Citrus Sinensis ID: 017098
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 377 | ||||||
| 255571006 | 569 | bromodomain-containing protein, putative | 0.843 | 0.558 | 0.497 | 3e-79 | |
| 356543397 | 531 | PREDICTED: uncharacterized protein LOC10 | 0.867 | 0.615 | 0.458 | 6e-70 | |
| 356560331 | 508 | PREDICTED: uncharacterized protein LOC10 | 0.803 | 0.596 | 0.462 | 7e-70 | |
| 297739526 | 637 | unnamed protein product [Vitis vinifera] | 0.933 | 0.552 | 0.413 | 2e-66 | |
| 357445295 | 679 | Bromodomain-containing protein [Medicago | 0.912 | 0.506 | 0.443 | 6e-62 | |
| 359486253 | 636 | PREDICTED: uncharacterized protein LOC10 | 0.899 | 0.533 | 0.385 | 3e-60 | |
| 297837677 | 585 | hypothetical protein ARALYDRAFT_475449 [ | 0.843 | 0.543 | 0.408 | 4e-53 | |
| 297840767 | 582 | hypothetical protein ARALYDRAFT_475462 [ | 0.830 | 0.537 | 0.412 | 9e-52 | |
| 334183399 | 573 | DNA-binding bromodomain-containing prote | 0.830 | 0.546 | 0.401 | 2e-51 | |
| 186491671 | 572 | DNA-binding bromodomain-containing prote | 0.827 | 0.545 | 0.401 | 3e-51 |
| >gi|255571006|ref|XP_002526454.1| bromodomain-containing protein, putative [Ricinus communis] gi|223534234|gb|EEF35949.1| bromodomain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 301 bits (771), Expect = 3e-79, Method: Compositional matrix adjust.
Identities = 191/384 (49%), Positives = 242/384 (63%), Gaps = 66/384 (17%)
Query: 1 MDFGTICSNLENGGKYMNSEDVYKDVEYIWENCNKYNSKGDYILDLMKRVKKNFMKLWMA 60
MDFGTICSNLE G KYMNSE VYKDV+YIW+NC KYN+KGDYILDLM+RVKKNFMK W A
Sbjct: 245 MDFGTICSNLETGDKYMNSEAVYKDVQYIWDNCYKYNNKGDYILDLMRRVKKNFMKYWTA 304
Query: 61 AGLYTEQSSGSAVYQKFQRSKKMPDGCRENIMICFSKSYDIKHSRCCSLQSGETQGKGGQ 120
AGL+TEQS GS+ S + GK GQ
Sbjct: 305 AGLFTEQSRGSSA-------------------------------------SSQGHGKSGQ 327
Query: 121 PKQKSGKRHGRRHKHDCLCAICVLKRRKREREENARIAQGQTDVVETQEPNQEESSLGES 180
PKQK+ KRHGRRHK DCLCAICVLKRR+REREEN RIA NQ+ L
Sbjct: 328 PKQKAKKRHGRRHKSDCLCAICVLKRRRREREENERIA------------NQK---LPHD 372
Query: 181 ARGDDSSSDMGESQNLDADAEVEGKREEVKGESAKQEYSHMEVKHEEEQEEEEDDEEDEE 240
G+DSSS+M ES + DADA+VEGKR E K E +Q+YS E+E+ E+ +ED +
Sbjct: 373 PAGEDSSSNMDESLDPDADADVEGKRLEAKMEDTEQQYS-------AEKEKHEEVQEDGD 425
Query: 241 EEDEEGGDEENEIDMQKKGEGEGLAQSKIGERLGEESMRQSEPGKPENSGGIQTHS---- 296
EE+E+ +E+NEI++QK+ + E QS+ +R G+E +Q +PG EN+G +
Sbjct: 426 EEEEDDEEEDNEIEIQKRAKVETSEQSEFADRSGDEPNQQPQPGLAENAGAAAQINFEKG 485
Query: 297 ---DEHDEEAVAVQKQAHKNSQEWAEKAKLYSSFNSENPMLLRLCGTLFPNDHTSVWSGP 353
++H++E A + +K+SQE +KA+++ F NPMLL LC TLFP++ SVWSGP
Sbjct: 486 HLMEQHEDETAAFHRNKNKDSQERQQKAEMFEKFCPHNPMLLSLCQTLFPDNRRSVWSGP 545
Query: 354 HSLVQRPVSAHTNSFHAAIESFMQ 377
HSLV R SAH NS AAIE+ M+
Sbjct: 546 HSLVPRQGSAHGNSIGAAIETLMK 569
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356543397|ref|XP_003540147.1| PREDICTED: uncharacterized protein LOC100802058 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356560331|ref|XP_003548446.1| PREDICTED: uncharacterized protein LOC100813884 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297739526|emb|CBI29708.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357445295|ref|XP_003592925.1| Bromodomain-containing protein [Medicago truncatula] gi|140053518|gb|ABE79573.2| Bromodomain [Medicago truncatula] gi|355481973|gb|AES63176.1| Bromodomain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|359486253|ref|XP_002263445.2| PREDICTED: uncharacterized protein LOC100254331 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297837677|ref|XP_002886720.1| hypothetical protein ARALYDRAFT_475449 [Arabidopsis lyrata subsp. lyrata] gi|297332561|gb|EFH62979.1| hypothetical protein ARALYDRAFT_475449 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297840767|ref|XP_002888265.1| hypothetical protein ARALYDRAFT_475462 [Arabidopsis lyrata subsp. lyrata] gi|297334106|gb|EFH64524.1| hypothetical protein ARALYDRAFT_475462 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|334183399|ref|NP_001185258.1| DNA-binding bromodomain-containing protein [Arabidopsis thaliana] gi|332195366|gb|AEE33487.1| DNA-binding bromodomain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|186491671|ref|NP_176101.3| DNA-binding bromodomain-containing protein [Arabidopsis thaliana] gi|332195364|gb|AEE33485.1| DNA-binding bromodomain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
No hits with e-value below 0.001 by BLAST
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 377 | |||
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 3e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-08 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 8e-08 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 8e-08 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 9e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 9e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-06 | |
| cd05506 | 99 | cd05506, Bromo_plant1, Bromodomain, uncharacterize | 3e-06 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-05 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 1e-05 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 1e-05 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 4e-05 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 4e-05 | |
| cd05510 | 112 | cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s | 1e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 2e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 8e-04 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 0.001 | |
| cd05497 | 107 | cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like | 0.001 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 0.003 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 0.004 | |
| COG5177 | 769 | COG5177, COG5177, Uncharacterized conserved protei | 0.004 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.004 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.004 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.004 |
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
Score = 50.8 bits (122), Expect = 3e-08
Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
Query: 1 MDFGTICSNLENGGKYMNSEDVYKDVEYIWENCNKYNSKGDYILDLMKRVKKNFMKLW 58
MD TI L+NG +Y + E+ DV I+ N YN G I K+++K F KL
Sbjct: 43 MDLSTIKKKLKNG-EYKSLEEFEADVRLIFSNAKTYNGPGSPIYKDAKKLEKLFEKLL 99
|
Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine. Length = 99 |
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.62 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.61 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.6 | |
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 99.59 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.59 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.58 | |
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.57 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 99.57 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.56 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.56 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.55 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.54 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.54 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.53 | |
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.52 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.52 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.51 | |
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.51 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 99.49 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 99.49 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.48 | |
| smart00297 | 107 | BROMO bromo domain. | 99.48 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.47 | |
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.47 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 99.46 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 99.45 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.45 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.45 | |
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 99.44 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.44 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.43 | |
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 99.43 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 99.42 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 99.4 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 99.36 | |
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 99.3 | |
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 99.24 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 99.19 | |
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 99.01 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 98.52 | |
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 98.04 | |
| KOG1827 | 629 | consensus Chromatin remodeling complex RSC, subuni | 97.4 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 97.37 | |
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 96.57 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 96.35 | |
| KOG0008 | 1563 | consensus Transcription initiation factor TFIID, s | 96.07 | |
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 95.86 | |
| KOG1828 | 418 | consensus IRF-2-binding protein CELTIX-1, contains | 95.62 | |
| cd05493 | 131 | Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- | 95.27 | |
| KOG1828 | 418 | consensus IRF-2-binding protein CELTIX-1, contains | 92.92 | |
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 92.85 | |
| KOG0008 | 1563 | consensus Transcription initiation factor TFIID, s | 90.5 | |
| PF14372 | 101 | DUF4413: Domain of unknown function (DUF4413) | 82.58 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 80.65 |
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
Probab=99.62 E-value=1.1e-15 Score=129.56 Aligned_cols=63 Identities=30% Similarity=0.532 Sum_probs=61.1
Q ss_pred CCHHHHHHHhhCCCCCCCHHHHHHHHHHHHhhhhccCCCCCHHHHHHHHHHHHHHHHHHHcCCC
Q 017098 1 MDFGTICSNLENGGKYMNSEDVYKDVEYIWENCNKYNSKGDYILDLMKRVKKNFMKLWMAAGLY 64 (377)
Q Consensus 1 MDLsTIKkKLe~G~kYkSveEF~sDVrLIFsNC~kYN~pgS~Iy~~Ak~LEk~FeK~~kkigL~ 64 (377)
|||+||++||..+ .|.|+.+|..||+|||.||++||++++.++.+|..|+++|++.+.++++.
T Consensus 53 mDL~tI~~kL~~~-~Y~s~~~f~~Dv~LI~~Na~~yN~~~s~i~~~A~~l~~~f~~~~~~~~~~ 115 (115)
T cd05504 53 MDLGTIKEKLNMG-EYKLAEEFLSDIQLVFSNCFLYNPEHTSVYKAGTRLQRFFIKRCRKLGLP 115 (115)
T ss_pred ccHHHHHHHHccC-CCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHhCCC
Confidence 8999999999998 99999999999999999999999999999999999999999999998863
|
Bromo adjacent to zinc finger 1A (BAZ1A) was identified as a novel human bromodomain gene by cDNA library screening. The Drosophila homologue, Acf1, is part of the CHRAC (chromatin accessibility complex) and regulates ISWI-induced nucleosome remodeling. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. |
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] | Back alignment and domain information |
|---|
| >cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins | Back alignment and domain information |
|---|
| >KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] | Back alignment and domain information |
|---|
| >PF14372 DUF4413: Domain of unknown function (DUF4413) | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 99.68 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 99.64 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.63 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.63 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.63 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.63 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.63 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.63 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.62 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.62 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.62 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.62 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.61 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.61 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.61 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.61 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.6 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 99.6 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.6 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.59 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.59 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.58 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.58 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.57 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.56 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 99.56 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.54 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.53 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.52 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.44 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.43 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.42 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.41 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.4 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.4 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.4 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.39 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.31 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.24 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.24 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.21 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 99.18 |
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
Probab=99.68 E-value=8.7e-17 Score=132.67 Aligned_cols=64 Identities=20% Similarity=0.325 Sum_probs=62.5
Q ss_pred CCHHHHHHHhhCCCCCCCHHHHHHHHHHHHhhhhccCCCCCHHHHHHHHHHHHHHHHHHHcCCCC
Q 017098 1 MDFGTICSNLENGGKYMNSEDVYKDVEYIWENCNKYNSKGDYILDLMKRVKKNFMKLWMAAGLYT 65 (377)
Q Consensus 1 MDLsTIKkKLe~G~kYkSveEF~sDVrLIFsNC~kYN~pgS~Iy~~Ak~LEk~FeK~~kkigL~~ 65 (377)
|||+||++||.+| .|.++.+|..||+|||.||++||++++.++.+|..|++.|++.|.+++++.
T Consensus 48 mdL~tI~~kl~~~-~Y~s~~~f~~Dv~li~~Na~~yN~~~s~~~~~A~~L~~~f~~~~~~~~~~~ 111 (112)
T 3d7c_A 48 IDLKTMTERLRSR-YYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLID 111 (112)
T ss_dssp CCHHHHHHHHHTT-CCCSHHHHHHHHHHHHHHHHHHSCTTSHHHHHHHHHHHHHHHHHHHTTSSC
T ss_pred cCHHHHHHHHcCC-CCcCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCcC
Confidence 8999999999998 999999999999999999999999999999999999999999999999874
|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 377 | ||||
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 9e-09 | |
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 1e-07 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 1e-07 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 5e-07 | |
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 1e-06 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 2e-06 |
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: CREB-binding protein, CBP species: Human (Homo sapiens) [TaxId: 9606]
Score = 50.7 bits (121), Expect = 9e-09
Identities = 14/58 (24%), Positives = 23/58 (39%), Gaps = 1/58 (1%)
Query: 1 MDFGTICSNLENGGKYMNSEDVYKDVEYIWENCNKYNSKGDYILDLMKRVKKNFMKLW 58
MD TI L+ G +Y DV ++ N YN K + ++ + F +
Sbjct: 50 MDLSTIKRKLDTG-QYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEI 106
|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.59 | |
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.58 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.56 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.54 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.51 |
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: GCN5 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60 E-value=7.7e-16 Score=123.61 Aligned_cols=59 Identities=19% Similarity=0.294 Sum_probs=57.3
Q ss_pred CCHHHHHHHhhCCCCCCCHHHHHHHHHHHHhhhhccCCCCCHHHHHHHHHHHHHHHHHHH
Q 017098 1 MDFGTICSNLENGGKYMNSEDVYKDVEYIWENCNKYNSKGDYILDLMKRVKKNFMKLWMA 60 (377)
Q Consensus 1 MDLsTIKkKLe~G~kYkSveEF~sDVrLIFsNC~kYN~pgS~Iy~~Ak~LEk~FeK~~kk 60 (377)
|||+||++||.++ .|.|+.+|..||+|||.||++||+++|.++.+|..|+++|.++|++
T Consensus 43 mdL~tI~~kl~~~-~Y~s~~~f~~D~~li~~Na~~yN~~~s~~~~~A~~l~~~f~~~~ke 101 (102)
T d3d7ca1 43 IDLKTMTERLRSR-YYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKE 101 (102)
T ss_dssp CCHHHHHHHHHTT-CCCSHHHHHHHHHHHHHHHHHHSCTTSHHHHHHHHHHHHHHHHHHH
T ss_pred cCHHHHHHHhccC-ccCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHhc
Confidence 8999999999998 9999999999999999999999999999999999999999998874
|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|