Citrus Sinensis ID: 016990

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38

MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYPFFTSLCFLVIVDGRLF

cccccccccccccccccccccccccccccccEEccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccEEEEccccc

cccccccccccccccccccccEEEHcccccEEEEcccccHHHcccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccEEEEcccEccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEEccccc

mkkedapdkgrtlsvdpnvprwvcqncrhflcivgvdsyadkylndssrstmhgssihasnsvlgstrmdnsfvvlpkqrpqshgvpprprgssaqseasqsgkamdESFVVIYKsesasdgggphipppeggtngpmqpnnsgfhSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTnvlndafpiwhdgefgtinnfrlgrlpkipvewDEINAAWGQACLLLHTMCqyfrpkfpypfftsLCFLVIVDGRLF

mkkedapdkgrtlsvdpnvprwVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQrpqshgvpprprgssAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSqtqveqplCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYPFFTSLCFLVIVDGRLF

MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRgssaqseasqsgKAMDESFVVIYKSESASDgggphipppeggTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLkeklkieeeerkleaaieeteKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYPFFTSLCFLVIVDGRLF

*****************NVPRWVCQNCRHFLCIVGVDSYADKYL******************************************************************VVI********************************HSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVL**********************************************FKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYPFFTSLCFLVIVDG***

*******************PRWVCQNCRHFLCIVGVDSYADKYL**************************************************************************************************************AFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEAC****************************************************************RYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYPFFTSLCFLVIVDGRLF

************LSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPK***************************MDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYPFFTSLCFLVIVDGRLF

*************SVDPNVPRWVCQNCRHFLCIVGVDSYADKYLN***************************************************************SF****K*****************************FHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYPFFTSLCFLVIVDG***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYPFFTSLCFLVIVDGRLF

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		379	2.2.26 [Sep-21-2011]
Q9M367		517	Beclin-1-like protein OS=	no	no	0.949	0.696	0.773	1e-157
Q54JI9		855	Beclin-1-like protein B O	yes	no	0.535	0.237	0.417	4e-39
Q6GP52		445	Beclin-1 OS=Xenopus laevi	N/A	no	0.741	0.631	0.319	6e-39
Q4A1L3		445	Beclin-1 OS=Xenopus tropi	yes	no	0.741	0.631	0.319	8e-39
Q5ZKS6		447	Beclin-1 OS=Gallus gallus	yes	no	0.730	0.619	0.324	5e-37
O88597		448	Beclin-1 OS=Mus musculus	yes	no	0.728	0.616	0.325	8e-37
Q91XJ1		448	Beclin-1 OS=Rattus norveg	yes	no	0.728	0.616	0.325	9e-37
Q4A1L4		448	Beclin-1 OS=Bos taurus GN	yes	no	0.736	0.622	0.335	2e-36
Q14457		450	Beclin-1 OS=Homo sapiens	yes	no	0.733	0.617	0.320	3e-36
Q5R878		450	Beclin-1 OS=Pongo abelii	yes	no	0.733	0.617	0.320	3e-36

>sp\|Q9M367\|BECN1_ARATH Beclin-1-like protein OS=Arabidopsis thaliana GN=At3g61710 PE=2 SV=2	Back alignment and function desciption

 Score =  555 bits (1429), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 280/362 (77%), Positives = 310/362 (85%), Gaps = 2/362 (0%)

Query: 1   MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHAS 60
           M+KE+ PDK RT+ +DPN+P+WVCQNC H L IVGVDSYA K+ ND   S   GSSIH +
Sbjct: 1   MRKEEIPDKSRTIPIDPNLPKWVCQNCHHSLTIVGVDSYAGKFFNDPPPSATQGSSIHGA 60

Query: 61  NSVLGSTRMDNSFVVLPKQRP-QSHGVPPRPRG-SSAQSEASQSGKAMDESFVVIYKSES 118
           NSVLGSTRMDNSFVVLP+ +P QS G+PPRPRG SS Q +A+QSGKAM+ESFVV+YKSE 
Sbjct: 61  NSVLGSTRMDNSFVVLPRHKPPQSQGIPPRPRGASSPQPDATQSGKAMEESFVVVYKSEP 120

Query: 119 ASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLS 178
            SD GG H    E G NGP+  N SGF++TI VL RAF+IA +QTQVEQPLCLECMRVLS
Sbjct: 121 VSDSGGSHNLSLEVGQNGPLHSNTSGFNATINVLTRAFDIARTQTQVEQPLCLECMRVLS 180

Query: 179 DKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEK 238
           DKL+KEV+DVTRD+EAYEAC+QRLEGE +DVLSEADFLKEK KIEEEERKL AAIEETEK
Sbjct: 181 DKLEKEVEDVTRDVEAYEACVQRLEGETQDVLSEADFLKEKKKIEEEERKLVAAIEETEK 240

Query: 239 QNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLEL 298
           QNAEVN +LKELE K  RF ELE+RYWQEFNNFQFQLIAHQEERDAI +KIEVSQAHLEL
Sbjct: 241 QNAEVNHQLKELEFKGNRFNELEDRYWQEFNNFQFQLIAHQEERDAILAKIEVSQAHLEL 300

Query: 299 LKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRP 358
           L +TNVL DAFPI +DGEFGTINNFRLGRLP I VEWDEINAAWGQACLLLHTMC YFRP
Sbjct: 301 LNKTNVLIDAFPIRNDGEFGTINNFRLGRLPAIKVEWDEINAAWGQACLLLHTMCNYFRP 360

Query: 359 KF 360
           KF
Sbjct: 361 KF 362

Arabidopsis thaliana (taxid: 3702)

>sp\|Q54JI9\|BECNB_DICDI Beclin-1-like protein B OS=Dictyostelium discoideum GN=atg6B PE=3 SV=1	Back alignment and function description

>sp\|Q6GP52\|BECN1_XENLA Beclin-1 OS=Xenopus laevis GN=becn1 PE=2 SV=1	Back alignment and function description

>sp\|Q4A1L3\|BECN1_XENTR Beclin-1 OS=Xenopus tropicalis GN=becn1 PE=2 SV=1	Back alignment and function description

>sp\|Q5ZKS6\|BECN1_CHICK Beclin-1 OS=Gallus gallus GN=BECN1 PE=2 SV=1	Back alignment and function description

>sp\|O88597\|BECN1_MOUSE Beclin-1 OS=Mus musculus GN=Becn1 PE=1 SV=3	Back alignment and function description

>sp\|Q91XJ1\|BECN1_RAT Beclin-1 OS=Rattus norvegicus GN=Becn1 PE=1 SV=1	Back alignment and function description

>sp\|Q4A1L4\|BECN1_BOVIN Beclin-1 OS=Bos taurus GN=BECN1 PE=2 SV=1	Back alignment and function description

>sp\|Q14457\|BECN1_HUMAN Beclin-1 OS=Homo sapiens GN=BECN1 PE=1 SV=2	Back alignment and function description

>sp\|Q5R878\|BECN1_PONAB Beclin-1 OS=Pongo abelii GN=BECN1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		379
73587480		505	beclin 1 protein [Malus x domestica]	0.926	0.695	0.805	1e-171
225454518		522	PREDICTED: beclin 1 protein [Vitis vinif	0.947	0.687	0.814	1e-168
73587486		479	beclin 1 protein [Vitis vinifera]	0.947	0.749	0.814	1e-167
224067974		516	predicted protein [Populus trichocarpa]	0.955	0.701	0.818	1e-167
73587476		511	beclin 1 protein [Gossypium raimondii]	0.955	0.708	0.831	1e-167
255564727		523	Beclin-1, putative [Ricinus communis] gi	0.955	0.692	0.839	1e-167
357456733		517	Beclin 1 protein [Medicago truncatula] g	0.941	0.690	0.804	1e-158
351724517		509	beclin 1 protein [Glycine max] gi\|735874	0.944	0.703	0.781	1e-158
42572759		386	Beclin-1-like protein [Arabidopsis thali	0.984	0.966	0.755	1e-158
357456731		567	Beclin 1 protein [Medicago truncatula] g	0.941	0.629	0.690	1e-158

>gi\|73587480\|emb\|CAJ27522.1\| beclin 1 protein [Malus x domestica]	Back alignment and taxonomy information

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 286/355 (80%), Positives = 319/355 (89%), Gaps = 4/355 (1%)

Query: 8   DKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGST 67
           ++GR+ +VDPNVPR+VCQNCR+ LC+VG DSYA+K+ +D SRS M GSS+H + SVL S 
Sbjct: 3   ERGRSFTVDPNVPRYVCQNCRNSLCVVGADSYAEKFFHDFSRSGMQGSSMHGATSVLSSM 62

Query: 68  RMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHI 127
           RMDNSFVVLP+QR Q  GVPPRPRG +  +    SG AMDESFVV+ KSES++DGGG H+
Sbjct: 63  RMDNSFVVLPQQRAQ--GVPPRPRGGAVNT--GHSGNAMDESFVVVNKSESSADGGGAHL 118

Query: 128 PPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDD 187
           P P+GG NGP+QPNNSGFHSTI++LKRAFEIA++QTQVEQPLC+ECMRVLSDKLDKEV+D
Sbjct: 119 PSPDGGPNGPLQPNNSGFHSTISLLKRAFEIASTQTQVEQPLCVECMRVLSDKLDKEVED 178

Query: 188 VTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAEL 247
           V RDI+AYEACL+RLEGE R+VLSE DFLKEKLKIEEE+RKLEA IEE EKQNAEVN EL
Sbjct: 179 VNRDIKAYEACLKRLEGETREVLSETDFLKEKLKIEEEQRKLEAEIEEMEKQNAEVNNEL 238

Query: 248 KELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND 307
           K LELKS RFKELEE+YW +FNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND
Sbjct: 239 KGLELKSSRFKELEEQYWHKFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLND 298

Query: 308 AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPY 362
           AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKF Y
Sbjct: 299 AFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFQY 353

Source: Malus x domestica

Species: Malus x domestica

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225454518\|ref\|XP_002277370.1\| PREDICTED: beclin 1 protein [Vitis vinifera] gi\|297745431\|emb\|CBI40511.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|73587486\|emb\|CAJ27525.1\| beclin 1 protein [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224067974\|ref\|XP_002302626.1\| predicted protein [Populus trichocarpa] gi\|222844352\|gb\|EEE81899.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|73587476\|emb\|CAJ27520.1\| beclin 1 protein [Gossypium raimondii]	Back alignment and taxonomy information

>gi\|255564727\|ref\|XP_002523358.1\| Beclin-1, putative [Ricinus communis] gi\|223537446\|gb\|EEF39074.1\| Beclin-1, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|357456733\|ref\|XP_003598647.1\| Beclin 1 protein [Medicago truncatula] gi\|355487695\|gb\|AES68898.1\| Beclin 1 protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|351724517\|ref\|NP_001238340.1\| beclin 1 protein [Glycine max] gi\|73587474\|emb\|CAJ27519.1\| beclin 1 protein [Glycine max]	Back alignment and taxonomy information

>gi\|42572759\|ref\|NP_974475.1\| Beclin-1-like protein [Arabidopsis thaliana] gi\|332646724\|gb\|AEE80245.1\| Beclin-1-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|357456731\|ref\|XP_003598646.1\| Beclin 1 protein [Medicago truncatula] gi\|355487694\|gb\|AES68897.1\| Beclin 1 protein [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		379
TAIR\|locus:2076715		517	ATG6 "AT3G61710" [Arabidopsis	0.949	0.696	0.685	3.1e-131
MGI\|MGI:1891828		448	Becn1 "beclin 1, autophagy rel	0.532	0.450	0.373	3.1e-35
UNIPROTKB\|Q14457		450	BECN1 "Beclin-1" [Homo sapiens	0.532	0.448	0.368	5.1e-35
UNIPROTKB\|Q4A1L4		448	BECN1 "Beclin-1" [Bos taurus (	0.532	0.450	0.368	6.5e-35
UNIPROTKB\|E2RNW7		463	AARSD1 "Uncharacterized protei	0.532	0.436	0.368	6.5e-35
UNIPROTKB\|Q4A1L5		448	BECN1 "Beclin-1" [Sus scrofa (	0.532	0.450	0.368	6.5e-35
UNIPROTKB\|Q5R878		450	BECN1 "Beclin-1" [Pongo abelii	0.532	0.448	0.368	6.5e-35
DICTYBASE\|DDB_G0288021		855	atg6B "autophagy protein Apg6	0.588	0.260	0.359	1.2e-34
UNIPROTKB\|F1S1F6		448	BECN1 "Beclin-1" [Sus scrofa (	0.532	0.450	0.368	1.7e-34
RGD\|620190		448	Becn1 "beclin 1, autophagy rel	0.532	0.450	0.368	2.2e-34

TAIR\|locus:2076715 ATG6 "AT3G61710" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1287 (458.1 bits), Expect = 3.1e-131, P = 3.1e-131
 Identities = 248/362 (68%), Positives = 276/362 (76%)

Query:     1 MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHAS 60
             M+KE+ PDK RT+ +DPN+P+WVCQNC H L IVGVDSYA K+ ND   S   GSSIH +
Sbjct:     1 MRKEEIPDKSRTIPIDPNLPKWVCQNCHHSLTIVGVDSYAGKFFNDPPPSATQGSSIHGA 60

Query:    61 NSVLGSTRMDNSFVVLPKQRP-QSHGVPPRPRXXXXXX-XXXXXXKAMDESFVVIYKSES 118
             NSVLGSTRMDNSFVVLP+ +P QS G+PPRPR             KAM+ESFVV+YKSE 
Sbjct:    61 NSVLGSTRMDNSFVVLPRHKPPQSQGIPPRPRGASSPQPDATQSGKAMEESFVVVYKSEP 120

Query:   119 ASDXXXXXXXXXXXXTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLS 178
              SD             NGP+  N SGF++TI VL RAF+IA +QTQVEQPLCLECMRVLS
Sbjct:   121 VSDSGGSHNLSLEVGQNGPLHSNTSGFNATINVLTRAFDIARTQTQVEQPLCLECMRVLS 180

Query:   179 DKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLXXXXXXXXXXXXXXXXXXXXXK 238
             DKL+KEV+DVTRD+EAYEAC+QRLEGE +DVLSEADFL                     K
Sbjct:   181 DKLEKEVEDVTRDVEAYEACVQRLEGETQDVLSEADFLKEKKKIEEEERKLVAAIEETEK 240

Query:   239 QNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLEL 298
             QNAEVN +LKELE K  RF ELE+RYWQEFNNFQFQLIAHQEERDAI +KIEVSQAHLEL
Sbjct:   241 QNAEVNHQLKELEFKGNRFNELEDRYWQEFNNFQFQLIAHQEERDAILAKIEVSQAHLEL 300

Query:   299 LKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRP 358
             L +TNVL DAFPI +DGEFGTINNFRLGRLP I VEWDEINAAWGQACLLLHTMC YFRP
Sbjct:   301 LNKTNVLIDAFPIRNDGEFGTINNFRLGRLPAIKVEWDEINAAWGQACLLLHTMCNYFRP 360

Query:   359 KF 360
             KF
Sbjct:   361 KF 362

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0006914 "autophagy" evidence=IEA;ISS

GO:0009507 "chloroplast" evidence=ISM

GO:0000045 "autophagic vacuole assembly" evidence=IGI

GO:0000407 "pre-autophagosomal structure" evidence=IDA

GO:0006623 "protein targeting to vacuole" evidence=IGI

GO:0009846 "pollen germination" evidence=IMP

GO:0050832 "defense response to fungus" evidence=IEP

MGI\|MGI:1891828 Becn1 "beclin 1, autophagy related" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q14457 BECN1 "Beclin-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4A1L4 BECN1 "Beclin-1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RNW7 AARSD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4A1L5 BECN1 "Beclin-1" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5R878 BECN1 "Beclin-1" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0288021 atg6B "autophagy protein Apg6 family protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S1F6 BECN1 "Beclin-1" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|620190 Becn1 "beclin 1, autophagy related" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	atg6	SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (522 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00002733001	SubName- Full=Chromosome chr1 scaffold_135, whole genome shotgun sequence; (815 aa)	•	•	0.632

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		379
pfam04111		356	pfam04111, APG6, Autophagy protein Apg6	2e-54
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	8e-08
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	8e-07
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	5e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	8e-06
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	2e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	3e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	3e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	8e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	8e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	9e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	1e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	5e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	6e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-04
PRK02224		880	PRK02224, PRK02224, chromosome segregation protein	8e-04
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.001
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	0.001
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.001
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.001
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.002
TIGR04211		198	TIGR04211, SH3_and_anchor, SH3 domain protein	0.002
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.003
COG4942		420	COG4942, COG4942, Membrane-bound metallopeptidase	0.003
pfam12325		121	pfam12325, TMF_TATA_bd, TATA element modulatory fa	0.003
PRK00409		782	PRK00409, PRK00409, recombination and DNA strand e	0.003
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.004

>gnl\|CDD\|217902 pfam04111, APG6, Autophagy protein Apg6	Back alignment and domain information

 Score =  182 bits (464), Expect = 2e-54
 Identities = 70/204 (34%), Positives = 120/204 (58%)

Query: 149 ITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARD 208
           +  +   F+I +SQT ++ PLC EC  +L ++LD E+ D  ++ + Y+  L +LE +  +
Sbjct: 2   VKAMTNLFDILSSQTNIDHPLCEECADILLERLDSELRDAEKERDTYKQYLSKLESQNVE 61

Query: 209 VLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEF 268
           + +      E  ++++EE +L   +EE EK++ +++ EL EL+ + ++ +  E +Y +E+
Sbjct: 62  ISNYEALDSELDELKKEEERLLDELEELEKEDDDLDGELVELQEEKEQLENEELQYLREY 121

Query: 269 NNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRL 328
           N F    +  ++   ++  + E S   L+ L++TN+ N  F I H G F TIN  RLGRL
Sbjct: 122 NLFDRNNLQLEDNLQSLELQYEYSLNQLDKLRKTNIFNATFHISHSGPFATINGLRLGRL 181

Query: 329 PKIPVEWDEINAAWGQACLLLHTM 352
           P + V W EINAAWGQ  LLL  +
Sbjct: 182 PSVVVPWKEINAAWGQTVLLLAAL 205

In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway. Length = 356

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|234501 TIGR04211, SH3_and_anchor, SH3 domain protein	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|192987 pfam12325, TMF_TATA_bd, TATA element modulatory factor 1 TATA binding	Back alignment and domain information

>gnl\|CDD\|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		379
KOG2751		447	consensus Beclin-like protein [Signal transduction	100.0
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	100.0
PF10186		302	Atg14: UV radiation resistance protein and autopha	99.3
KOG2751		447	consensus Beclin-like protein [Signal transduction	98.98
KOG2896		377	consensus UV radiation resistance associated prote	98.34
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	97.27
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	96.91
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	96.64
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	96.61
PRK03918		880	chromosome segregation protein; Provisional	96.32
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	96.26
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	96.11
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.1
PHA02562		562	46 endonuclease subunit; Provisional	96.09
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	96.08
KOG0996		1293	consensus Structural maintenance of chromosome pro	95.75
PRK11637		428	AmiB activator; Provisional	95.66
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	95.62
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	95.47
KOG0979		1072	consensus Structural maintenance of chromosome pro	95.32
PRK11637		428	AmiB activator; Provisional	95.27
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	95.2
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	94.92
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	94.89
COG4942		420	Membrane-bound metallopeptidase [Cell division and	94.88
PHA02562		562	46 endonuclease subunit; Provisional	94.86
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	94.74
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	94.68
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	94.66
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	94.57
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	94.48
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	94.47
PRK04863		1486	mukB cell division protein MukB; Provisional	94.46
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	94.44
PRK09039		343	hypothetical protein; Validated	94.41
PRK02224		880	chromosome segregation protein; Provisional	94.31
PRK02224		880	chromosome segregation protein; Provisional	94.27
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	94.24
KOG2391		365	consensus Vacuolar sorting protein/ubiquitin recep	94.23
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	94.23
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	94.07
COG4026		290	Uncharacterized protein containing TOPRIM domain,	94.07
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	94.05
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	94.05
TIGR02894		161	DNA_bind_RsfA transcription factor, RsfA family. I	93.98
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	93.72
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	93.72
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	93.7
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	93.48
PRK10884		206	SH3 domain-containing protein; Provisional	93.42
PRK04778		569	septation ring formation regulator EzrA; Provision	93.35
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	93.23
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	93.2
PRK04863		1486	mukB cell division protein MukB; Provisional	93.13
PF15285		25	BH3: Beclin-1 BH3 domain, Bcl-2-interacting; PDB:	93.13
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	93.12
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	93.08
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	93.06
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	93.01
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	92.95
COG4985		289	ABC-type phosphate transport system, auxiliary com	92.82
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	92.74
PF06156		107	DUF972: Protein of unknown function (DUF972); Inte	92.71
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	92.69
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	92.66
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	92.57
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	92.55
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	92.49
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	92.47
PRK10884		206	SH3 domain-containing protein; Provisional	92.41
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	92.39
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	92.37
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	92.3
KOG0964		1200	consensus Structural maintenance of chromosome pro	92.17
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	92.05
PRK04778		569	septation ring formation regulator EzrA; Provision	91.88
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	91.71
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	91.7
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	91.66
COG2433		652	Uncharacterized conserved protein [Function unknow	91.64
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	91.5
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	91.48
KOG1962		216	consensus B-cell receptor-associated protein and r	91.47
PF00038		312	Filament: Intermediate filament protein; InterPro:	91.46
PRK01156		895	chromosome segregation protein; Provisional	91.46
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	91.15
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	91.05
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	90.95
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	90.78
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	90.67
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	90.62
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	90.55
COG2433		652	Uncharacterized conserved protein [Function unknow	90.53
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	90.51
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	90.49
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	90.43
PF06120		301	Phage_HK97_TLTM: Tail length tape measure protein;	90.35
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	89.97
KOG4673		961	consensus Transcription factor TMF, TATA element m	89.81
KOG0971		1243	consensus Microtubule-associated protein dynactin	89.79
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	89.39
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	89.23
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	89.13
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	89.12
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	88.82
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	88.77
COG4942		420	Membrane-bound metallopeptidase [Cell division and	88.69
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	88.64
PRK11519		719	tyrosine kinase; Provisional	88.61
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	88.58
PF00038		312	Filament: Intermediate filament protein; InterPro:	88.51
TIGR03752		472	conj_TIGR03752 integrating conjugative element pro	88.5
KOG1962		216	consensus B-cell receptor-associated protein and r	88.48
PF14662		193	CCDC155: Coiled-coil region of CCDC155	88.24
KOG0933		1174	consensus Structural maintenance of chromosome pro	88.14
KOG0288		459	consensus WD40 repeat protein TipD [General functi	88.11
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	88.08
KOG2264		907	consensus Exostosin EXT1L [Signal transduction mec	88.02
KOG0933		1174	consensus Structural maintenance of chromosome pro	87.9
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	87.89
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	87.85
KOG0964		1200	consensus Structural maintenance of chromosome pro	87.82
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	87.78
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	87.62
PRK09039		343	hypothetical protein; Validated	87.58
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	87.55
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	87.28
PF10211		189	Ax_dynein_light: Axonemal dynein light chain; Inte	87.17
PF10186		302	Atg14: UV radiation resistance protein and autopha	87.07
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	87.02
PRK00409		782	recombination and DNA strand exchange inhibitor pr	86.97
COG5185		622	HEC1 Protein involved in chromosome segregation, i	86.86
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	86.85
KOG2072		988	consensus Translation initiation factor 3, subunit	86.81
KOG4438		446	consensus Centromere-associated protein NUF2 [Cell	86.73
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	86.68
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	86.62
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	86.24
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	86.1
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	86.06
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	86.05
PF05278		269	PEARLI-4: Arabidopsis phospholipase-like protein (	85.99
PF12329		74	TMF_DNA_bd: TATA element modulatory factor 1 DNA b	85.97
TIGR02894		161	DNA_bind_RsfA transcription factor, RsfA family. I	85.96
PF05700		221	BCAS2: Breast carcinoma amplified sequence 2 (BCAS	85.8
PF05149		289	Flagellar_rod: Paraflagellar rod protein; InterPro	85.69
cd07666		243	BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S	85.59
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	85.58
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	85.44
PF11180		192	DUF2968: Protein of unknown function (DUF2968); In	85.29
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	85.24
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	85.19
PRK08032		462	fliD flagellar capping protein; Reviewed	85.17
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	84.97
TIGR03752		472	conj_TIGR03752 integrating conjugative element pro	84.94
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	84.79
TIGR02231		525	conserved hypothetical protein. This family consis	84.75
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	84.74
PRK13169		110	DNA replication intiation control protein YabA; Re	84.67
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	84.64
TIGR02231		525	conserved hypothetical protein. This family consis	84.26
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	84.25
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	84.09
PF02403		108	Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom	84.08
PLN03188		1320	kinesin-12 family protein; Provisional	84.02
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	83.98
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	83.67
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	83.63
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	83.58
PRK06798		440	fliD flagellar capping protein; Validated	83.48
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	83.42
PRK00409		782	recombination and DNA strand exchange inhibitor pr	83.23
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	82.84
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	82.73
KOG4673		961	consensus Transcription factor TMF, TATA element m	82.63
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	82.59
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	82.34
COG5185		622	HEC1 Protein involved in chromosome segregation, i	82.3
KOG3647		338	consensus Predicted coiled-coil protein [General f	82.2
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	82.17
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	81.9
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	81.81
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	81.68
PRK00106		535	hypothetical protein; Provisional	81.67
PF14662		193	CCDC155: Coiled-coil region of CCDC155	81.63
KOG4572		1424	consensus Predicted DNA-binding transcription fact	81.61
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	81.59
KOG0996		1293	consensus Structural maintenance of chromosome pro	81.51
PF11414		84	Suppressor_APC: Adenomatous polyposis coli tumour	81.4
PF03961		451	DUF342: Protein of unknown function (DUF342); Inte	81.29
PRK11519		719	tyrosine kinase; Provisional	81.28
COG4026		290	Uncharacterized protein containing TOPRIM domain,	81.26
KOG0979		1072	consensus Structural maintenance of chromosome pro	81.09
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	80.69
PF03962		188	Mnd1: Mnd1 family; InterPro: IPR005647 This family	80.24
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	80.19
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	80.16

>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=6.4e-81  Score=622.90  Aligned_cols=339  Identities=52%  Similarity=0.818  Sum_probs=314.2

Q ss_pred             EeecccccccccCCccCcCCCCCcccccccccccCCCCCceeecCCCCC-CCCCCCCCCCCCCCCcccccCCCCCccceE
Q 016990           33 IVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRP-QSHGVPPRPRGSSAQSEASQSGKAMDESFV  111 (379)
Q Consensus        33 i~g~d~~~~~~~~~~~~~~~~~s~~~~~~s~~~~~~~d~s~vvl~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~eSfV  111 (379)
                      ++|+|+|+++++..|..+.-.+.++|+..++.+..+|+.+++|+|.+.+ ++.+.+++++++.. +++. ++.++.+|||
T Consensus         1 ~~g~~~s~~~~~q~~~~~~r~~~~i~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~t~~~~a~~-~~~~-~~~~~~~~~~   78 (447)
T KOG2751|consen    1 IVGVDSSANKFFQVPFPCQRCLQPIHLDNSLLGSDRMDISELVLPLHKPPQSQGGPTRPRGASS-GDAT-SGKTPQESSV   78 (447)
T ss_pred             CcccccccccccCCChhhhhccchhhhhhhhccccccchhhccCCCCCCccccCCCccCccccC-cccc-CCcchhhccc
Confidence            5899999999999998888889999999999999999999999999966 99999999999887 4555 8889999999


Q ss_pred             EEecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccchHHHHHHHHHhhcCCCCcCCcchHHHHHHHHHHHHHHHHHHHHH
Q 016990          112 VIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRD  191 (379)
Q Consensus       112 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lss~i~~l~~lFdIlSs~s~IDhPLC~ECtd~Lle~Ld~qle~~~~E  191 (379)
                      +.+...+..+....+-+....+..++...+.+++++++++++++|+|||++++||||+|.||+|.|++.|+++++.+++|
T Consensus        79 ~~~~~~p~r~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~f~i~~~qt~~d~PlC~eC~d~l~~~ld~e~~~~~~e  158 (447)
T KOG2751|consen   79 VVYFSPPVRDSDTEHNLSFELGENGSDGSNTKTLSATINVLTRLFDILSSQTQVDHPLCEECMDVLLNKLDKEVEDAEDE  158 (447)
T ss_pred             eecccCcccccccccccccccccccchhhhhHHHHHHHHHHHHHHHHhhccCCcccchHHHHHHHHHHHHHHHHHHHHHH
Confidence            99877665555555544444443444566778999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhchhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 016990          192 IEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNF  271 (379)
Q Consensus       192 ~d~Y~~fL~~L~~~~~~~~~ee~l~~el~~Le~EE~~L~~eLeelEkE~~~l~~el~~le~e~~~L~eeEe~~w~e~n~~  271 (379)
                      +++|++|+++|+++..+. +++++.+|+++++.||++|.++|++++++.++++.++.+++.+..++.++|.+||++||.+
T Consensus       159 ~~~Y~~~l~~Le~~~~~~-~~~~~~~e~~~l~~eE~~L~q~lk~le~~~~~l~~~l~e~~~~~~~~~e~~~~~~~ey~~~  237 (447)
T KOG2751|consen  159 VDTYKACLQRLEQQNQDV-SEEDLLKELKNLKEEEERLLQQLEELEKEEAELDHQLKELEFKAERLNEEEDQYWREYNNF  237 (447)
T ss_pred             HHHHHHHHHHHhhcCccc-chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999876543 7889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccCceeeeecCCceeecccccCCCCCCCCChhhHHHHHHHHHHHHHH
Q 016990          272 QFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHT  351 (379)
Q Consensus       272 q~qL~~~~eE~~sl~~q~~~~~~qLdkLrkTNV~nd~F~I~hdG~fGTINgfRLGrlp~~~V~W~EINAAwGQ~~LLL~t  351 (379)
                      ++++.+++++++||++|++|++.||++|++|||||.+|||||+|+|||||||||||+|.+||+|+||||||||+||||++
T Consensus       238 ~~q~~~~~del~Sle~q~~~s~~qldkL~ktNv~n~~F~I~~~G~fgtIN~FRLG~lp~~pVew~EINAA~GQ~vLLL~~  317 (447)
T KOG2751|consen  238 QRQLIEHQDELDSLEAQIEYSQAQLDKLRKTNVFNATFHIWHDGEFGTINNFRLGRLPSVPVEWDEINAAWGQTVLLLHT  317 (447)
T ss_pred             HHhhhcccchHHHHHHHHHHHHHHHHHHHhhhhhhheeeEeecccccccccceeccccCCCcCHHHHHHHhhhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCcc-eeEEeccceeeee
Q 016990          352 MCQYFRPKFP-YPFFTSLCFLVIV  374 (379)
Q Consensus       352 la~kl~~~Fq-YrLvp~gs~~~~~  374 (379)
                      |++|+|++|+ ||||||||+|.|+
T Consensus       318 l~~kig~~~~~y~lvp~GshSyI~  341 (447)
T KOG2751|consen  318 LANKIGLNFVRYRLVPMGSHSYIK  341 (447)
T ss_pred             HHHhcCcccceeeeecccchhHHH
Confidence            9999999998 9999999999986

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG2896 consensus UV radiation resistance associated protein [General function prediction only]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PF15285 BH3: Beclin-1 BH3 domain, Bcl-2-interacting; PDB: 3BL2_C 2P1L_H 3DVU_C 2PON_A	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>COG4985 ABC-type phosphate transport system, auxiliary component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12)	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family	Back alignment and domain information

>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4	Back alignment and domain information

>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures	Back alignment and domain information

>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family	Back alignment and domain information

>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function	Back alignment and domain information

>PF05149 Flagellar_rod: Paraflagellar rod protein; InterPro: IPR007824 This family consists of several eukaryotic paraflagellar rod component proteins	Back alignment and domain information

>cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PRK08032 fliD flagellar capping protein; Reviewed	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>TIGR02231 conserved hypothetical protein	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PRK13169 DNA replication intiation control protein YabA; Reviewed	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>TIGR02231 conserved hypothetical protein	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PRK06798 fliD flagellar capping protein; Validated	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG3647 consensus Predicted coiled-coil protein [General function prediction only]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF11414 Suppressor_APC: Adenomatous polyposis coli tumour suppressor protein; PDB: 1M5I_A	Back alignment and domain information

>PF03961 DUF342: Protein of unknown function (DUF342); InterPro: IPR005646 This family of bacterial proteins has no known function	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		379
4ddp_A		210	Crystal Structure Of Beclin 1 Evolutionarily Conser		3e-23
3vp7_A		220	Crystal Structure Of The Beta-Alpha Repeated, Autop		3e-09

>pdb|4DDP|A Chain A, Crystal Structure Of Beclin 1 Evolutionarily Conserved Domain(Ecd) Length = 210

Back alignment and structure

Iteration: 1

Score = 106 bits (264), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 45/81 (55%), Positives = 58/81 (71%) Query: 280 EERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEIN 339 +E ++ +++ +Q L+ LK+TNV N F IWH G+FGTINNFRLGRLP +PVEW+EIN Sbjct: 5 DELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEIN 64 Query: 340 AAWGQACLLLHTMCQYFRPKF 360 AAWGQ LLLH + KF Sbjct: 65 AAWGQTVLLLHALANKMGLKF 85

PyMOL of 4ddp

>pdb|3VP7|A Chain A, Crystal Structure Of The Beta-Alpha Repeated, Autophagy-Specific (Bara) Domain Of Vps30ATG6 Length = 220

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		379
4ddp_A		210	Beclin-1; ECD, autophagy, membrane binding, membra	2e-38
3vp7_A		220	Vacuolar protein sorting-associated protein 30; ta	1e-29
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	2e-21
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-09
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-06
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-06
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-04
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-04
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	5e-04
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	1e-07
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	7e-07
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	4e-04
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	6e-04
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	5e-06
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	1e-05
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	1e-04
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	2e-04
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	2e-04
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	3e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-04

>4ddp_A Beclin-1; ECD, autophagy, membrane binding, membrane protein; 1.55A {Homo sapiens} Length = 210	Back alignment and structure

 Score =  136 bits (343), Expect = 2e-38
 Identities = 45/86 (52%), Positives = 59/86 (68%)

Query: 276 IAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEW 335
           +   +E  ++ +++  +Q  L+ LK+TNV N  F IWH G+FGTINNFRLGRLP +PVEW
Sbjct: 1   LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW 60

Query: 336 DEINAAWGQACLLLHTMCQYFRPKFP 361
           +EINAAWGQ  LLLH +      KF 
Sbjct: 61  NEINAAWGQTVLLLHALANKMGLKFQ 86

PyMOL of 4ddp

>3vp7_A Vacuolar protein sorting-associated protein 30; targeting, PI3-kinase complex I, PRE-autophagosomal structur protein transport; 2.30A {Saccharomyces cerevisiae} Length = 220	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Length = 96	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		379
4ddp_A		210	Beclin-1; ECD, autophagy, membrane binding, membra	100.0
3vp7_A		220	Vacuolar protein sorting-associated protein 30; ta	100.0
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	99.78
2p1l_B		31	Beclin 1; apoptosis, autophagy, BH3 domain, BCL; 2	98.4
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	96.76
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	96.4
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	96.23
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	96.22
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	95.72
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	95.46
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	95.27
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	95.25
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	95.25
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	95.06
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	94.71
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	94.66
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	92.99
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	92.39
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	91.66
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	91.56
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	91.33
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	91.29
3bas_A		89	Myosin heavy chain, striated muscle/general contro	89.42
1l8d_A		112	DNA double-strand break repair RAD50 ATPase; zinc	89.21
3s4r_A		93	Vimentin; alpha-helix, cytoskeleton, intermediate	89.09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	89.06
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	88.12
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	87.58
3iox_A		497	AGI/II, PA; alpha helix, PPII helix, supersandwich	87.44
3a7p_A		152	Autophagy protein 16; coiled-coil, coiled coil, cy	87.41
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	87.02
3bas_A		89	Myosin heavy chain, striated muscle/general contro	86.74
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	85.89
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	85.21
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	84.95
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	84.95
3s9g_A		104	Protein hexim1; cyclin T-binding domain (TBD), cyc	84.62
3mq9_A		471	Bone marrow stromal antigen 2 fused to maltose-BI	84.04
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	83.15
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	82.87
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	82.7
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	81.94
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	81.31
2zqm_A		117	Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9	81.02
3nmd_A		72	CGMP dependent protein kinase; leucine zipper, coi	80.93

>4ddp_A Beclin-1; ECD, autophagy, membrane binding, membrane protein; 1.55A {Homo sapiens}	Back alignment and structure

Probab=100.00  E-value=4.6e-48  Score=359.07  Aligned_cols=99  Identities=46%  Similarity=0.861  Sum_probs=88.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhccccccCceeeeecCCceeecccccCCCCCCCCChhhHHHHHHHHHHHHHHHHhhc
Q 016990          277 AHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYF  356 (379)
Q Consensus       277 ~~~eE~~sl~~q~~~~~~qLdkLrkTNV~nd~F~I~hdG~fGTINgfRLGrlp~~~V~W~EINAAwGQ~~LLL~tla~kl  356 (379)
                      ++++|++|+++||++++.|||+|+||||||++|||||||+|||||||||||+|++||+|+||||||||+||||++||+++
T Consensus         2 ~~~~e~~sl~~q~~~~~~~L~~L~~tNv~n~~F~I~hdG~fgtINglRLGrlp~~~V~W~EINAAwGq~~LLL~tla~~l   81 (210)
T 4ddp_A            2 ELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKM   81 (210)
T ss_dssp             ------CCHHHHHHHHHHHHHTC----CCSSCCCEEEETTEEEETTEECCCBTTBCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHhcccccceeEEEecCCceeEcccccCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHc
Confidence            67899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcc-eeEEeccceeeeec
Q 016990          357 RPKFP-YPFFTSLCFLVIVD  375 (379)
Q Consensus       357 ~~~Fq-YrLvp~gs~~~~~~  375 (379)
                      +++|+ |||+||||||+|++
T Consensus        82 ~~~f~~y~L~P~GS~S~I~~  101 (210)
T 4ddp_A           82 GLKFQRYRLVPYGNHSYLES  101 (210)
T ss_dssp             TCCCSSEEEECCGGGCEEEE
T ss_pred             CCCccceeEEecCCcceeeE
Confidence            99998 99999999999976

PyMOL of 4ddp

>3vp7_A Vacuolar protein sorting-associated protein 30; targeting, PI3-kinase complex I, PRE-autophagosomal structur protein transport; 2.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>2p1l_B Beclin 1; apoptosis, autophagy, BH3 domain, BCL; 2.50A {Homo sapiens} PDB: 3dvu_C 2pon_A	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A	Back alignment and structure

>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1	Back alignment and structure

>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A	Back alignment and structure

>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A	Back alignment and structure

>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A	Back alignment and structure

>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00