Citrus Sinensis ID: 016989


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MGSSEDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQEIIL
ccccccccEEEEEEEcccccccccccccccccccccccccccHHHccHHccccEEEEccccHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHHccccccEEEEEEccEEccccHHHHHHHHHHccccEEEEEEEEccccccccEEEEEcccccEEEEEEccccccccccEEcEEEEEcHHHHHHHccccccccccHHHHcccHHHHHHHHHcccccccccccccccccccccccEEEEEEccEEcccccHHHHHHHHHHHHHcccccccccccccccccccEEEccEEEccccEEccccccccEEEcEEEccccEEccccEEccccccccccccEEEccccEEccccEEEccEEccccEEcccccccccc
ccccccccEEEEEEEcccccccEcccccccccccccccccccHHHHHHHHHcEEEEEEcccHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHccccccEEEEEccEEccccHHHHHHHHHHccccEEEEEEEcccccccccEEEEEcccccEEEEEEEccHHHHccEEccEEEEEcHHHHHHHHccccccHHHHccEEEccHHHHHHHHccccccHcHHHHHHHHHHHHcccEEEEEccccHHHcccHHHHHHHHHHHHHcccccccHHHcccccccccEEcccEEEcccEEEccccccccEEEEEEEEEccEEccEEEEEccccccccccEEEEccccEcccEEEEEcEEEcccccccccccccccc
MGSSEDDKVVAVIMVggptkgtrfrplslnipkplfplggqpmvhhpisackriylvgfyeEREFALYVSSIsnelripvrylredkphgsagalynfrdlimednpshifllncdvccsfplpemldahrnyggMGTILVIKVSAESAsqfgelvadpdtnellhytekpetfvsdlincgvyvftpDIFNAIQGvssqrkdrenlrrVSSFEALQSATRNLTTDFVrldqdilsplagkkqlytYETMDFWEqiktpgmslkcsgLYLAQFrltspnllasgdgtknatiigdvyvhpsakihptakeNAVVTNAIVGWKSsigrwsrvqaegdfnaKLGITILgeavgvedEVVVTNSivlpnktlnvSVHQEIIL
MGSSEDDKVVAVIMvggptkgtrfrplsLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQgvssqrkdrenlRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNsivlpnktlnvsvhqeiil
MGSSEDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILgeavgvedevvvTNSIVLPNKTLNVSVHQEIIL
********VVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGV*********************ATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVH*****
******D***AVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGV************VSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQEIIL
MGSSEDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQEIIL
******DKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVH*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSSEDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQEIIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query379 2.2.26 [Sep-21-2011]
Q86HG0412 Mannose-1-phosphate guany yes no 0.934 0.859 0.395 2e-84
Q7SXP8422 Mannose-1-phosphate guany yes no 0.949 0.853 0.408 3e-84
Q0VFM6421 Mannose-1-phosphate guany yes no 0.936 0.843 0.388 5e-81
Q6GMK8422 Mannose-1-phosphate guany no no 0.949 0.853 0.394 1e-80
Q66KG5426 Mannose-1-phosphate guany N/A no 0.949 0.845 0.395 1e-79
Q6DKE9421 Mannose-1-phosphate guany N/A no 0.941 0.847 0.4 2e-79
Q5XIC1420 Mannose-1-phosphate guany yes no 0.949 0.857 0.382 3e-76
Q922H4420 Mannose-1-phosphate guany yes no 0.949 0.857 0.380 5e-76
B0CM52420 Mannose-1-phosphate guany N/A no 0.949 0.857 0.380 2e-75
Q96IJ6420 Mannose-1-phosphate guany yes no 0.949 0.857 0.380 3e-75
>sp|Q86HG0|GMPPA_DICDI Mannose-1-phosphate guanyltransferase alpha OS=Dictyostelium discoideum GN=gmppA PE=2 SV=1 Back     alignment and function desciption
 Score =  312 bits (800), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 166/420 (39%), Positives = 246/420 (58%), Gaps = 66/420 (15%)

Query: 11  AVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISAC------KRIYLVGFYEERE 64
           A+I+VGGP+KGTRFRPLSL++PK LFP+ G+PM++H I AC      K I L+GF++E  
Sbjct: 8   AIILVGGPSKGTRFRPLSLDVPKLLFPIAGKPMIYHHIEACSKVENMKEIILIGFFQESV 67

Query: 65  FALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLP 124
            + ++S  S +L + +RY+ E+K  G+AG LY+FRD+I+E  PS IF+L+ D+CC+FPL 
Sbjct: 68  LSKFISETSKQLNVAIRYINEEKVLGTAGGLYHFRDIILEGGPSEIFVLHSDICCAFPLN 127

Query: 125 EMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVY 184
           ++L  H+ +G   TI+  ++ +  A+Q+G LV D  T ELLHY EKPETFVS+LINCGVY
Sbjct: 128 DLLQFHKQHGRSCTIMGTEIESAYANQYGCLVRDEKTAELLHYAEKPETFVSNLINCGVY 187

Query: 185 VFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDF------------VRLDQ 232
            F+P  F+ I                 +   L+++ +N+TTD+            +RL+Q
Sbjct: 188 CFSPQFFDVIG---------------KTMIDLKTSGQNITTDYPEITRKGFDVERLRLEQ 232

Query: 233 DILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASG-------- 284
           DI  PLAG   +  Y  + FW QIK  G S+ C  LYL  F  T P +L  G        
Sbjct: 233 DIFVPLAGTGFISVYPYVGFWRQIKNAGSSVYCQELYLNHFAKTKPEVLKKGNNIIGNVI 292

Query: 285 -DGTKN---ATIIG-DVYVHPSAKI-------------HPTAKENAVVTNAIVGWKSSIG 326
            D T +   + IIG DVY+ P+ KI                 K++A +  +I+GW+S IG
Sbjct: 293 IDSTASVDPSAIIGPDVYIGPNVKIGKGVRVIHSIILDQTEIKDHACIIYSIIGWQSLIG 352

Query: 327 RWSRVQAEGDF-------NAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQEIIL 379
            W+R++   ++       + + G+TI G       E++V+N IV+P+K L+ + + EIIL
Sbjct: 353 VWARIEGIPNYTPFLYSQDKRRGVTIFGAGAQANGEIIVSNCIVMPHKQLDRNYNNEIIL 412





Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 1EC: 3
>sp|Q7SXP8|GMPAB_DANRE Mannose-1-phosphate guanyltransferase alpha-B OS=Danio rerio GN=gmppab PE=2 SV=1 Back     alignment and function description
>sp|Q0VFM6|GMPPA_XENTR Mannose-1-phosphate guanyltransferase alpha OS=Xenopus tropicalis GN=gmppa PE=2 SV=1 Back     alignment and function description
>sp|Q6GMK8|GMPAA_DANRE Mannose-1-phosphate guanyltransferase alpha-A OS=Danio rerio GN=gmppaa PE=2 SV=1 Back     alignment and function description
>sp|Q66KG5|GMPAB_XENLA Mannose-1-phosphate guanyltransferase alpha-B OS=Xenopus laevis GN=gmppa-b PE=2 SV=1 Back     alignment and function description
>sp|Q6DKE9|GMPAA_XENLA Mannose-1-phosphate guanyltransferase alpha-A OS=Xenopus laevis GN=gmppa-a PE=2 SV=1 Back     alignment and function description
>sp|Q5XIC1|GMPPA_RAT Mannose-1-phosphate guanyltransferase alpha OS=Rattus norvegicus GN=Gmppa PE=2 SV=1 Back     alignment and function description
>sp|Q922H4|GMPPA_MOUSE Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=2 SV=1 Back     alignment and function description
>sp|B0CM52|GMPPA_PAPAN Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1 Back     alignment and function description
>sp|Q96IJ6|GMPPA_HUMAN Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
224135729415 predicted protein [Populus trichocarpa] 0.997 0.910 0.822 0.0
255540799415 mannose-1-phosphate guanyltransferase, p 0.997 0.910 0.824 0.0
297842235415 ADP-glucose pyrophosphorylase family pro 0.997 0.910 0.786 0.0
15222037415 ADP-glucose pyrophosphorylase-like prote 0.997 0.910 0.786 0.0
224121622417 predicted protein [Populus trichocarpa] 0.997 0.906 0.796 0.0
5882732411 Similar to gb|AF135422 GDP-mannose pyrop 0.984 0.907 0.785 0.0
94962375415 putative GDP-mannose pyrophosphorylase [ 0.997 0.910 0.802 0.0
225457154415 PREDICTED: mannose-1-phosphate guanyltra 0.997 0.910 0.800 0.0
225452650415 PREDICTED: mannose-1-phosphate guanyltra 0.992 0.906 0.769 0.0
296087766418 unnamed protein product [Vitis vinifera] 0.992 0.899 0.764 0.0
>gi|224135729|ref|XP_002322146.1| predicted protein [Populus trichocarpa] gi|222869142|gb|EEF06273.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/416 (82%), Positives = 362/416 (87%), Gaps = 38/416 (9%)

Query: 1   MGSSEDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRI------ 54
           MGSSE+ +VVAVIMVGGPTKGTRFRPLSLNIPKPLFPL GQPMVHHPISACK+I      
Sbjct: 1   MGSSEE-RVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLAGQPMVHHPISACKKIPNLAQI 59

Query: 55  YLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLN 114
           YLVGFYEEREFALYVSSISNEL++PVRYLREDKPHGSAG LYNFRDLIMED+PSHIFLLN
Sbjct: 60  YLVGFYEEREFALYVSSISNELKVPVRYLREDKPHGSAGGLYNFRDLIMEDSPSHIFLLN 119

Query: 115 CDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETF 174
           CDVCCSFPLPEML+AHR YGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETF
Sbjct: 120 CDVCCSFPLPEMLEAHRTYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETF 179

Query: 175 VSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDI 234
           VSD INCGVYVFTP+IF AIQ VSSQRKDR NLRR+SSFEALQSATR+L TDFVRLDQDI
Sbjct: 180 VSDRINCGVYVFTPEIFTAIQDVSSQRKDRANLRRISSFEALQSATRSLPTDFVRLDQDI 239

Query: 235 LSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIG 294
           LSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFR TSP+LLA GDG+K ATI+ 
Sbjct: 240 LSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRFTSPHLLAGGDGSKTATIVD 299

Query: 295 DVYVHPSAKIHPTAK-------------------------------ENAVVTNAIVGWKS 323
           DVY+HPSAK+HPTAK                               ENAVV ++IVGWKS
Sbjct: 300 DVYIHPSAKVHPTAKIGPNVSISANARIGPGARLICCIILDDVEVMENAVVIHSIVGWKS 359

Query: 324 SIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQEIIL 379
           SIGRWSRVQAEGD+NAKLG+TILGEAV VEDEVVV NSIVLPNKTLNVSV +EIIL
Sbjct: 360 SIGRWSRVQAEGDYNAKLGVTILGEAVTVEDEVVVVNSIVLPNKTLNVSVQEEIIL 415




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255540799|ref|XP_002511464.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis] gi|223550579|gb|EEF52066.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297842235|ref|XP_002888999.1| ADP-glucose pyrophosphorylase family protein [Arabidopsis lyrata subsp. lyrata] gi|297334840|gb|EFH65258.1| ADP-glucose pyrophosphorylase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15222037|ref|NP_177629.1| ADP-glucose pyrophosphorylase-like protein [Arabidopsis thaliana] gi|30699054|ref|NP_849886.1| ADP-glucose pyrophosphorylase-like protein [Arabidopsis thaliana] gi|12323882|gb|AAG51908.1|AC013258_2 putative GDP-mannose pyrophosphorylase; 64911-67597 [Arabidopsis thaliana] gi|13937224|gb|AAK50104.1|AF372967_1 At1g74910/F9E10_24 [Arabidopsis thaliana] gi|21700877|gb|AAM70562.1| At1g74910/F9E10_24 [Arabidopsis thaliana] gi|332197525|gb|AEE35646.1| ADP-glucose pyrophosphorylase-like protein [Arabidopsis thaliana] gi|332197527|gb|AEE35648.1| ADP-glucose pyrophosphorylase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224121622|ref|XP_002318629.1| predicted protein [Populus trichocarpa] gi|222859302|gb|EEE96849.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|5882732|gb|AAD55285.1|AC008263_16 Similar to gb|AF135422 GDP-mannose pyrophosphorylase A (GMPPA) from Homo sapiens. ESTs gb|AA712990, gb|N65247, gb|N38149, gb|T04179, gb|Z38092, gb|T76473, gb|N96403, gb|AA394551 and gb|AA728527 come from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|94962375|gb|ABF48494.1| putative GDP-mannose pyrophosphorylase [Linum usitatissimum] Back     alignment and taxonomy information
>gi|225457154|ref|XP_002283703.1| PREDICTED: mannose-1-phosphate guanyltransferase alpha isoform 1 [Vitis vinifera] gi|297733847|emb|CBI15094.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225452650|ref|XP_002281959.1| PREDICTED: mannose-1-phosphate guanyltransferase alpha-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087766|emb|CBI35022.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
TAIR|locus:2027201415 AT1G74910 [Arabidopsis thalian 0.841 0.768 0.826 2.4e-168
TAIR|locus:2049188406 AT2G04650 [Arabidopsis thalian 0.781 0.729 0.778 3.2e-149
ZFIN|ZDB-GENE-040426-1550422 gmppab "GDP-mannose pyrophosph 0.817 0.734 0.444 3.7e-72
ASPGD|ASPL0000047492439 AN1911 [Emericella nidulans (t 0.828 0.715 0.408 2.6e-69
UNIPROTKB|G4N495440 MGG_05936 "Uncharacterized pro 0.831 0.715 0.415 4.2e-69
ZFIN|ZDB-GENE-040704-37422 gmppaa "GDP-mannose pyrophosph 0.815 0.732 0.424 1.1e-68
DICTYBASE|DDB_G0271858412 gmppA "mannose-1-phosphate gua 0.815 0.75 0.417 2.8e-66
UNIPROTKB|E1BEN4420 GMPPA "Uncharacterized protein 0.817 0.738 0.413 3.7e-66
RGD|1560644420 Gmppa "GDP-mannose pyrophospho 0.817 0.738 0.407 1.3e-65
MGI|MGI:1916330420 Gmppa "GDP-mannose pyrophospho 0.817 0.738 0.404 2e-65
TAIR|locus:2027201 AT1G74910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1412 (502.1 bits), Expect = 2.4e-168, Sum P(2) = 2.4e-168
 Identities = 272/329 (82%), Positives = 300/329 (91%)

Query:     1 MGSSEDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRI------ 54
             MGSS ++KVVAVIMVGGPTKGTRFRPLSLNIPKPLFP+ GQPMVHHPISACKRI      
Sbjct:     1 MGSSMEEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQI 60

Query:    55 YLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLN 114
             YLVGFYEEREFALYVS+ISNEL++PVRYLREDKPHGSAG LY+FR+LIMED+PSHIFLLN
Sbjct:    61 YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDSPSHIFLLN 120

Query:   115 CDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETF 174
             CDVCCSFPLP+ML+AHR YGG+GT+LVIKVS ESASQFGELVADP TNELLHYTEKPETF
Sbjct:   121 CDVCCSFPLPKMLEAHRGYGGIGTLLVIKVSPESASQFGELVADPVTNELLHYTEKPETF 180

Query:   175 VSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDI 234
             VSD INCGVYVFTP+IFNAI  VS+QRKDR  L+RVSSFEALQ ATR + TDFVRLDQDI
Sbjct:   181 VSDRINCGVYVFTPEIFNAIGDVSTQRKDRATLKRVSSFEALQPATR-IPTDFVRLDQDI 239

Query:   235 LSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIG 294
             LSPLAGKK+LYTYETMDFWEQIK+PGMSL+CSGLYL+QFRLTSP LLASGDGT++A +IG
Sbjct:   240 LSPLAGKKRLYTYETMDFWEQIKSPGMSLRCSGLYLSQFRLTSPQLLASGDGTRSAIVIG 299

Query:   295 DVYVHPSAKIHPTAK--ENAVVT-NAIVG 320
             DVY+HPSAK+HPTAK   N  ++ NA VG
Sbjct:   300 DVYIHPSAKVHPTAKIGPNVSISANARVG 328


GO:0005737 "cytoplasm" evidence=ISM
GO:0009058 "biosynthetic process" evidence=IEA;ISS
GO:0016740 "transferase activity" evidence=IEA
GO:0016779 "nucleotidyltransferase activity" evidence=IEA;ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2049188 AT2G04650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1550 gmppab "GDP-mannose pyrophosphorylase Ab" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000047492 AN1911 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4N495 MGG_05936 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040704-37 gmppaa "GDP-mannose pyrophosphorylase Aa" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271858 gmppA "mannose-1-phosphate guanylyltransferase alpha" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEN4 GMPPA "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1560644 Gmppa "GDP-mannose pyrophosphorylase A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1916330 Gmppa "GDP-mannose pyrophosphorylase A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q922H4GMPPA_MOUSE2, ., 7, ., 7, ., 1, 30.38020.94980.8571yesno
O60064YBB2_SCHPO2, ., 7, ., 7, ., 1, 30.34950.91550.8381yesno
Q7SXP8GMPAB_DANRE2, ., 7, ., 7, ., 1, 30.40880.94980.8530yesno
Q96IJ6GMPPA_HUMAN2, ., 7, ., 7, ., 1, 30.38020.94980.8571yesno
Q9Y725MPG11_CANGA2, ., 7, ., 7, ., 1, 30.30040.84690.8891yesno
Q86HG0GMPPA_DICDI2, ., 7, ., 7, ., 1, 30.39520.93400.8592yesno
Q0VFM6GMPPA_XENTR2, ., 7, ., 7, ., 1, 30.38880.93660.8432yesno
Q5XIC1GMPPA_RAT2, ., 7, ., 7, ., 1, 30.38260.94980.8571yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.70.921
3rd Layer2.7.7.130.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_XV0175
hypothetical protein (416 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
cd06428257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain 1e-144
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain 2e-51
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph 1e-50
cd04181217 cd04181, NTP_transferase, NTP_transferases catalyz 1e-49
pfam00483247 pfam00483, NTP_transferase, Nucleotidyl transferas 5e-32
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the l 3e-28
TIGR03992393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 6e-28
cd06915223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a 8e-26
cd06426220 cd06426, NTP_transferase_like_2, NTP_trnasferase_l 3e-24
cd02507216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eI 6e-20
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb 3e-16
cd04198214 cd04198, eIF-2B_gamma_N, The N-terminal domain of 5e-16
COG1209286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel 6e-16
TIGR02091361 TIGR02091, glgC, glucose-1-phosphate adenylyltrans 1e-15
cd06422221 cd06422, NTP_transferase_like_1, NTP_transferase_l 7e-14
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidyl 1e-13
cd02524253 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltr 2e-13
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransf 3e-13
cd02540229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bact 6e-13
cd02541267 cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca 2e-11
cd02523229 cd02523, PC_cytidylyltransferase, Phosphocholine c 1e-09
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 3e-09
cd04197217 cd04197, eIF-2B_epsilon_N, The N-terminal domain o 1e-08
TIGR01099260 TIGR01099, galU, UTP-glucose-1-phosphate uridylylt 1e-08
COG1210291 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell 6e-08
cd02538240 cd02538, G1P_TT_short, G1P_TT_short is the short f 6e-08
cd0582480 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate 1e-07
PRK00844407 PRK00844, glgC, glucose-1-phosphate adenylyltransf 2e-06
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphospho 3e-06
pfam12804178 pfam12804, NTP_transf_3, MobA-like NTP transferase 3e-06
cd02508200 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory 3e-05
PRK14355459 PRK14355, glmU, bifunctional N-acetylglucosamine-1 5e-05
PRK02862429 PRK02862, glgC, glucose-1-phosphate adenylyltransf 1e-04
PLN02241436 PLN02241, PLN02241, glucose-1-phosphate adenylyltr 2e-04
PRK00725425 PRK00725, glgC, glucose-1-phosphate adenylyltransf 2e-04
cd02516218 cd02516, CDP-ME_synthetase, CDP-ME synthetase is i 4e-04
PRK09451456 PRK09451, glmU, bifunctional N-acetylglucosamine-1 7e-04
COG4750231 COG4750, LicC, CTP:phosphocholine cytidylyltransfe 7e-04
PRK14358 481 PRK14358, glmU, bifunctional N-acetylglucosamine-1 8e-04
COG2266177 COG2266, COG2266, GTP:adenosylcobinamide-phosphate 0.001
PRK15480292 PRK15480, PRK15480, glucose-1-phosphate thymidylyl 0.001
TIGR02623254 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti 0.002
cd04183231 cd04183, GT2_BcE_like, GT2_BcbE_like is likely inv 0.003
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
 Score =  410 bits (1055), Expect = e-144
 Identities = 137/265 (51%), Positives = 179/265 (67%), Gaps = 14/265 (5%)

Query: 11  AVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISAC------KRIYLVGFYEERE 64
           AVI+VGGP KGTRFRPLSL++PKPLFP+ G+PM+HH I AC      K + L+GFY E  
Sbjct: 1   AVILVGGPQKGTRFRPLSLDVPKPLFPVAGKPMIHHHIEACAKVPDLKEVLLIGFYPESV 60

Query: 65  FALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLP 124
           F+ ++S    E  +P+RYL+E KP G+AG LY+FRD I+  NPS  F+LN DVCC FPL 
Sbjct: 61  FSDFISDAQQEFNVPIRYLQEYKPLGTAGGLYHFRDQILAGNPSAFFVLNADVCCDFPLQ 120

Query: 125 EMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVY 184
           E+L+ H+ +G  GTIL  + S E AS +G +V DP T E+LHY EKPETFVSDLINCGVY
Sbjct: 121 ELLEFHKKHGASGTILGTEASREQASNYGCIVEDPSTGEVLHYVEKPETFVSDLINCGVY 180

Query: 185 VFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQL 244
           +F+P+IF+ I+     R+    L             R    + +RL+QD+L+PLAG  +L
Sbjct: 181 LFSPEIFDTIKKAFQSRQQEAQLG--------DDNNREGRAEVIRLEQDVLTPLAGSGKL 232

Query: 245 YTYETMDFWEQIKTPGMSLKCSGLY 269
           Y Y+T DFW QIKT G ++  + LY
Sbjct: 233 YVYKTDDFWSQIKTAGSAIYANRLY 257


N-terminal domain of the M1P-guanylyltransferase A-isoform like proteins: The proteins of this family are likely to be a isoform of GDP-mannose pyrophosphorylase. Their sequences are highly conserved with mannose-1-phosphate guanyltransferase, but generally about 40-60 bases longer. GDP-mannose pyrophosphorylase (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes including cell lysis, defective cell wall, and failure of polarized growth and cell separation. Length = 257

>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|233272 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>gnl|CDD|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|221780 pfam12804, NTP_transf_3, MobA-like NTP transferase domain Back     alignment and domain information
>gnl|CDD|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133009 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>gnl|CDD|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|227093 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|237688 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225175 COG2266, COG2266, GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|133026 cd04183, GT2_BcE_like, GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 379
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 100.0
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 100.0
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 100.0
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 100.0
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 100.0
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 100.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PLN02241436 glucose-1-phosphate adenylyltransferase 100.0
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 100.0
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 100.0
COG1207 460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 100.0
PRK14355 459 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14358 481 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14352 482 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
KOG1462433 consensus Translation initiation factor 2B, gamma 100.0
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 100.0
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 100.0
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK15480292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 100.0
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 100.0
KOG1461 673 consensus Translation initiation factor 2B, epsilo 100.0
TIGR01173 451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 100.0
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 100.0
PRK10122297 GalU regulator GalF; Provisional 100.0
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase, sh 100.0
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 100.0
PRK14354 458 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14357 448 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14360 450 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR02623254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 100.0
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subun 100.0
TIGR01099260 galU UTP-glucose-1-phosphate uridylyltransferase. 100.0
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 100.0
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 100.0
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 100.0
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 99.98
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase 99.98
cd04181217 NTP_transferase NTP_transferases catalyze the tran 99.97
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 99.97
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope 99.97
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon 99.96
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 99.95
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 99.95
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 99.95
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 99.93
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma 99.93
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 99.92
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 99.92
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.92
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.9
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 99.89
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 99.89
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.87
PLN02917293 CMP-KDO synthetase 99.84
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Ce 99.82
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.81
COG4750231 LicC CTP:phosphocholine cytidylyltransferase invol 99.73
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 99.69
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 99.61
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.55
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 99.55
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 99.54
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 99.53
PRK09382378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 99.53
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.53
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase 99.53
TIGR00454183 conserved hypothetical protein TIGR00454. At this 99.52
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 99.5
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.49
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 99.46
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.41
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 99.38
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis pr 99.38
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransfera 99.37
cd02503181 MobA MobA catalyzes the formation of molybdopterin 99.35
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 99.32
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 99.31
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 99.31
PF01128221 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.28
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthes 99.27
PLN02728252 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.26
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.23
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.21
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell 99.19
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt 99.18
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 99.15
COG2068199 Uncharacterized MobA-related protein [General func 99.14
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.14
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.12
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.08
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.08
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.05
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.04
PRK13627196 carnitine operon protein CaiE; Provisional 99.02
COG1044 338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.01
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.0
KOG1462433 consensus Translation initiation factor 2B, gamma 98.98
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 98.98
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 98.98
PLN02296 269 carbonate dehydratase 98.97
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 98.97
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 98.95
PLN02472246 uncharacterized protein 98.95
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 98.95
cd04193323 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala 98.94
cd04745155 LbH_paaY_like paaY-like: This group is composed by 98.94
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 98.92
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 98.9
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 98.9
cd04180266 UGPase_euk_like Eukaryotic UGPase-like includes UD 98.9
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 98.89
PRK14500346 putative bifunctional molybdopterin-guanine dinucl 98.89
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 98.86
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 98.86
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 98.83
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 98.83
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 98.83
KOG1461 673 consensus Translation initiation factor 2B, epsilo 98.82
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 98.81
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 98.81
cd03351 254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 98.8
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 98.8
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 98.79
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 98.79
PRK05289 262 UDP-N-acetylglucosamine acyltransferase; Provision 98.78
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 98.78
PRK05289 262 UDP-N-acetylglucosamine acyltransferase; Provision 98.78
cd03351 254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 98.77
TIGR01853 324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 98.76
PLN02472246 uncharacterized protein 98.76
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 98.75
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 98.75
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 98.74
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 98.72
PTZ00339482 UDP-N-acetylglucosamine pyrophosphorylase; Provisi 98.71
TIGR01852 254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 98.7
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 98.7
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 98.69
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 98.69
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 98.68
PRK12461 255 UDP-N-acetylglucosamine acyltransferase; Provision 98.67
PLN02474469 UTP--glucose-1-phosphate uridylyltransferase 98.67
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 98.67
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 98.67
COG1044 338 LpxD UDP-3-O-[3-hydroxymyristoyl] 98.67
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 98.67
cd04745155 LbH_paaY_like paaY-like: This group is composed by 98.66
TIGR01852 254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 98.66
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 98.65
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 98.65
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.64
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 98.63
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 98.62
PRK00892 343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 98.61
PRK14358 481 glmU bifunctional N-acetylglucosamine-1-phosphate 98.61
PRK11132273 cysE serine acetyltransferase; Provisional 98.61
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 98.61
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 98.6
PLN02694294 serine O-acetyltransferase 98.59
PRK12461 255 UDP-N-acetylglucosamine acyltransferase; Provision 98.59
PF02348217 CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 98.58
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.58
PRK09451 456 glmU bifunctional N-acetylglucosamine-1-phosphate 98.57
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 98.57
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 98.56
PLN02296269 carbonate dehydratase 98.56
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 98.55
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 98.55
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 98.55
PRK13627196 carnitine operon protein CaiE; Provisional 98.54
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 98.53
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 98.52
PLN02357360 serine acetyltransferase 98.5
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 98.49
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 98.49
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 98.49
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 98.46
PRK10191146 putative acyl transferase; Provisional 98.45
PLN02739355 serine acetyltransferase 98.45
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 98.41
TIGR03308 204 phn_thr-fam phosphonate metabolim protein, transfe 98.4
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.4
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 98.39
PRK11132273 cysE serine acetyltransferase; Provisional 98.39
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 98.38
PRK10191146 putative acyl transferase; Provisional 98.38
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 98.38
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 98.37
cd00897300 UGPase_euk Eukaryotic UGPase catalyses the synthes 98.37
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 98.37
COG1043 260 LpxA Acyl-[acyl carrier protein] 98.37
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 98.36
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.34
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.34
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.34
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 98.34
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 98.33
PLN02694294 serine O-acetyltransferase 98.32
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 98.31
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 98.3
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 98.3
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.27
PRK10092183 maltose O-acetyltransferase; Provisional 98.26
PRK10502182 putative acyl transferase; Provisional 98.26
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 98.25
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.24
COG1861241 SpsF Spore coat polysaccharide biosynthesis protei 98.23
COG1043 260 LpxA Acyl-[acyl carrier protein] 98.22
PRK10092183 maltose O-acetyltransferase; Provisional 98.22
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 98.22
PLN02357360 serine acetyltransferase 98.21
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 98.19
PLN02739355 serine acetyltransferase 98.18
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.18
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 98.16
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 98.15
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 98.15
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.13
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 98.1
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 98.09
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 98.08
PRK10502182 putative acyl transferase; Provisional 98.07
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 98.05
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 98.03
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.01
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.0
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 98.0
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 97.99
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 97.98
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 97.96
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.95
PLN02435493 probable UDP-N-acetylglucosamine pyrophosphorylase 97.95
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 97.93
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis pr 97.92
PF01704420 UDPGP: UTP--glucose-1-phosphate uridylyltransferas 97.91
PLN02241436 glucose-1-phosphate adenylyltransferase 97.9
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 97.77
COG4284472 UDP-glucose pyrophosphorylase [Carbohydrate transp 97.71
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 97.7
cd06424315 UGGPase UGGPase catalyzes the synthesis of UDP-Glu 97.68
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 97.67
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 97.65
PRK13412 974 fkp bifunctional fucokinase/L-fucose-1-P-guanylylt 97.6
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 97.41
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 97.33
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 97.3
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 97.28
PLN02830615 UDP-sugar pyrophosphorylase 97.23
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 97.22
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 97.21
COG4801 277 Predicted acyltransferase [General function predic 97.17
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.09
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 97.05
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 97.04
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 96.76
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 96.3
KOG2638498 consensus UDP-glucose pyrophosphorylase [Carbohydr 96.03
COG4801 277 Predicted acyltransferase [General function predic 95.24
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 94.82
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 94.6
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 93.35
KOG2388477 consensus UDP-N-acetylglucosamine pyrophosphorylas 91.6
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 90.99
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 89.72
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 89.31
cd06423180 CESA_like CESA_like is the cellulose synthase supe 88.01
TIGR01556281 rhamnosyltran L-rhamnosyltransferase. Rhamnolipids 87.76
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 86.83
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 86.33
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 86.33
cd04188211 DPG_synthase DPG_synthase is involved in protein N 85.74
KOG2978238 consensus Dolichol-phosphate mannosyltransferase [ 84.6
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 84.51
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Famil 84.4
cd06442224 DPM1_like DPM1_like represents putative enzymes si 84.11
PRK10714325 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi 84.04
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Famil 83.12
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 81.56
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 81.14
cd06435236 CESA_NdvC_like NdvC_like proteins in this family a 80.98
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=2.8e-56  Score=386.39  Aligned_cols=366  Identities=61%  Similarity=1.014  Sum_probs=317.0

Q ss_pred             ceEEEEEecCCCCCCccCCCCCCCCCCCceeCCcchhHHHHHhcCc------EEEEcccchHHHHHHHHhhcccCCccEE
Q 016989            8 KVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKR------IYLVGFYEEREFALYVSSISNELRIPVR   81 (379)
Q Consensus         8 ~~~aVIla~G~~~gtRl~~lt~~~pK~llpi~g~pli~~~i~~l~~------iiv~~~~~~~~i~~~l~~~~~~~~~~i~   81 (379)
                      +++||||.||+|+||||+||..+.||||+||+|+|||+|.|+.+.+      |++++.++++.+.+|+......+.+.+.
T Consensus         2 ~~~AVIlVGGP~kGTRFRPLSf~vPKPLfpiaG~pmI~Hhi~ac~qi~~l~eI~LvGFy~e~~f~~fis~~~~e~~~pvr   81 (407)
T KOG1460|consen    2 KVKAVILVGGPQKGTRFRPLSFNVPKPLFPIAGVPMIHHHISACKQISGLAEILLVGFYEERVFTDFISAIQQEFKVPVR   81 (407)
T ss_pred             ceEEEEEecCCCCCccccccccCCCCCccccCCcchhhhhHHHHhcccchhheeEEecccchHHHHHHHHHHhhcccchh
Confidence            5799999999999999999999999999999999999999999987      9999999888899999988888999999


Q ss_pred             EecCCCCCChHHHHHHHHHhhccCCCCeEEEEcCCeeecCChHHHHHHHHhcCCceEEEEEEeCCCCCCceeEEEEeCCC
Q 016989           82 YLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDT  161 (379)
Q Consensus        82 ~~~~~~~~g~~~al~~~~~~i~~~~~~~~lv~~gD~i~~~dl~~~l~~~~~~~~~~ti~~~~~~~~~~~~~g~v~~d~~~  161 (379)
                      |..++.++||++.|+.-++.+-...|+.+++++||..+++.|++|++.|.+.+...++++++....++.+||.++.|+++
T Consensus        82 YL~E~~plGtaGgLyhFrdqIl~g~ps~vFvlnaDVCcsfPl~~ml~ahr~~g~~~tll~tkvs~e~asnfG~lV~dP~t  161 (407)
T KOG1460|consen   82 YLREDNPLGTAGGLYHFRDQILAGSPSAVFVLNADVCCSFPLQDMLEAHRRYGGIGTLLVTKVSREQASNFGCLVEDPST  161 (407)
T ss_pred             hhccCCCCCcccceeehhhHHhcCCCceEEEEecceecCCcHHHHHHHHhhcCCceEEEEEEecHhHhhccCeeeecCCc
Confidence            99999999999999999998876678899999999999999999999999999999999999988889999999999889


Q ss_pred             CcEEEeeecCCCcccceeeeeEEEeCHhhHHHhhccccccccchhhhhcchhhhhhhhccccccccccccccccccccCC
Q 016989          162 NELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGK  241 (379)
Q Consensus       162 ~~v~~~~ekp~~~~~~~~~~Giy~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~d~l~~l~~~  241 (379)
                      ++|+.+.|||...-++.+++|+|+|++++|+.+.+....+.+-..  ...+...+++    .+.||..|+.|++..|+.+
T Consensus       162 ~evlHYveKPsTfvSd~InCGvYlF~~eif~~i~~v~~q~~~~~~--~~~~~~~l~~----g~~d~irLeqDvlspLag~  235 (407)
T KOG1460|consen  162 GEVLHYVEKPSTFVSDIINCGVYLFTPEIFNAIAEVYRQRQDLLE--VEKDLPLLQP----GPADFIRLEQDVLSPLAGS  235 (407)
T ss_pred             CceEEeecCcchhhhcccceeEEEecHHHHHHHHHHHHHHHhhhh--hhhcccccCC----CccceEEeechhhhhhcCC
Confidence            999999999999999999999999999999999877644322010  0112223333    3789999999999999999


Q ss_pred             ceEEEEEcccchhhcCCccchhhcchHHHHhhhhcCCccccCCC-----------------CCCCeEEecCeEECCCcEE
Q 016989          242 KQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGD-----------------GTKNATIIGDVYVHPSAKI  304 (379)
Q Consensus       242 ~~v~~~~~~~~w~~i~t~~d~~~a~~~~l~~~~~~~~~~~~~~~-----------------~~~~~~i~~~~~i~~~~~i  304 (379)
                      .++++|..+++|.++.|+..-+.|+++|+++++...+..+..++                 .+++++|+|+|.||.+++|
T Consensus       236 k~lY~y~t~~fW~QiKtagsal~as~lYLs~yk~t~p~~Lak~pgt~a~IigdVyIhPsakvhptAkiGPNVSIga~vrv  315 (407)
T KOG1460|consen  236 KQLYAYETTDFWSQIKTAGSALYASRLYLSQYKRTHPARLAKGPGTQAEIIGDVYIHPSAKVHPTAKIGPNVSIGANVRV  315 (407)
T ss_pred             CceEEEecccHHHHhccccceeehhhhHHHHHhhcCchhhcCCCCCCceEEeeeEEcCcceeCCccccCCCceecCCcee
Confidence            99999999999999999999999999999999876666554332                 1466777777777777777


Q ss_pred             CCCCC-------------CCcEEeceEECCCCEECCCcEEeecccccc----cccceEECCCcEECCCcEEeccEECCCc
Q 016989          305 HPTAK-------------ENAVVTNAIVGWKSSIGRWSRVQAEGDFNA----KLGITILGEAVGVEDEVVVTNSIVLPNK  367 (379)
Q Consensus       305 ~~~~~-------------~~~~i~~s~ig~~~~ig~~~~i~~~~~~~~----~~~~sii~~~~~i~~~~~i~~~ii~~~~  367 (379)
                      ++|++             +++.|-+|+||..|.||..++|...-+..+    .+.-+++|+.|.+++.|.|.||++.++-
T Consensus       316 g~GvRl~~sIIl~d~ei~enavVl~sIigw~s~iGrWaRVe~~pv~~s~~~~~~a~Tilga~v~v~dev~v~~s~vlp~k  395 (407)
T KOG1460|consen  316 GPGVRLRESIILDDAEIEENAVVLHSIIGWKSSIGRWARVEGIPVEPSPNLPFAALTILGADVSVEDEVIVLNSIVLPNK  395 (407)
T ss_pred             cCCceeeeeeeccCcEeeccceEEeeeecccccccceeeecccccccCCCCCcceeEEecccceecceeEEeeeeEecCC
Confidence            77776             788888899999999999998877655422    2334899999999999999999999999


Q ss_pred             eecccccccccC
Q 016989          368 TLNVSVHQEIIL  379 (379)
Q Consensus       368 ~i~~~~~~~~~~  379 (379)
                      .+.-.+.++||+
T Consensus       396 ~l~vs~~~eIil  407 (407)
T KOG1460|consen  396 ELNVSVQDEIIL  407 (407)
T ss_pred             ccceeeecceeC
Confidence            999999999986



>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>PRK10122 GalU regulator GalF; Provisional Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate [] Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PLN02474 UTP--glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2 Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02830 UDP-sugar pyrophosphorylase Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG2638 consensus UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>KOG2388 consensus UDP-N-acetylglucosamine pyrophosphorylase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>TIGR01556 rhamnosyltran L-rhamnosyltransferase Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>KOG2978 consensus Dolichol-phosphate mannosyltransferase [General function prediction only] Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
2ggo_A401 Crystal Structure Of Glucose-1-Phosphate Thymidylyl 2e-06
3juj_A281 The Crystal Structure Of Apo- Udp-Glucose Pyrophosp 1e-05
3hl3_A269 2.76 Angstrom Crystal Structure Of A Putative Gluco 4e-05
1mc3_A296 Crystal Structure Of Rffh Length = 296 4e-04
1h5s_D293 Thymidylyltransferase Complexed With Tmp Length = 2 5e-04
1h5r_B293 Thymidylyltransferase Complexed With Thimidine And 6e-04
1h5t_A293 Thymidylyltransferase Complexed With Thymidylyldiph 7e-04
1h5s_A293 Thymidylyltransferase Complexed With Tmp Length = 2 7e-04
>pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 54/203 (26%), Positives = 86/203 (42%), Gaps = 30/203 (14%) Query: 11 AVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVS 70 A I+ G G R P++ PK P+ +P++ + I ++ + R+ + VS Sbjct: 3 AFILAAGS--GERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGI------RDITVIVS 54 Query: 71 SISNEL------RIPVRYLRED-KPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPL 123 S + E I + ++D K G+A F D + F ++C L Sbjct: 55 SKNKEYFEKKLKEISIVTQKDDIKGTGAAILSAKFNDEALIIYGDLFFSNEKEICNIITL 114 Query: 124 PEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGV 183 E I+ +KVS + +G LV D + N L EKPE S+LIN G+ Sbjct: 115 KE-----------NAIIGVKVS--NPKDYGVLVLD-NQNNLSKIIEKPEIPPSNLINAGI 160 Query: 184 YVFTPDIFNAIQGVS-SQRKDRE 205 Y DIF + +S S+R + E Sbjct: 161 YKLNSDIFTYLDKISISERGELE 183
>pdb|3JUJ|A Chain A, The Crystal Structure Of Apo- Udp-Glucose Pyrophosphorylase Length = 281 Back     alignment and structure
>pdb|3HL3|A Chain A, 2.76 Angstrom Crystal Structure Of A Putative Glucose-1-Phosphate Thymidylyltransferase From Bacillus Anthracis In Complex With A Sucrose. Length = 269 Back     alignment and structure
>pdb|1MC3|A Chain A, Crystal Structure Of Rffh Length = 296 Back     alignment and structure
>pdb|1H5S|D Chain D, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|1H5R|B Chain B, Thymidylyltransferase Complexed With Thimidine And Glucose- 1-Phospate Length = 293 Back     alignment and structure
>pdb|1H5T|A Chain A, Thymidylyltransferase Complexed With Thymidylyldiphosphate- Glucose Length = 293 Back     alignment and structure
>pdb|1H5S|A Chain A, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 2e-30
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 2e-27
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 9e-24
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 7e-21
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 3e-19
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 9e-14
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 7e-12
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 2e-10
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 5e-10
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 6e-09
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 1e-06
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 7e-05
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 1e-04
3pnn_A303 Conserved domain protein; structural genomics, PSI 1e-04
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 3e-04
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 3e-04
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 3e-04
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 5e-04
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 5e-04
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 6e-04
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 6e-04
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
 Score =  119 bits (300), Expect = 2e-30
 Identities = 79/368 (21%), Positives = 135/368 (36%), Gaps = 79/368 (21%)

Query: 11  AVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACK-----RIYLVGFYEEREF 65
           A I+  G   G R  P++   PK   P+  +P++ + I   +      I ++   + +E 
Sbjct: 3   AFILAAG--SGERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGIRDITVIVSSKNKE- 59

Query: 66  ALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFP--L 123
             Y      E+ I     ++D   G+  A+ + +     D      ++  D+  S    +
Sbjct: 60  --YFEKKLKEISI---VTQKDDIKGTGAAILSAKF---NDE---ALIIYGDLFFSNEKEI 108

Query: 124 PEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGV 183
             ++    N      I+ +KV   +   +G LV D   N L    EKPE   S+LIN G+
Sbjct: 109 CNIITLKEN-----AIIGVKV--SNPKDYGVLVLDNQ-NNLSKIIEKPEIPPSNLINAGI 160

Query: 184 YVFTPDIFNAIQGVS-SQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKK 242
           Y    DIF  +  +S S+R + E                 LT        D ++ +A   
Sbjct: 161 YKLNSDIFTYLDKISISERGELE-----------------LT--------DAINLMAKDH 195

Query: 243 QLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTK---NATIIGDVYVH 299
           ++   E   +W  I  P   +  +   L        NL+ S +      N  I G V + 
Sbjct: 196 RVKVIEYEGYWMDIGKPWNIIDVNKWAL-------DNLVFSQNLGNVEDNVKIKGKVIIE 248

Query: 300 PSAKIHPTAKENAVVTN-AIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVV 358
             A+I         +     +G  S IG  S ++           TIL E   +   V V
Sbjct: 249 EDAEIKS----GTYIEGPVYIGKGSEIGPNSYLRPY---------TILVEKNKIGASVEV 295

Query: 359 TNSIVLPN 366
             S+++  
Sbjct: 296 KESVIMEG 303


>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Length = 259 Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Length = 232 Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 323 Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} Length = 246 Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Length = 303 Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Length = 228 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Length = 234 Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Length = 281 Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Length = 297 Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 100.0
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 100.0
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 100.0
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 100.0
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 100.0
4fce_A 459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 100.0
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, c 100.0
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 100.0
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 100.0
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 100.0
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 99.98
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 99.98
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 99.97
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose 99.97
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 99.97
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 99.97
3pnn_A303 Conserved domain protein; structural genomics, PSI 99.97
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 99.97
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 99.96
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.95
2x65_A336 Mannose-1-phosphate guanylyltransferase; nucleotid 99.93
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 99.93
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.93
2cu2_A337 Putative mannose-1-phosphate guanylyl transferase; 99.92
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 99.92
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.9
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 99.89
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 99.88
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.88
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 99.86
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 99.83
2icy_A469 Probable UTP-glucose-1-phosphate uridylyltransfera 99.81
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.78
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 99.77
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 99.77
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 99.76
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 99.75
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 99.75
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.74
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT 99.72
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 99.7
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 99.67
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 99.66
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.65
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 99.63
1jv1_A505 Glcnac1P uridyltransferase isoform 1: AGX1; nucleo 99.63
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosy 99.62
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 99.6
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.59
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.57
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 99.54
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 99.54
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 99.49
2oeg_A505 UTP-glucose-1-phosphate uridylyltransferase 2, put 99.47
1w55_A371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 99.43
3oc9_A405 UDP-N-acetylglucosamine pyrophosphorylase; structu 99.36
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.35
2yqc_A486 UDP-N-acetylglucosamine pyrophosphorylase; uridine 99.32
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.25
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.02
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 98.99
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 98.94
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 98.92
3r3r_A187 Ferripyochelin binding protein; structural genomic 98.91
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 98.9
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 98.9
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 98.9
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 98.89
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 98.89
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 98.88
3pmo_A 372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 98.86
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 98.86
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 98.86
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 98.85
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 98.85
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 98.85
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 98.84
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 98.83
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 98.83
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 98.82
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 98.79
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 98.79
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 98.78
4e79_A 357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 98.78
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 98.78
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 98.78
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 98.78
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 98.77
3r3r_A187 Ferripyochelin binding protein; structural genomic 98.77
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 98.77
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 98.77
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 98.77
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 98.76
4e79_A 357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 98.76
4eqy_A 283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 98.75
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 98.75
4e6u_A 265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 98.74
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structura 98.74
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 98.73
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 98.73
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 98.73
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 98.73
4eqy_A 283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 98.73
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 98.72
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 98.72
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 98.71
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 98.71
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 98.71
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 98.7
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 98.7
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 98.7
4e6u_A 265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 98.7
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 98.69
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 98.69
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 98.68
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 98.67
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 98.67
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 98.66
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 98.66
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 98.66
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, c 98.65
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 98.65
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 98.65
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 98.63
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 98.63
3srt_A188 Maltose O-acetyltransferase; structural genomics, 98.62
4fce_A 459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 98.62
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 98.62
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 98.61
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 98.61
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 98.6
3pmo_A 372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 98.59
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 98.59
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 98.58
3srt_A188 Maltose O-acetyltransferase; structural genomics, 98.56
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 98.56
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 98.55
4hur_A220 Virginiamycin A acetyltransferase; structural geno 98.55
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 98.53
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 98.52
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 98.52
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 98.51
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 98.51
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 98.49
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 98.49
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 98.48
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 98.44
3r3i_A528 UTP--glucose-1-phosphate uridylyltransferase; ross 98.41
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 98.36
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 98.36
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 98.36
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 98.36
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 98.32
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 98.31
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 98.3
4hur_A220 Virginiamycin A acetyltransferase; structural geno 98.29
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 98.28
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.27
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.26
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 98.23
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 98.17
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.14
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.02
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 98.02
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.0
3gue_A484 UTP-glucose-1-phosphate uridylyltransferase 2; pho 97.93
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 97.75
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 97.73
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 97.72
3ogz_A630 UDP-sugar pyrophosphorylase; LEFT handed beta heli 97.41
2i5e_A211 Hypothetical protein MM_2497; APC86122, methanosar 97.06
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 88.86
3bcv_A240 Putative glycosyltransferase protein; protein stru 87.81
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 86.62
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
Probab=100.00  E-value=1.3e-45  Score=357.90  Aligned_cols=330  Identities=17%  Similarity=0.268  Sum_probs=245.1

Q ss_pred             CCCceEEEEEecCCCCCCccCCCCCCCCCCCceeCCc-chhHHHHHhcCc-----EEEEcccchHHHHHHHHhhcccCCc
Q 016989            5 EDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQ-PMVHHPISACKR-----IYLVGFYEEREFALYVSSISNELRI   78 (379)
Q Consensus         5 ~~~~~~aVIla~G~~~gtRl~~lt~~~pK~llpi~g~-pli~~~i~~l~~-----iiv~~~~~~~~i~~~l~~~~~~~~~   78 (379)
                      |+++|+|||||||  .|+||+|+|..+||+|+|++|+ |||+|+++.|.+     |+|++.+..+.+.+|+...   ++.
T Consensus         9 mm~~~~avILAaG--~gtRl~plT~~~pK~llpi~gk~pli~~~l~~l~~~gi~~i~vv~~~~~~~i~~~~~~~---~~~   83 (420)
T 3brk_X            9 LARDAMAYVLAGG--RGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRG---WDF   83 (420)
T ss_dssp             GGGGEEEEEEECC--CCGGGGGGGSSSCGGGSEETTTEETHHHHHHHHHHTTCCEEEEEECTTCHHHHHHHHHH---SCC
T ss_pred             hhhceEEEEEcCC--CCCccchhhcCCcccccccCCCCcHHHHHHHHHHhCCCCeEEEEeCCChHHHHHHHhhh---hcc
Confidence            5567899999999  9999999999999999999999 999999999875     6666665555688888752   221


Q ss_pred             -------cEEEec--CC--CC---CChHHHHHHHHHhhccCCCCeEEEEcCCeeecCChHHHHHHHHhcCCceEEEEEEe
Q 016989           79 -------PVRYLR--ED--KP---HGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKV  144 (379)
Q Consensus        79 -------~i~~~~--~~--~~---~g~~~al~~~~~~i~~~~~~~~lv~~gD~i~~~dl~~~l~~~~~~~~~~ti~~~~~  144 (379)
                             .+.+..  +.  .+   .|++++++.+++++.....++|++++||++++.++.++++.|.++++++|+++.+.
T Consensus        84 ~~~~~~~~v~i~~~~~~~~~~~~~~Gt~~al~~a~~~l~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~~~~~~tl~~~~~  163 (420)
T 3brk_X           84 FRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGCLEV  163 (420)
T ss_dssp             CCGGGTCEEEEECCC-------CCCCHHHHHHTTHHHHHHHCCSEEEEEESSCEECBCTHHHHHHHHHTTCSEEEEEEEE
T ss_pred             ccccccCCEEEeCccccccCCccccCCHHHHHHHHHHHHhcCCCEEEEecccEEEchHHHHHHHHHHHcCCeEEEEEeec
Confidence                   133322  11  12   79999999999888642235799999999888899999999998888899998876


Q ss_pred             CCCCCCceeEEEEeCCCCcEEEeeecCCCcc-------cceeeeeEEEeCHhhH-HHhhccccccccchhhhhcchhhhh
Q 016989          145 SAESASQFGELVADPDTNELLHYTEKPETFV-------SDLINCGVYVFTPDIF-NAIQGVSSQRKDRENLRRVSSFEAL  216 (379)
Q Consensus       145 ~~~~~~~~g~v~~d~~~~~v~~~~ekp~~~~-------~~~~~~Giy~~~~~~l-~~l~~~~~~~~~~~~~~~~~~~~~~  216 (379)
                      +..++..||.+..++ +++|..|.|||....       ..+.++|+|+|++++| +.+.+......+             
T Consensus       164 ~~~~~~~~g~v~~d~-~g~v~~~~ekp~~~~~~~~~~~~~~~~~Giy~~~~~~l~~~l~~~~~~~~~-------------  229 (420)
T 3brk_X          164 PRMEATGFGVMHVNE-KDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAVRRDAADPTS-------------  229 (420)
T ss_dssp             ETTGGGGSEEEEECT-TSBEEEEEESCSSCCCBTTBTTEEEEEEEEEEEEHHHHHHHHTSSCCC----------------
T ss_pred             CccccCcccEEEECC-CCcEEEeEeCCCccccccccccceEEeeeeEEEeHHHHHHHHHHhcccCCc-------------
Confidence            545677999998884 789999999986543       6799999999999986 566543321110             


Q ss_pred             hhhccccccccccccccccccccCCceEEEEEc-----------ccchhhcCCccchhhcchHHHHhhhhcC---Cc--c
Q 016989          217 QSATRNLTTDFVRLDQDILSPLAGKKQLYTYET-----------MDFWEQIKTPGMSLKCSGLYLAQFRLTS---PN--L  280 (379)
Q Consensus       217 ~~~~~~~~~~~~~l~~d~l~~l~~~~~v~~~~~-----------~~~w~~i~t~~d~~~a~~~~l~~~~~~~---~~--~  280 (379)
                             ..+|   ..++++.++++.++++|.+           +++|.++|||++|+++++.++.++....   +.  +
T Consensus       230 -------~~~~---~~d~l~~li~~g~v~~~~~~~~~~~~~~~~~~~~~dI~t~~d~~~a~~~ll~~~~~~~~~~~~~~i  299 (420)
T 3brk_X          230 -------SRDF---GKDIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPI  299 (420)
T ss_dssp             -----------------CTTHHHHHSCEEEEEHHHHBCCCTTCSSCCEECCCSHHHHHHHHHHTTSSSCSSCTTCCSSCC
T ss_pred             -------cccc---hHHHHHHHhhhCcEEEEEeccccccccccCCCEEEECCCHHHHHHHHHHHhCCCchhhcCCCCCce
Confidence                   1112   1577887776669999999           8899999999999999987765432111   00  1


Q ss_pred             ccCCCCCCCeEEec-----CeEECCCcEECCCCC-CCcEEeceEECCCCEECCCcEEeecccccccccceEECCCcEECC
Q 016989          281 LASGDGTKNATIIG-----DVYVHPSAKIHPTAK-ENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVED  354 (379)
Q Consensus       281 ~~~~~~~~~~~i~~-----~~~i~~~~~i~~~~~-~~~~i~~s~ig~~~~ig~~~~i~~~~~~~~~~~~sii~~~~~i~~  354 (379)
                      .......+.+.+++     .+.+ +++.|+++|+ .++.|.+|+||++|.||++|.|.+          |+||++|.||+
T Consensus       300 ~~~~~i~~~~~i~~~~~~~~~~i-~~~~ig~~~~I~~~~i~~~~ig~~~~I~~~~~i~~----------~~i~~~~~i~~  368 (420)
T 3brk_X          300 WTYAEITPPAKFVHDDEDRRGSA-VSSVVSGDCIISGAALNRSLLFTGVRANSYSRLEN----------AVVLPSVKIGR  368 (420)
T ss_dssp             CCCCCCCCCCEEECBCSSCBCEE-ESCEECSSCEEESCEEESCEECTTCEECTTCEEEE----------EEECTTCEECT
T ss_pred             eeccccCCCcEEecccccCCcEe-cCCEECCCCEEcCCEEeCcEEcCCCEECCCCEEcc----------eEEcCCCEECC
Confidence            11112234555554     1111 1444444444 455788999999999999999987          99999999999


Q ss_pred             CcEEeccEECCCceeccccc
Q 016989          355 EVVVTNSIVLPNKTLNVSVH  374 (379)
Q Consensus       355 ~~~i~~~ii~~~~~i~~~~~  374 (379)
                      +|.|.+|+||+++.|++++.
T Consensus       369 ~~~i~~~~ig~~~~i~~~~~  388 (420)
T 3brk_X          369 HAQLSNVVIDHGVVIPEGLI  388 (420)
T ss_dssp             TCEEEEEEECTTCEECTTCE
T ss_pred             CCEEeceEECCCCEECCCCE
Confidence            99999999999999998864



>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei} Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A* Back     alignment and structure
>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 379
d1fxoa_292 c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa 2e-36
d1mc3a_291 c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} 6e-35
d1lvwa_295 c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri 3e-32
d1yp2a2307 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr 7e-23
d1tzfa_259 c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf 6e-18
d1g97a2250 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate 2e-13
d1jyka_229 c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer 2e-13
d2oi6a2248 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate 1e-10
d2cu2a2268 c.68.1.20 (A:1-268) Putative mannose-1-phosphate g 9e-10
d1vgwa_226 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 2e-09
d2dpwa1231 c.68.1.19 (A:1-231) Uncharacterized protein TTHA01 3e-07
d1i52a_225 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 3e-07
d1vpaa_221 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 5e-07
d1w77a1226 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl- 6e-07
d1w55a1205 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, 6e-05
d1eyra_225 c.68.1.13 (A:) CMP acylneuraminate synthetase {Nei 0.001
d1qwja_228 c.68.1.13 (A:) CMP acylneuraminate synthetase {Mou 0.003
d1e5ka_188 c.68.1.8 (A:) Molybdenum cofactor biosynthesis pro 0.004
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RmlA (RfbA)
species: Pseudomonas aeruginosa [TaxId: 287]
 Score =  131 bits (332), Expect = 2e-36
 Identities = 38/201 (18%), Positives = 78/201 (38%), Gaps = 13/201 (6%)

Query: 11  AVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISAC-----KRIYLVGFYEEREF 65
            +I+ GG   GTR  P +L I K L P+  +PM+++P+S       + I ++   ++   
Sbjct: 4   GIILAGG--SGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPR 61

Query: 66  ALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPE 125
              +    +   + ++Y  +  P G A A           N     +L  ++       E
Sbjct: 62  FQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGES--FIGNDLSALVLGDNLYYGHDFHE 119

Query: 126 MLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYV 185
           +L +        ++    V      ++G +  D    + +   EKP    S+    G+Y 
Sbjct: 120 LLGSASQRQTGASVFAYHVL--DPERYGVVEFDQG-GKAISLEEKPLEPKSNYAVTGLYF 176

Query: 186 FTPDIFNAIQGVS-SQRKDRE 205
           +   + +  + +  S R + E
Sbjct: 177 YDQQVVDIARDLKPSPRGELE 197


>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229 Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 248 Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Length = 268 Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Length = 226 Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Length = 231 Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Length = 221 Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 226 Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Length = 205 Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Length = 225 Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 100.0
d1mc3a_291 RffH {Escherichia coli [TaxId: 562]} 100.0
d1lvwa_295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 100.0
d1yp2a2307 Glucose-1-phosphate adenylyltransferase small subu 100.0
d1tzfa_259 Glucose-1-phosphate cytidylyltransferase RfbF {Sal 99.96
d2cu2a2268 Putative mannose-1-phosphate guanylyl transferase 99.95
d1jyka_229 CTP:phosphocholine cytidylytransferase LicC {Strep 99.95
d1g97a2250 N-acetylglucosamine 1-phosphate uridyltransferase 99.92
d2oi6a2248 N-acetylglucosamine 1-phosphate uridyltransferase 99.89
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.66
d1vpaa_221 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.63
d1i52a_225 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.6
d1vgwa_226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.56
d1h7ea_245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.53
d1vh1a_246 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.5
d1vica_255 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.48
d1eyra_225 CMP acylneuraminate synthetase {Neisseria meningit 99.45
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.39
d2dpwa1231 Uncharacterized protein TTHA0179 {Thermus thermoph 99.37
d1e5ka_188 Molybdenum cofactor biosynthesis protein MobA {Esc 99.33
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 99.32
d1w55a1205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 99.31
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 99.04
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.04
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 98.95
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 98.89
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 98.8
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 98.78
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 98.78
d2jf2a1 262 UDP N-acetylglucosamine acyltransferase {Escherich 98.74
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 98.71
d1j2za_ 259 UDP N-acetylglucosamine acyltransferase {Helicobac 98.65
d2jf2a1 262 UDP N-acetylglucosamine acyltransferase {Escherich 98.65
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 98.64
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 98.63
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 98.62
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 98.59
d1j2za_ 259 UDP N-acetylglucosamine acyltransferase {Helicobac 98.57
d1g97a1 196 N-acetylglucosamine 1-phosphate uridyltransferase 98.52
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 98.36
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 98.34
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 98.33
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 98.29
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.29
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 98.26
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 98.25
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 98.22
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 98.22
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 98.21
d1jv1a_501 UDP-N-acetylglucosamine pyrophosphorylase {Human ( 98.12
d2oi6a1 201 N-acetylglucosamine 1-phosphate uridyltransferase 98.08
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 98.08
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.0
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 97.92
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 97.8
d2f9ca1 320 Hypothetical protein YdcK {Salmonella enterica [Ta 97.62
d2f9ca1 320 Hypothetical protein YdcK {Salmonella enterica [Ta 97.51
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 85.76
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RmlA (RfbA)
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00  E-value=2.5e-40  Score=299.96  Aligned_cols=231  Identities=19%  Similarity=0.309  Sum_probs=197.9

Q ss_pred             ceEEEEEecCCCCCCccCCCCCCCCCCCceeCCcchhHHHHHhcCc-----EE-EEcccchHHHHHHHHhhcccCCccEE
Q 016989            8 KVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKR-----IY-LVGFYEEREFALYVSSISNELRIPVR   81 (379)
Q Consensus         8 ~~~aVIla~G~~~gtRl~~lt~~~pK~llpi~g~pli~~~i~~l~~-----ii-v~~~~~~~~i~~~l~~~~~~~~~~i~   81 (379)
                      +++|||||||  .||||+|+|..+||||+||+|+|||+|+|+.|..     |+ |++++....+.++++. ...+++++.
T Consensus         1 k~KavILAgG--~GtRl~plT~~~pKpllpi~gkPiI~~~l~~l~~~Gi~ei~ii~~~~~~~~i~~~~~~-~~~~g~~I~   77 (292)
T d1fxoa_           1 KRKGIILAGG--SGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGD-GSNWGLDLQ   77 (292)
T ss_dssp             CEEEEEECCC--CCTTTTTHHHHSCGGGSEETTEETTHHHHHHHHHTTCCEEEEEECTTTHHHHHHHHTT-SGGGTCEEE
T ss_pred             CcEEEEECCC--CCCcCChhhcCCCcccCEECCEehHHHHHHHHHHCCCCEEEEEeCcCCHHHHHHHhcc-ccccCeEEE
Confidence            3699999999  9999999999999999999999999999999976     54 5565666678888876 456889999


Q ss_pred             EecCCCCCChHHHHHHHHHhhccCCCCeEEEEcCCeeecCChHHHHHHHHhcCCceEEEEEEeCCCCCCceeEEEEeCCC
Q 016989           82 YLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDT  161 (379)
Q Consensus        82 ~~~~~~~~g~~~al~~~~~~i~~~~~~~~lv~~gD~i~~~dl~~~l~~~~~~~~~~ti~~~~~~~~~~~~~g~v~~d~~~  161 (379)
                      |+.|+++.|+++|++.|.++++++  +.++++++|.+++.|+.++++.|.+.++.+++++.++.  +|++||++..|. +
T Consensus        78 y~~q~~~~Gta~ai~~a~~~i~~~--~~~lil~dD~~~~~dl~~ll~~h~~~~~~~~i~~~~V~--~p~~yGV~~~d~-~  152 (292)
T d1fxoa_          78 YAVQPSPDGLAQAFLIGESFIGND--LSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVL--DPERYGVVEFDQ-G  152 (292)
T ss_dssp             EEECSSCCCGGGHHHHTHHHHTTS--EEEEEETTEEEECTTHHHHHHHHHTCCSSEEEEEEECS--CGGGSEEEEECT-T
T ss_pred             EccCCCCCcHHHHHHhhhhhcCCC--ceEEEEccccccCcCHHHHHHHHHhCCCCcEEEEEECC--CHHHCeEEEEcC-C
Confidence            999999999999999999999764  35778888888899999999999999998999999884  678999999985 7


Q ss_pred             CcEEEeeecCCCcccceeeeeEEEeCHhhHHHhhccccccccchhhhhcchhhhhhhhccccccccccccccccccccCC
Q 016989          162 NELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGK  241 (379)
Q Consensus       162 ~~v~~~~ekp~~~~~~~~~~Giy~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~d~l~~l~~~  241 (379)
                      +++..+.|||..+.++++.+|+|+|++++++.+.+..++.+++.++                        .|+++.+.++
T Consensus       153 ~ki~~~~EKP~~p~Snla~~G~Y~f~~~~~~~~~~l~~s~rgE~ei------------------------tD~~~~~l~~  208 (292)
T d1fxoa_         153 GKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEI------------------------TDVNRAYLER  208 (292)
T ss_dssp             SCEEEEEESCSSCSSSEEEEEEEEECTTHHHHHHHCCCCTTSSCCH------------------------HHHHHHHHHT
T ss_pred             CCEeEEEECCCCCCCCcEEEEEEEEChHHHHHHHhCCCCCCCchhh------------------------HHHHHHHHHc
Confidence            8999999999999999999999999999999998887665543221                        6788887777


Q ss_pred             ceEEEEEcc--cchhhcCCccchhhcchHHH
Q 016989          242 KQLYTYETM--DFWEQIKTPGMSLKCSGLYL  270 (379)
Q Consensus       242 ~~v~~~~~~--~~w~~i~t~~d~~~a~~~~l  270 (379)
                      .++.++.+.  .+|.|+||+++|++|+++..
T Consensus       209 ~~~~~~~~~~~~~W~D~Gt~~~l~~a~~~v~  239 (292)
T d1fxoa_         209 GQLSVEIMGRGYAWLDTGTHDSLLEAGQFIA  239 (292)
T ss_dssp             TCEEEEECCTTSEEEECCSHHHHHHHHHHHH
T ss_pred             CCeEEEEeCCCCEEEeCCCHHHHHHHHHHHH
Confidence            777666653  35999999999999986653



>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure