+.+++++++|+.|+..+.+-.-|-+++.... +..++....+++ .+++.+.+.+.
T Consensus 70 ~~~~~LPpEl~lkvFS~LD-tksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG~ 148 (483)
T KOG4341|consen 70 SISRSLPPELLLKVFSMLD-TKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRGC 148 (483)
T ss_pred cccccCCHHHHHHHHHHHh-HHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhcccccccccccc
Confidence 3455899999999999999 69999999999999999998888888875432 223344444443 35566665554
Q ss_pred eeeecccccCCccCccccccccccceeccccCCCcccccccceeeChHHHHHHHhcCCCccEEecCCCCCCChHHHHHHH
Q 016845 81 LSVSIPVQHGRRRGDQSKLSALQLHYLTKKTGSEDGQFQSESYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSLA 160 (381)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~ 160 (381)
.......- +.. ....-.+.. +.......+++..+..++++|++|++|++..|..+++..+..+.
T Consensus 149 r~v~~ssl----rt~--~~~CpnIeh----------L~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la 212 (483)
T KOG4341|consen 149 RAVGDSSL----RTF--ASNCPNIEH----------LALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLA 212 (483)
T ss_pred ccCCcchh----hHH--hhhCCchhh----------hhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHH
Confidence 33210000 000 000000000 00111224555555555556666666666555555555555555
Q ss_pred HhCCCCCEEEeeccc-cChhHHHHHHhhCCCCCeEeccCCCCCChHHHHHHHhhcCcCccEEeccCCCCCCHHHHHHHHh
Q 016845 161 QKCIHLKSLDLQGCY-VGDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGS 239 (381)
Q Consensus 161 ~~~~~L~~L~l~~~~-~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~ 239 (381)
.+|++|++++++.|. +.+.+++.+...+.+++.+.+.+|.....+.+......+ +-+..+++..|..+++.++..+..
T Consensus 213 ~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~-~~i~~lnl~~c~~lTD~~~~~i~~ 291 (483)
T KOG4341|consen 213 EGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYC-LEILKLNLQHCNQLTDEDLWLIAC 291 (483)
T ss_pred HhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccC-hHhhccchhhhccccchHHHHHhh
Confidence 556666666665554 444455555555555555555555545544444444433 445556666676777777777777
Q ss_pred cCCCCCEEEccc-CCCChhHHHHHHhcCCCCcEEEee-cccCCHHHHHHHHhcCCCCCeEeccCCCCCCHHHHHHHHhcC
Q 016845 240 HCKSLETLSLDS-EFIHNKGVHAVAQGCPLLRVLKLQ-CINVTDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGC 317 (381)
Q Consensus 240 ~~~~L~~L~l~~-~~~~~~~~~~~~~~~~~L~~L~l~-~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~ 317 (381)
.+..|+.|+.++ ..+++..+..+.+.+++|+.|.+. |..+++..+..+..+++.|+.+++.++..+++..+..++.+|
T Consensus 292 ~c~~lq~l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C 371 (483)
T KOG4341|consen 292 GCHALQVLCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDGTLASLSRNC 371 (483)
T ss_pred hhhHhhhhcccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhhhHhhhccCC
Confidence 778888888877 457777778888888888888885 777888888888888888888888888877877788888889
Q ss_pred CCCCEEeccCCCCCCHHHHHHHHh---cCCCCCEEeccCCCCCChHHHHHHHhcCCccceeEc
Q 016845 318 KKLKNLTLSDCYFLSDMGLEAIAT---GCKELTHLEINGCHNIGTMGLESIGKFCRYASFCRL 377 (381)
Q Consensus 318 ~~L~~L~l~~~~~i~~~~l~~l~~---~~~~L~~L~l~~c~~~~~~~~~~l~~~~~~L~~l~l 377 (381)
+.|+.+.++.|..++|+++..+.. +...|+.+++.+|+.++++.++.+. .|++|+.+++
T Consensus 372 ~~lr~lslshce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~l~-~c~~Leri~l 433 (483)
T KOG4341|consen 372 PRLRVLSLSHCELITDEGIRHLSSSSCSLEGLEVLELDNCPLITDATLEHLS-ICRNLERIEL 433 (483)
T ss_pred chhccCChhhhhhhhhhhhhhhhhccccccccceeeecCCCCchHHHHHHHh-hCcccceeee
Confidence 999999999998888887776644 4578889999999988887777665 6899998654
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 381 | ||||
| 3ogk_B | 592 | Structure Of Coi1-Ask1 In Complex With Coronatine A | 2e-11 | ||
| 2p1m_B | 594 | Tir1-ask1 Complex Structure Length = 594 | 2e-07 |
| >pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 | Back alignment and structure |
|
| >pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 381 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-64 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 8e-40 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 8e-36 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-21 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-57 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 7e-39 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-38 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-36 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-27 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-23 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-09 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 4e-45 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-14 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-18 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-17 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-17 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 5e-17 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 1e-15 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 5e-12 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 6e-07 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-16 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 4e-11 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-09 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-14 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 4e-14 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 6e-12 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 1e-08 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 8e-14 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 4e-10 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 7e-09 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 1e-07 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 2e-04 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 1e-07 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 3e-07 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 9e-07 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 4e-04 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 3e-07 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 3e-06 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 1e-04 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-05 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
Score = 214 bits (546), Expect = 3e-64
Identities = 91/388 (23%), Positives = 146/388 (37%), Gaps = 38/388 (9%)
Query: 4 HDRINTCLPDEVILEIFRHLDSKASRDACSLVCRRWLTLERLSRTTLRIGASGSPDLFVK 63
RI P+EV+ +F + R++ SLVC+ W +ER R + IG +
Sbjct: 2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCY--AVSPA 59
Query: 64 LLSRRFANVKSIHIDERLSVS----IPVQHGRRRGDQSKLSALQLHYLTKKTGSEDGQFQ 119
+ RRF V+S+ + + + +P G + + +L +
Sbjct: 60 TVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLK------ 113
Query: 120 SESYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSLAQKCIHLKSLDLQGCYV--- 176
++D L +A F + L L C S+ GL ++A C +LK LDL+ V
Sbjct: 114 --RMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDV 171
Query: 177 GDQGLAAVGKVCNQLEDLNLRFCEG-LTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLE 235
L+ L LN+ ++ + L L C +LKSL + V + L
Sbjct: 172 SGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRC-PNLKSLKLNRAVPLEK--LA 228
Query: 236 AVGSHCKSLETLSL-----DSEFIHNKGVHAVAQGCPLLRVLKLQCINVTDEALVAVGNQ 290
+ LE L + G+ GC LR L + L AV +
Sbjct: 229 TLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSG-FWDAVPAYLPAVYSV 287
Query: 291 CLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLE 350
C L L L S+ L + C KL+ L + ++ D GLE +A+ CK+L L
Sbjct: 288 CSRLTTLNL-SYATVQSYDLVKLLCQCPKLQRLWV--LDYIEDAGLEVLASTCKDLRELR 344
Query: 351 I--------NGCHNIGTMGLESIGKFCR 370
+ + GL S+ C
Sbjct: 345 VFPSEPFVMEPNVALTEQGLVSVSMGCP 372
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 381 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 100.0 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 100.0 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 100.0 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.91 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.91 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.84 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.84 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.82 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.81 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.79 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.72 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.62 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.6 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.55 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.51 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.46 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.45 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.44 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.43 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.41 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.4 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.38 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.37 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.35 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.35 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.33 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.33 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.31 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.31 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.3 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.29 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.29 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.29 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.29 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.29 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.28 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.28 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.27 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.26 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.26 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.25 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.24 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.23 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.23 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.22 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.22 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.21 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.21 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.21 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.21 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.2 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.2 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.19 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.19 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.19 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.18 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.18 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.18 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.17 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.17 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.16 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.16 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.15 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.14 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.14 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.14 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.13 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.13 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.11 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.08 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.08 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.06 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.03 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.03 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.02 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.02 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.02 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.01 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.01 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.97 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.96 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.95 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.94 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.93 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.93 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.92 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.91 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.91 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.9 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.9 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.9 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.88 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.88 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.83 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.8 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.79 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.77 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.75 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.75 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.7 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.68 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.68 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.64 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.61 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.6 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.56 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.51 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.49 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.45 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.45 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.43 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.42 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.4 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.34 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.34 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.34 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.33 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.33 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.3 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.27 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.24 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.23 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.23 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.22 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.21 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.19 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.16 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.15 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.15 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.15 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.12 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.1 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.04 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.94 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.91 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.78 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.72 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.67 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.61 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.54 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.5 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.5 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.42 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.25 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.25 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.14 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.02 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.56 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.31 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.29 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.24 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.43 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.37 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 93.94 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 93.58 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 92.16 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 80.51 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-34 Score=270.40 Aligned_cols=362 Identities=24% Similarity=0.355 Sum_probs=190.9
Q ss_pred CccccccCCCHHHHHHHHhcCCChhhhhhHHHhhhhHHHhhhcccceeeeccCCCchHHHHHHHHhCCCceEeeecCcee
Q 016845 3 GHDRINTCLPDEVILEIFRHLDSKASRDACSLVCRRWLTLERLSRTTLRIGASGSPDLFVKLLSRRFANVKSIHIDERLS 82 (381)
Q Consensus 3 ~~~~i~~~LP~eil~~If~~L~~~~d~~~~~~Vcr~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ 82 (381)
+.|.++ .||+||+.+||+||+..+|++++++|||+|+++....+..+.+..... .....+..++++++.+.+.....
T Consensus 2 ~~d~~~-~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~--~~~~~~~~~~~~L~~L~L~~~~~ 78 (594)
T 2p1m_B 2 QKRIAL-SFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYA--VSPATVIRRFPKVRSVELKGKPH 78 (594)
T ss_dssp ---------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTS--SCHHHHHHHCTTCCEEEEECSCG
T ss_pred cccchh-hCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccc--cCHHHHHhhCCCceEEeccCCCc
Confidence 346666 899999999999999558999999999999999544444444433222 23346678899999999987543
Q ss_pred eecccccCCccCccccccccccceecc---ccCCCcccccccceeeChHHHHHHHhcCCCccEEecCCCCCCChHHHHHH
Q 016845 83 VSIPVQHGRRRGDQSKLSALQLHYLTK---KTGSEDGQFQSESYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSL 159 (381)
Q Consensus 83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~l~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~ 159 (381)
......... .+.....+|.. .........++....+++..+..+.+.+++|++|++.+|..++..++..+
T Consensus 79 ~~~~~l~~~-------~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~l~~~ 151 (594)
T 2p1m_B 79 FADFNLVPD-------GWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAI 151 (594)
T ss_dssp GGGGTCSCT-------TSCCBCHHHHHHHHHHCTTCCEEEEESCBCCHHHHHHHHHHCTTCCEEEEESCEEEEHHHHHHH
T ss_pred hhhcccccc-------cccchhhHHHHHHHHhCCCCCeEEeeCcEEcHHHHHHHHHhCCCCcEEeCCCcCCCCHHHHHHH
Confidence 321100000 00000001100 01111122244445577777877776788999999988766777778888
Q ss_pred HHhCCCCCEEEeeccccChhH---HHHHHhhCCCCCeEeccCCC-CCChHHHHHHHhhcCcCccEEeccCCCCCC-----
Q 016845 160 AQKCIHLKSLDLQGCYVGDQG---LAAVGKVCNQLEDLNLRFCE-GLTDTGLVDLAHGCGKSLKSLGIAACVKIT----- 230 (381)
Q Consensus 160 ~~~~~~L~~L~l~~~~~~~~~---~~~~~~~~~~L~~L~l~~~~-~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~----- 230 (381)
..++++|++|++++|.+++.. +..+...+++|++|+++++. .+....+..+...+ ++|+.|++.+|..+.
T Consensus 152 ~~~~~~L~~L~L~~~~i~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~-~~L~~L~L~~~~~~~~l~~~ 230 (594)
T 2p1m_B 152 AATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRC-PNLKSLKLNRAVPLEKLATL 230 (594)
T ss_dssp HHHCTTCCEEECTTCEEECCCGGGGGGSCTTCCCCCEEECTTCCSCCCHHHHHHHHHHC-TTCCEEECCTTSCHHHHHHH
T ss_pred HHhCCCCCEEeCcCCccCCcchHHHHHHhhcCCcCcEEEecccCCcCCHHHHHHHHHhC-CCCcEEecCCCCcHHHHHHH
Confidence 778888888888877644322 22223344555555555543 23344444443333 455555554431110
Q ss_pred -----------------------------------------------HHHHHHHHhcCCCCCEEEcccCCCChhHHHHHH
Q 016845 231 -----------------------------------------------DVSLEAVGSHCKSLETLSLDSEFIHNKGVHAVA 263 (381)
Q Consensus 231 -----------------------------------------------~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~ 263 (381)
...+..+...+++|++|+++++.+++..+..+.
T Consensus 231 ~~~~~~L~~L~l~~~~~~~~~~~~~~l~~~l~~~~~L~~Ls~~~~~~~~~l~~~~~~~~~L~~L~L~~~~l~~~~l~~~~ 310 (594)
T 2p1m_B 231 LQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLL 310 (594)
T ss_dssp HHHCTTCSEEECSBCCCCCCHHHHHHHHHHHHTCTTCCEEECCBTCCGGGGGGGHHHHTTCCEEECTTCCCCHHHHHHHH
T ss_pred HhcCCcceEcccccccCccchhhHHHHHHHHhcCCCcccccCCcccchhhHHHHHHhhCCCCEEEccCCCCCHHHHHHHH
Confidence 001111112345555555555555555555555
Q ss_pred hcCCCCcEEEeecccCCHHHHHHHHhcCCCCCeEec--------cCCCCCCHHHHHHHHhcCCCCCEEeccCCCCCCHHH
Q 016845 264 QGCPLLRVLKLQCINVTDEALVAVGNQCLSLELLAL--------YSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMG 335 (381)
Q Consensus 264 ~~~~~L~~L~l~~~~~~~~~l~~l~~~~~~L~~L~l--------~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~i~~~~ 335 (381)
..+++|+.|++..+ +.+..+..+...+++|++|++ .++..+++.++..+...+++|++|.+. |..+++..
T Consensus 311 ~~~~~L~~L~l~~~-~~~~~l~~l~~~~~~L~~L~L~~~~~~g~~~~~~l~~~~l~~l~~~~~~L~~L~~~-~~~l~~~~ 388 (594)
T 2p1m_B 311 CQCPKLQRLWVLDY-IEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYF-CRQMTNAA 388 (594)
T ss_dssp TTCTTCCEEEEEGG-GHHHHHHHHHHHCTTCCEEEEECSCTTCSSCSSCCCHHHHHHHHHHCTTCCEEEEE-ESCCCHHH
T ss_pred hcCCCcCEEeCcCc-cCHHHHHHHHHhCCCCCEEEEecCcccccccCCCCCHHHHHHHHHhchhHHHHHHh-cCCcCHHH
Confidence 55556666665543 444444444444555555555 223344555555444445555555332 23445544
Q ss_pred HHHHHhcCCCCCEEecc-----CCCCCC----hHHHHHHHhcCCccceeEc
Q 016845 336 LEAIATGCKELTHLEIN-----GCHNIG----TMGLESIGKFCRYASFCRL 377 (381)
Q Consensus 336 l~~l~~~~~~L~~L~l~-----~c~~~~----~~~~~~l~~~~~~L~~l~l 377 (381)
+..+...+++|+.|++. +|..++ +.++..+...|++|+.|++
T Consensus 389 ~~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~l~~~~~~L~~L~L 439 (594)
T 2p1m_B 389 LITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSL 439 (594)
T ss_dssp HHHHHHHCTTCCEEEEEESSTTCCCTTTCCCTHHHHHHHHHHCTTCCEEEC
T ss_pred HHHHHhhCCCcceeEeecccCCCcccccCCchhhHHHHHHhhCCCccEEee
Confidence 44444445555555554 344444 3444444444444444444
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 381 | ||||
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 1e-10 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 5e-07 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 5e-04 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 2e-06 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 2e-05 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 1e-04 | |
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 3e-04 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 59.3 bits (142), Expect = 1e-10
Identities = 46/249 (18%), Positives = 91/249 (36%), Gaps = 13/249 (5%)
Query: 128 SGLNALADGFSKLEKLSLIW--CSNISSLGLMSLAQKCIHLKSLDLQGCYVGDQGLAAVG 185
+G N D +L +I C ++ ++ +DL + L +
Sbjct: 8 TGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGIL 67
Query: 186 KVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSHCKSLE 245
C++L++L+L L+D + LA +L L ++ C ++ +L+ + S C L+
Sbjct: 68 SQCSKLQNLSLEGLR-LSDPIVNTLAKNS--NLVRLNLSGCSGFSEFALQTLLSSCSRLD 124
Query: 246 TLSLDSEFIHNKGVH----AVAQGCPLLRVLKLQCINVTDEALVAVGNQCLSLELLALYS 301
L+L F + A L N+ L + +C +L L L
Sbjct: 125 ELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSD 184
Query: 302 FQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTMG 361
+ + L++L+LS CY + L + L L++ G +
Sbjct: 185 SVMLKNDCFQEFFQ-LNYLQHLSLSRCYDIIPETLLELG-EIPTLKTLQVFGI--VPDGT 240
Query: 362 LESIGKFCR 370
L+ + +
Sbjct: 241 LQLLKEALP 249
|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 381 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.93 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.91 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.65 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.61 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.61 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.58 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.04 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.03 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.98 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.96 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.93 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.87 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.86 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.85 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.76 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.75 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.73 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.71 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.68 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.68 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.67 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.65 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.65 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.63 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.61 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.58 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.5 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.48 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.41 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.36 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.32 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.32 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.29 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.26 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.97 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.85 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.69 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.63 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.59 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.32 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.29 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.09 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.95 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.37 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.18 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=1.4e-24 Score=182.60 Aligned_cols=243 Identities=18% Similarity=0.210 Sum_probs=192.9
Q ss_pred ccceeeChHHHHHHHhcCCCccEEecCCCCCCChHHHHHHHHhCCCCCEEEeeccccChhHHHHHHhhCCCCCeEeccCC
Q 016845 120 SESYYLSDSGLNALADGFSKLEKLSLIWCSNISSLGLMSLAQKCIHLKSLDLQGCYVGDQGLAAVGKVCNQLEDLNLRFC 199 (381)
Q Consensus 120 l~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~ 199 (381)
+....+.+..+..+... .+..+.+.... +.... . ......+|++|+++++.+++..+..+...|++|++|++++|
T Consensus 7 Ls~~~l~~~~l~~l~~~--~~~~lrl~~~~-~~~~~-~-~~~~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~ 81 (284)
T d2astb2 7 LTGKNLHPDVTGRLLSQ--GVIAFRCPRSF-MDQPL-A-EHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGL 81 (284)
T ss_dssp CTTCBCCHHHHHHHHHT--TCSEEECTTCE-ECSCC-C-SCCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTC
T ss_pred CCCCCCCchHHHHHHhc--cceEeeccccc-cccch-h-hhccCCCCCEEECCCCccCHHHHHHHHHhCCCccccccccc
Confidence 33444566667666653 33444443321 11100 0 01134689999999999998888888889999999999998
Q ss_pred CCCChHHHHHHHhhcCcCccEEeccCCCCCCHHHHHHHHhcCCCCCEEEcccC-CCChhHHHHH-HhcCCCCcEEEee--
Q 016845 200 EGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSHCKSLETLSLDSE-FIHNKGVHAV-AQGCPLLRVLKLQ-- 275 (381)
Q Consensus 200 ~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~-~~~~~~~~~~-~~~~~~L~~L~l~-- 275 (381)
. +++..+..+.. + ++|++|++++|..+++.++..+...+|+|++|++++| .++++++... ...+++|+.|.++
T Consensus 82 ~-l~~~~~~~l~~-~-~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~ 158 (284)
T d2astb2 82 R-LSDPIVNTLAK-N-SNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGY 158 (284)
T ss_dssp B-CCHHHHHHHTT-C-TTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSC
T ss_pred C-CCcHHHHHHhc-C-CCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhcccccccchhhhccc
Confidence 6 77777766644 3 7999999999999999999988889999999999985 5777776554 4456899999997
Q ss_pred cccCCHHHHHHHHhcCCCCCeEeccCCCCCCHHHHHHHHhcCCCCCEEeccCCCCCCHHHHHHHHhcCCCCCEEeccCCC
Q 016845 276 CINVTDEALVAVGNQCLSLELLALYSFQQFTDKGLHAVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCH 355 (381)
Q Consensus 276 ~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~i~~~~l~~l~~~~~~L~~L~l~~c~ 355 (381)
+..+++..+..+...||+|++|++++|..++++++..+.+ +++|++|++++|..+++.++..+.. +|+|+.|++.+|
T Consensus 159 ~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~-~~~L~~L~L~~C~~i~~~~l~~L~~-~~~L~~L~l~~~- 235 (284)
T d2astb2 159 RKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-LNYLQHLSLSRCYDIIPETLLELGE-IPTLKTLQVFGI- 235 (284)
T ss_dssp GGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGG-CTTCCEEECTTCTTCCGGGGGGGGG-CTTCCEEECTTS-
T ss_pred ccccccccccccccccccccccccccccCCCchhhhhhcc-cCcCCEEECCCCCCCChHHHHHHhc-CCCCCEEeeeCC-
Confidence 3568888898888899999999999998899988887765 8999999999999999998888754 999999999998
Q ss_pred CCChHHHHHHHhcCCccce
Q 016845 356 NIGTMGLESIGKFCRYASF 374 (381)
Q Consensus 356 ~~~~~~~~~l~~~~~~L~~ 374 (381)
+++.++..+.+.||+|+.
T Consensus 236 -~~d~~l~~l~~~lp~L~i 253 (284)
T d2astb2 236 -VPDGTLQLLKEALPHLQI 253 (284)
T ss_dssp -SCTTCHHHHHHHSTTSEE
T ss_pred -CCHHHHHHHHHhCccccc
Confidence 788899999999999875
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|