Citrus Sinensis ID: 016972

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MDITPTNNNTLNTNTNSKSPETDTTDNHQTGATRIHSAKPLTFTNGVLKRHQPQPQHHQRHHHHHHHHPIVVTYKECLKNHAASIGGHALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHRREPDQDHHLPHVPTTATTATIEYQPHHRHHPPPPVTQPPSRRSPSSASPPPISSSYYPSAPHMLLALSGNLQQSSAAAAVPQENHHISNNHHHNNNNIMMSNSGGSSGGRKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTFAKRDLNGAGGSGSGSAGGGIGRINLDDDNTGNDNINNSKSGDGDDQDEEEGINNNNNGVRNLNHQFGSATESAAHVANANGGSSSSS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccEEEEccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccEEEEEHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccEccccHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHccccccccccc
mditptnnntlntntnskspetdttdnhqtgatrihsakpltftngvlkrhqpqpqhhqrhhhhhhhhpIVVTYKECLKNHAAsigghaldgcgefmpsptatpsdptslkcaacgchrnfhrrepdqdhhlphvpttattatieyqphhrhhppppvtqppsrrspssaspppisssyypsapHMLLALSGnlqqssaaaavpqenhhisnnhhhnnnnimmsnsggssggrkrfRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNnkstfakrdlngaggsgsgsagggigrinldddntgndninnsksgdgddqdeeeginnnnngvrnlnhqfgsatESAAHVananggsssss
mditptnnntlntntnskspetdTTDNHQTGATRIHSAKPLTFTNGVLKRHQPQPQHHQRHHHHHHHHPIVVTYKECLKNHAASIGGHALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHrrepdqdhhlphVPTTATTATIEYQPHHRHHPPPPVTQPPSRRSPSSASPPPISSSYYPSAPHMLLALSGNLQQSSAAAAVPQENHHISNNHHHNNNNIMMSNSGGSSGGRKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKStfakrdlngaggSGSGSAGGGIGRINLDDDNTGNDNINNsksgdgddqdEEEGINNNNNGVRNLNHQFGSATESAAHVANanggsssss
MDItptnnntlntntnSKSPETDTTDNHQTGATRIHSAKPLTFTNGVLKrhqpqpqhhqrhhhhhhhhpIVVTYKECLKNHAASIGGHALDGCGEFMpsptatpsdptsLKCAACGCHRNFHRREPDQDHHLPHVPTTATTATIEYQphhrhhppppvtqppsrrspssaspppisssyypsaphMLLALSGNLQQSSAAAAVPQEnhhisnnhhhnnnnimmsnsggssggRKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTFAKRDLNgaggsgsgsagggigRInldddntgndninnSKSgdgddqdeeeginnnnngVRNLNHQFGSATEsaahvananggsssss
*********************************************************************IVVTYKECLKNHAASIGGHALDGCGEF**************KCAACGCHRNF*******************************************************************************************************************************FEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKS*****************************************************************************************
***********************************************************************VTYKECLKNHAASIGGHALDGCGEFMP******SDPTSLKCAACGCHRNFHRREPD*******************************************************************************************************************SQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNK******************************************************************************************
MDITPTNNNTLNTNTN**************GATRIHSAKPLTFTNGVLK********************IVVTYKECLKNHAASIGGHALDGCGEFMPS**********LKCAACGCHRNFHRREPDQDHHLPHVPTTATTATIEY*****************************SSSYYPSAPHMLLALSGNLQ*********QENHHISNNHHHNNNNIMMSN********************EKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTFAKRDLNG********AGGGIGRINLDDDNTGNDNINNSK**********EGINNNNNGVRNLNHQFGSATESAAHV***********
*************************************AKPLTFTNGVLK*****************HHPIVVTYKECLKNHAASIGGHALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHRREPDQDHHLPHVPTTATTATIEYQPHHRHHPPPPVTQPPSRRSPSSASPPPISSSYYPSAPHMLLAL*********************************************FRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKST****************************************************INNNNNGVRNLNHQF*********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDITPTNNNTLNTNTNSKSPETDTTDNHQTGATRIHSAKPLTFTNGVLKRHQPQPQHHQRHHHHHHHHPIVVTYKECLKNHAASIGGHALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHRREPDQDHHLPHVPTTATTATIEYQPHHRHHPPPPVTQPPSRRSPSSASPPPISSSYYPSAPHMLLALSGNLQQSSAAAAVPQENHHISNNHHHNNNNIMMSNSGGSSGGRKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTFAKRDLNGAGGSGSGSAGGGIGRINLDDDNTGNDNINNSKSGDGDDQDEEEGINNNNNGVRNLNHQFGSATESAAHVANANGGSSSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query379 2.2.26 [Sep-21-2011]
Q9SEZ1242 Transcription factor HB29 no no 0.496 0.776 0.465 7e-49
Q9SB61220 ZF-HD homeobox protein At no no 0.456 0.786 0.415 9e-37
Q9FKP8279 ZF-HD homeobox protein At no no 0.467 0.634 0.396 8e-36
>sp|Q9SEZ1|HB29_ARATH Transcription factor HB29 OS=Arabidopsis thaliana GN=HB29 PE=1 SV=1 Back     alignment and function desciption
 Score =  194 bits (494), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 107/230 (46%), Positives = 134/230 (58%), Gaps = 42/230 (18%)

Query: 72  VTYKECLKNHAASIGGHALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHRREPDQDHH 131
           V YKECLKNHAA++GGHALDGCGEFMPSPTAT +DP+SL+CAACGCHRNFHRR+P ++ +
Sbjct: 29  VCYKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSENLN 88

Query: 132 LPHVPTTATTATIEYQPHHRHHPPPPVTQPPSRRSPSSASPPPISSSYYPSAP--HMLLA 189
               P  ++ +  E               PPSR   S     P+  SYY SAP  H++L+
Sbjct: 89  FLTAPPISSPSGTE--------------SPPSRHVSS-----PVPCSYYTSAPPHHVILS 129

Query: 190 LSGNLQQSSAAAAVPQENHHISNNHHHNNNNIMMSNSGGSSGGRKRFRTKFSQSQKEKMF 249
           LS      S                   +  ++ S +      RKR RTKF+  QK KM 
Sbjct: 130 LSSGFPGPS-----------------DQDPTVVRSENSSRGAMRKRTRTKFTPEQKIKMR 172

Query: 250 EFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTFAKRDLNG 299
            FAE+ GWK+   D+  V EFCNEVG++R VLKVWMHNNK +     LNG
Sbjct: 173 AFAEKAGWKINGCDEKSVREFCNEVGIERGVLKVWMHNNKYSL----LNG 218
Transcription factor involved in the up-regulation of several stress-inducible genes. Acts as a transcriptional activator by interacting with MED25 and NAC proteins. Involved in increased drought tolerance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SB61|Y4466_ARATH ZF-HD homeobox protein At4g24660 OS=Arabidopsis thaliana GN=At4g24660 PE=1 SV=1 Back     alignment and function description
>sp|Q9FKP8|Y5541_ARATH ZF-HD homeobox protein At5g65410 OS=Arabidopsis thaliana GN=At5g65410 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
357501809341 ZF-HD homeobox protein [Medicago truncat 0.675 0.750 0.583 3e-70
225452813341 PREDICTED: ZF-HD homeobox protein At4g24 0.649 0.721 0.621 3e-70
255586792335 conserved hypothetical protein [Ricinus 0.704 0.797 0.576 3e-66
224077726241 predicted protein [Populus trichocarpa] 0.625 0.983 0.674 9e-66
449459474298 PREDICTED: transcription factor HB29-lik 0.683 0.869 0.583 1e-64
224141391243 predicted protein [Populus trichocarpa] 0.625 0.975 0.659 2e-64
449522934307 PREDICTED: transcription factor HB29-lik 0.699 0.863 0.593 3e-63
164562231302 zinc finger-homeodomain protein 1, parti 0.675 0.847 0.597 2e-60
356550836331 PREDICTED: ZF-HD homeobox protein At4g24 0.604 0.691 0.527 3e-60
356568656338 PREDICTED: ZF-HD homeobox protein At4g24 0.688 0.772 0.566 6e-60
>gi|357501809|ref|XP_003621193.1| ZF-HD homeobox protein [Medicago truncatula] gi|124359224|gb|ABN05735.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich dimerisation region; Homeodomain-like [Medicago truncatula] gi|124360958|gb|ABN08930.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich dimerisation region; Homeodomain-like [Medicago truncatula] gi|355496208|gb|AES77411.1| ZF-HD homeobox protein [Medicago truncatula] Back     alignment and taxonomy information
 Score =  271 bits (694), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 168/288 (58%), Positives = 198/288 (68%), Gaps = 32/288 (11%)

Query: 10  TLNTNTNSKSPETDTTDNHQTGATRIHSAKPLT-FTNGVLKRHQPQPQHHQRHHHHHHHH 68
           T +T T +KSPE        T      +   ++ F+NGVLKR      H   H++H    
Sbjct: 27  TASTTTLTKSPEQQHETETPTTKFTTSTTPKISPFSNGVLKRFHHHHHHFNHHNNHQP-- 84

Query: 69  PIVVTYKECLKNHAASIGGHALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHRREPDQ 128
              +TYKECLKNHAA++GGHALDGCGEFM SPTATP+DPTSLKCAACGCHRNFHRREP++
Sbjct: 85  --TITYKECLKNHAANLGGHALDGCGEFMTSPTATPTDPTSLKCAACGCHRNFHRREPEE 142

Query: 129 DHHLPHVPTTATTATIEYQPHHRHHPPPPVTQPPSRRSPSSASPPPISSSYYPSAPHMLL 188
                  P   TT  IEYQPHHRH P PP   P S RSP+S+SPPPISSSYYPSAPHMLL
Sbjct: 143 -------PPLTTTHVIEYQPHHRHQPLPP--PPFSHRSPNSSSPPPISSSYYPSAPHMLL 193

Query: 189 ALSGNLQQSSAAAAVPQENHHISNNHHHNNNNIMMSNSGGSSGGRKRFRTKFSQSQKEKM 248
           ALS  L ++ AA                  N  M+ NS  S+  RKRFRTKF+Q QK+KM
Sbjct: 194 ALSAALPENVAAP-----------------NQTMLMNS-HSNNSRKRFRTKFTQDQKDKM 235

Query: 249 FEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTFAKRD 296
            +FAE+VGWKMQK+DD+ VHEFCNE+GVDR+VLKVWMHNNK+T AKR+
Sbjct: 236 LKFAEKVGWKMQKKDDEFVHEFCNEIGVDRSVLKVWMHNNKNTLAKRE 283

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225452813|ref|XP_002283533.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255586792|ref|XP_002534012.1| conserved hypothetical protein [Ricinus communis] gi|223525985|gb|EEF28370.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224077726|ref|XP_002305381.1| predicted protein [Populus trichocarpa] gi|222848345|gb|EEE85892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449459474|ref|XP_004147471.1| PREDICTED: transcription factor HB29-like [Cucumis sativus] gi|449509241|ref|XP_004163533.1| PREDICTED: transcription factor HB29-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224141391|ref|XP_002324056.1| predicted protein [Populus trichocarpa] gi|222867058|gb|EEF04189.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449522934|ref|XP_004168480.1| PREDICTED: transcription factor HB29-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|164562231|gb|ABY61030.1| zinc finger-homeodomain protein 1, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356550836|ref|XP_003543789.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max] Back     alignment and taxonomy information
>gi|356568656|ref|XP_003552526.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
TAIR|locus:2095157312 HB34 "AT3G28920" [Arabidopsis 0.300 0.365 0.496 2.6e-54
TAIR|locus:2167052334 HB23 "AT5G39760" [Arabidopsis 0.306 0.347 0.441 3.3e-53
TAIR|locus:2150871271 HB30 "AT5G15210" [Arabidopsis 0.150 0.210 0.771 5.3e-47
TAIR|locus:2026734242 ZFHD1 "AT1G69600" [Arabidopsis 0.189 0.297 0.561 1.1e-38
TAIR|locus:2065304310 HB21 "homeobox protein 21" [Ar 0.174 0.212 0.590 4.5e-38
TAIR|locus:2121989220 HB22 "AT4G24660" [Arabidopsis 0.163 0.281 0.629 1.2e-37
TAIR|locus:2168240279 HB25 "AT5G65410" [Arabidopsis 0.163 0.222 0.580 1.5e-37
TAIR|locus:2012602312 HB31 "AT1G14440" [Arabidopsis 0.168 0.205 0.625 6.4e-37
TAIR|locus:2062141262 HB24 "AT2G18350" [Arabidopsis 0.171 0.248 0.615 3.5e-36
TAIR|locus:2025121309 HB33 "AT1G75240" [Arabidopsis 0.163 0.200 0.564 3.9e-35
TAIR|locus:2095157 HB34 "AT3G28920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 297 (109.6 bits), Expect = 2.6e-54, Sum P(3) = 2.6e-54
 Identities = 66/133 (49%), Positives = 79/133 (59%)

Query:    18 KSPETDTTDNHQTGATRIHSAKPLTFTNGVLKXXXXXXXXXXXXXXXXXXXXIVVTYKEC 77
             KSPE ++    +T  TRI  AKP++F+NG++K                      VTYKEC
Sbjct:    12 KSPEPES----ET-PTRIQPAKPISFSNGIIKRHHHHHHNNNK-----------VTYKEC 55

Query:    78 LKNHAASIGGHALDGCGEFMXXXXXXXXXXXXLKCAACGCHRNFHRREPDQDHHLPH--- 134
             LKNHAA+IGGHALDGCGEFM            LKCAACGCHRNFHRRE D    +P    
Sbjct:    56 LKNHAAAIGGHALDGCGEFMPSPSSTPSDPTSLKCAACGCHRNFHRRETDDSSAVPPPSL 115

Query:   135 VPTTATTATIEYQ 147
             +P++ TTA IEYQ
Sbjct:   116 LPSSTTTAAIEYQ 128
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003677 "DNA binding" evidence=ISS
TAIR|locus:2167052 HB23 "AT5G39760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150871 HB30 "AT5G15210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026734 ZFHD1 "AT1G69600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065304 HB21 "homeobox protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121989 HB22 "AT4G24660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168240 HB25 "AT5G65410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012602 HB31 "AT1G14440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062141 HB24 "AT2G18350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025121 HB33 "AT1G75240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00020963001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (323 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
pfam0477060 pfam04770, ZF-HD_dimer, ZF-HD protein dimerisation 8e-32
TIGR0156558 TIGR01565, homeo_ZF_HD, homeobox domain, ZF-HD cla 3e-26
TIGR0156653 TIGR01566, ZF_HD_prot_N, ZF-HD homeobox protein Cy 8e-25
>gnl|CDD|218256 pfam04770, ZF-HD_dimer, ZF-HD protein dimerisation region Back     alignment and domain information 
 Score =  114 bits (286), Expect = 8e-32
 Identities = 44/59 (74%), Positives = 47/59 (79%), Gaps = 2/59 (3%)

Query: 69  PIVVTYKECLKNHAASIGGHALDGCGEFMPSPTATPSDPTSLKCAACGCHRNFHRREPD 127
              V Y+ECLKNHAASIGGHA+DGCGEFMPS       P SLKCAACGCHRNFHRREP+
Sbjct: 1   GSGVRYRECLKNHAASIGGHAVDGCGEFMPSGEE--GTPDSLKCAACGCHRNFHRREPE 57

This family of proteins has are plant transcription factors, and have been named ZF-HD for zinc finger homeodomain proteins, on the basis of similarity to proteins of known structure. This region is thought to be involved in the formation of homo and heterodimers, and may form a zinc finger. Length = 60
>gnl|CDD|130628 TIGR01565, homeo_ZF_HD, homeobox domain, ZF-HD class Back     alignment and domain information
>gnl|CDD|130629 TIGR01566, ZF_HD_prot_N, ZF-HD homeobox protein Cys/His-rich dimerization domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 379
TIGR0156653 ZF_HD_prot_N ZF-HD homeobox protein Cys/His-rich d 99.98
PF0477060 ZF-HD_dimer: ZF-HD protein dimerisation region; In 99.97
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.93
KOG0843197 consensus Transcription factor EMX1 and related HO 99.5
KOG0493342 consensus Transcription factor Engrailed, contains 99.38
KOG0494332 consensus Transcription factor CHX10 and related H 99.38
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.37
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.34
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.29
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.25
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.14
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.11
KOG0488309 consensus Transcription factor BarH and related HO 99.04
KOG0489261 consensus Transcription factor zerknullt and relat 99.03
KOG0844408 consensus Transcription factor EVX1, contains HOX 98.99
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 98.94
KOG0486351 consensus Transcription factor PTX1, contains HOX 98.9
KOG0490235 consensus Transcription factor, contains HOX domai 98.89
KOG0850245 consensus Transcription factor DLX and related pro 98.86
KOG3802398 consensus Transcription factor OCT-1, contains POU 98.77
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 98.74
COG5576156 Homeodomain-containing transcription factor [Trans 98.6
KOG0492246 consensus Transcription factor MSH, contains HOX d 98.57
KOG0483198 consensus Transcription factor HEX, contains HOX a 98.56
KOG0847288 consensus Transcription factor, contains HOX domai 98.56
KOG0849354 consensus Transcription factor PRD and related pro 98.48
KOG0487308 consensus Transcription factor Abd-B, contains HOX 98.25
KOG0491194 consensus Transcription factor BSH, contains HOX d 98.25
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.09
KOG0848317 consensus Transcription factor Caudal, contains HO 98.09
KOG0490235 consensus Transcription factor, contains HOX domai 98.05
KOG1146 1406 consensus Homeobox protein [General function predi 97.86
KOG2252558 consensus CCAAT displacement protein and related h 97.85
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 96.01
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 95.64
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 95.43
KOG0774334 consensus Transcription factor PBX and related HOX 95.12
KOG0775304 consensus Transcription factor SIX and related HOX 94.47
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 92.58
KOG0773342 consensus Transcription factor MEIS1 and related H 91.11
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 90.87
COG2963116 Transposase and inactivated derivatives [DNA repli 88.75
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 84.49
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 83.5
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 81.76
PRK09413121 IS2 repressor TnpA; Reviewed 81.19
>TIGR01566 ZF_HD_prot_N ZF-HD homeobox protein Cys/His-rich dimerization domain Back     alignment and domain information 
Probab=99.98  E-value=1.1e-33  Score=212.12  Aligned_cols=50  Identities=84%  Similarity=1.519  Sum_probs=45.5

Q ss_pred             HHHhhhhhhccCCccccCcccccc-CCCCCCCCCCccccccccccccccccCC
Q 016972           75 KECLKNHAASIGGHALDGCGEFMP-SPTATPSDPTSLKCAACGCHRNFHRREP  126 (379)
Q Consensus        75 RECLKNHAAsiGGHAvDGCGEFMP-SGeegt~dp~ALKCAACGCHRNFHRKE~  126 (379)
                      ..-||||||+|||||||||||||| +|++++  +++||||||||||||||||+
T Consensus         3 ~EC~kNHAa~~Gg~a~DGCgEFmps~g~~~~--~~al~CaACgCHRnFHRre~   53 (53)
T TIGR01566         3 KECLKNHAASIGGHALDGCGEFMPSSGEEGD--PESLTCAACGCHRNFHRKEP   53 (53)
T ss_pred             HHHHHhhHHHhCCcccccccccccCCCCCCC--CcceeeeecCcccccccCCC
Confidence            467999999999999999999999 677665  67999999999999999985

This model describes a 54-residue domain found in the N-terminal region of plant proteins, the vast majority of which contain a ZF-HD class homeobox domain toward the C-terminus. The region between the two domains typically is rich in low complexity sequence. The companion ZF-HD homeobox domain is described in model TIGR01565.
>PF04770 ZF-HD_dimer: ZF-HD protein dimerisation region; InterPro: IPR006456 The homeodomain (HD) is a 60-amino acid DNA-binding domain found in many transcription factors Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
1wh7_A80 Solution Structure Of Homeobox Domain Of Arabidopsi 1e-17
1wh5_A80 Solution Structure Of Homeobox Domain Of Arabidopsi 8e-17
>pdb|1WH7|A Chain A, Solution Structure Of Homeobox Domain Of Arabidopsis Thaliana Hypothetical Protein F22k18.140 Length = 80 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/58 (65%), Positives = 46/58 (79%)
Query: 234 KRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKST 291
           KRFRTKF+  QKEKM  FAER+GW++QK DD  V +FC E GV R VLK+WMHNNK++
Sbjct: 18  KRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNS 75
>pdb|1WH5|A Chain A, Solution Structure Of Homeobox Domain Of Arabidopsisthaliana Zinc Finger Homeobox Family Protein Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 3e-34
1wh5_A80 ZF-HD homeobox family protein; structural genomics 2e-33
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 8e-04
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
 Score =  120 bits (303), Expect = 3e-34
 Identities = 42/72 (58%), Positives = 50/72 (69%)

Query: 224 SNSGGSSGGRKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKV 283
           SN   S G  KRFRTKF+  QKEKM  FAER+GW++QK DD  V +FC E GV R VLK+
Sbjct: 8   SNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKI 67

Query: 284 WMHNNKSTFAKR 295
           WMHNNK++    
Sbjct: 68  WMHNNKNSGPSS 79
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.85
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.85
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.69
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.68
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.67
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.64
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.63
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.59
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.58
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.58
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.57
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.57
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.56
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.55
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.53
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.53
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.53
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.52
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.52
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.52
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.51
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.5
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.5
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.5
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.5
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.49
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.49
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.48
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.48
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.48
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.47
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.47
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.47
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.47
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.47
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.47
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.46
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.45
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.45
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.45
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.45
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.45
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.45
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.44
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.43
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.43
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.4
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.4
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.4
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.4
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.39
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.38
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.38
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.38
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.37
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.37
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.37
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.36
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.35
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.33
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.32
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.32
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.32
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.31
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.3
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.25
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.24
2e19_A64 Transcription factor 8; homeobox domain, structura 99.15
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.08
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.04
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.03
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.0
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.91
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.88
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.81
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.45
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 97.15
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 95.04
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 93.71
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 93.52
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 91.84
2ofy_A86 Putative XRE-family transcriptional regulator; tra 90.85
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 90.53
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 90.47
2rn7_A108 IS629 ORFA; helix, all alpha, unknown function, st 89.15
3bni_A229 Putative TETR-family transcriptional regulator; st 86.06
3bdn_A236 Lambda repressor; repressor, allostery; HET: DNA; 84.4
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 83.8
1iuf_A144 Centromere ABP1 protein; riken structural genomics 83.33
2k27_A159 Paired box protein PAX-8; paired domain, solution 82.42
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 82.0
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 81.69
1u78_A141 TC3 transposase, transposable element TC3 transpos 80.99
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.85  E-value=4.4e-22  Score=158.13  Aligned_cols=66  Identities=61%  Similarity=1.041  Sum_probs=63.0

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHhCccCCCCCHHHHHHHHHHhCCCCceeeeecccccccCCC
Q 016972          229 SSGGRKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTFAK  294 (379)
Q Consensus       229 ~s~~kKR~RTkFT~EQkekM~~faEk~GWRIqk~d~~~vq~fc~eiGv~r~V~KVWfhNnK~k~~k  294 (379)
                      ...++||.||+||.+|+++|++|++++||+.+|+|..++++||.+|||++.+|||||||+|+|+++
T Consensus        13 ~~~~~rR~Rt~ft~~Ql~~Le~F~~~~~w~~~yp~~~~r~~La~~lgL~e~qVkvWFqNrR~k~~~   78 (80)
T 1wh7_A           13 SGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSGPS   78 (80)
T ss_dssp             CCCCSSCCCCCCCHHHHHHHHHHHHHHTSCCCSSTTHHHHHHHHHSCCCHHHHHHHHHTTSCCSCC
T ss_pred             CCCCCCCCCccCCHHHHHHHHHHHHHcCcCCCCCCHHHHHHHHHHhCcCcCcccccccccccCCCC
Confidence            456789999999999999999999999999999999999999999999999999999999999976
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PS protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} Back     alignment and structure
>3bni_A Putative TETR-family transcriptional regulator; structural genomics, APC7281; HET: PG4; 2.30A {Streptomyces coelicolor A3} Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 379
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-14
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-05
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 6e-05
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-04
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-04
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-04
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-04
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 8e-04
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 0.001
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 0.001
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 0.002
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 0.002
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 0.003
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: ZF-HD homeobox protein At4g24660
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 66.6 bits (162), Expect = 1e-14
 Identities = 42/72 (58%), Positives = 50/72 (69%)

Query: 224 SNSGGSSGGRKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKV 283
           SN   S G  KRFRTKF+  QKEKM  FAER+GW++QK DD  V +FC E GV R VLK+
Sbjct: 8   SNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKI 67

Query: 284 WMHNNKSTFAKR 295
           WMHNNK++    
Sbjct: 68  WMHNNKNSGPSS 79
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.87
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.62
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.62
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.62
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.59
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.58
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.57
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.57
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.56
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.56
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.56
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.56
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.55
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.53
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.53
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.53
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.51
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.5
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.49
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.48
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.44
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.41
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.41
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.39
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.36
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.31
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.2
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.12
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.11
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.1
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.06
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 92.03
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 87.43
d1hlva166 DNA-binding domain of centromere binding protein B 86.44
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: ZF-HD homeobox protein At4g24660
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.87  E-value=4e-23  Score=162.61  Aligned_cols=66  Identities=61%  Similarity=1.041  Sum_probs=62.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHhCccCCCCCHHHHHHHHHHhCCCCceeeeecccccccCCC
Q 016972          229 SSGGRKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTFAK  294 (379)
Q Consensus       229 ~s~~kKR~RTkFT~EQkekM~~faEk~GWRIqk~d~~~vq~fc~eiGv~r~V~KVWfhNnK~k~~k  294 (379)
                      ...++||.||.||.+|++.|++|||+++|+.+|||.+++++||.+|||+++||||||||+|+++++
T Consensus        13 ~~~~~kR~Rt~ft~~Q~~~L~~~fe~~~~~~~~p~~~~~~~la~~~gl~~~~i~vWFqN~R~~~k~   78 (80)
T d1wh7a_          13 SGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSGPS   78 (80)
T ss_dssp             CCCCSSCCCCCCCHHHHHHHHHHHHHHTSCCCSSTTHHHHHHHHHSCCCHHHHHHHHHTTSCCSCC
T ss_pred             CccCCCCccccCCHHHHHHHHHHHHHhcccccCcCHHHHHHHHHHHCCCHHHeeeecccCcCCCCC
Confidence            445678999999999999999999999999999999999999999999999999999999998875
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure