Citrus Sinensis ID: 017259


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370----
MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKPKPADAPATPCHRCGRNLYG
cHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHccccccccccccccccccEEEEcccHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHHHcccEEEEEcccccccccccHHHHcccccccHHHHHHHHccccccccEEEEccHHHHcccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHEEEccccccccHHHHHHHHHHcccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc
HHHHHHHHccccccccccccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccHHHHHccccHHHHcccccccccEEEEccccHHHHHHHcccccccEEEEEEcccEcccccEcccccHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHcccccEEEEcHHHHccccccEEEEEcHHHHcccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHcccHHHHEccccEEEEEEEccccccccHHHHHHHHHHcccEEEcccccEEEEccccEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
MKALQEQAEKLTLSsrafyndkfPVFAERLTSMfgydmvlpmntgaEGVETALKLARKWGyvkkkfsiDEAIIVSCCGCFHGRTLAAISMSCdneairgfgpllpghlkvdfgDITALEKIFKESGDQIagflfepiqgeagviippdgyLKAVRDLCSKYNILMIADEIQSGLARSgrmlasdweevrpDMVILGKAlgggvipvsavladkevmlciqpgehgstfggnpLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEvrgrglfnavefdktalpvsAYDICLKMKergilakpthdtivrltpplsissnelQEGSKALHDVLeldlpkmrkpkpadapatpchrcgrnlyg
MKALQEQAEkltlssrafyndkFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFnavefdktalpvSAYDICLKMKERgilakpthdtivrlTPPLSISSNELQEGSKALHDVLELDLpkmrkpkpadapatpchrcgrnlyg
MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKPKPADAPATPCHRCGRNLYG
***************RAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLT**************************************************
MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLE*********************CGRNL**
********EKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKM**********TPCHRCGRNLYG
MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKP*********CHRC******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKPKPADAPATPCHRCGRNLYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query374 2.2.26 [Sep-21-2011]
Q9FNK4475 Ornithine aminotransferas yes no 0.997 0.785 0.811 1e-180
Q10G56473 Ornithine aminotransferas yes no 0.997 0.788 0.734 1e-166
Q54JP5416 Probable ornithine aminot yes no 0.914 0.822 0.543 1e-113
Q9P7L5438 Ornithine aminotransferas yes no 0.941 0.803 0.520 1e-103
Q92413454 Ornithine aminotransferas yes no 0.933 0.768 0.494 1e-101
Q9VW26431 Ornithine aminotransferas yes no 0.871 0.756 0.520 1e-100
P49724432 Ornithine aminotransferas N/A no 0.877 0.759 0.529 7e-99
C4L2E7400 Ornithine aminotransferas yes no 0.890 0.832 0.524 1e-98
C5D6R2398 Ornithine aminotransferas yes no 0.863 0.811 0.544 2e-98
P60299396 Ornithine aminotransferas yes no 0.895 0.845 0.526 5e-98
>sp|Q9FNK4|OAT_ARATH Ornithine aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=DELTA-OAT PE=1 SV=1 Back     alignment and function desciption
 Score =  631 bits (1628), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 306/377 (81%), Positives = 339/377 (89%), Gaps = 4/377 (1%)

Query: 1   MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWG 60
           MKALQEQ EKLTLSSRAFYNDKFPVFAERLT+MFGYDMVLPMNTGAEGVETALKLARKWG
Sbjct: 98  MKALQEQVEKLTLSSRAFYNDKFPVFAERLTNMFGYDMVLPMNTGAEGVETALKLARKWG 157

Query: 61  YVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEK 120
           + KK    DEAIIVSCCGCFHGRTLA +SMSCDN+A RGFGPLLPG+LKVDFGD  +LEK
Sbjct: 158 HEKKNIPKDEAIIVSCCGCFHGRTLAIVSMSCDNDATRGFGPLLPGNLKVDFGDADSLEK 217

Query: 121 IFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRM 180
           IFKE GD+IAGFLFEPIQGEAGVIIPPDGYLKAVR+LC+KYN+LMIADE+QSGLARSG+M
Sbjct: 218 IFKEKGDRIAGFLFEPIQGEAGVIIPPDGYLKAVRELCTKYNVLMIADEVQSGLARSGKM 277

Query: 181 LASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIA 240
           LA DWEE+RPDMVILGKALGGGVIPVSAVLADK+VML I+PG+HGSTFGGNPLASAVA+A
Sbjct: 278 LACDWEEIRPDMVILGKALGGGVIPVSAVLADKDVMLHIKPGQHGSTFGGNPLASAVAMA 337

Query: 241 SLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTAL-PVSA 299
           SLDVI +EKL ERSA LGEELR  L +I++QFP Y+KEVRGRGLFNA+EF+  +L PVSA
Sbjct: 338 SLDVIVEEKLVERSASLGEELRIQLNEIKKQFPKYIKEVRGRGLFNAIEFNSESLSPVSA 397

Query: 300 YDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKPKPAD 359
           YDICL +KERG+LAKPTH+TIVRLTPPLSISS+EL++GS+ALHDVLELDLP + K     
Sbjct: 398 YDICLSLKERGVLAKPTHNTIVRLTPPLSISSDELRDGSEALHDVLELDLPNLLKINSGK 457

Query: 360 APA---TPCHRCGRNLY 373
            P    T C RCGRNLY
Sbjct: 458 TPVSHITECDRCGRNLY 474




Mediates degradation of arginine for nitrogen recycling. Plays a role in non-host disease resistance by regulating pyrroline-5-carboxylate metabolism-induced hypersensitive response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: 1EC: 3
>sp|Q10G56|OAT_ORYSJ Ornithine aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica GN=OAT PE=2 SV=1 Back     alignment and function description
>sp|Q54JP5|OAT_DICDI Probable ornithine aminotransferase OS=Dictyostelium discoideum GN=oatA PE=3 SV=1 Back     alignment and function description
>sp|Q9P7L5|OAT_SCHPO Ornithine aminotransferase car2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=car2 PE=2 SV=1 Back     alignment and function description
>sp|Q92413|OAT_EMENI Ornithine aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=otaA PE=3 SV=2 Back     alignment and function description
>sp|Q9VW26|OAT_DROME Ornithine aminotransferase, mitochondrial OS=Drosophila melanogaster GN=Oat PE=2 SV=1 Back     alignment and function description
>sp|P49724|OAT_DROAN Ornithine aminotransferase, mitochondrial OS=Drosophila ananassae GN=Oat PE=1 SV=1 Back     alignment and function description
>sp|C4L2E7|OAT_EXISA Ornithine aminotransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rocD PE=3 SV=1 Back     alignment and function description
>sp|C5D6R2|OAT_GEOSW Ornithine aminotransferase OS=Geobacillus sp. (strain WCH70) GN=rocD PE=3 SV=1 Back     alignment and function description
>sp|P60299|OAT2_STAAW Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MW2) GN=rocD2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query374
255557233473 ornithine aminotransferase, putative [Ri 1.0 0.790 0.838 0.0
224116376469 predicted protein [Populus trichocarpa] 0.991 0.791 0.844 0.0
346980456 478 ornithine aminotransferase [Malus hupehe 0.997 0.780 0.827 0.0
304650830 477 ornithine aminotransferase [Nicotiana ta 1.0 0.784 0.820 0.0
449439181473 PREDICTED: probable ornithine aminotrans 1.0 0.790 0.820 1e-180
15237392 475 ornithine-delta-aminotransferase [Arabid 0.997 0.785 0.811 1e-178
297791071 475 delta-OAT [Arabidopsis lyrata subsp. lyr 0.997 0.785 0.809 1e-178
157890950 477 ornithine-oxo-acid transaminase [Brassic 0.997 0.781 0.798 1e-176
225443914466 PREDICTED: probable ornithine aminotrans 0.994 0.798 0.803 1e-175
169665583 476 ornithine aminotransferase [Brassica nap 0.997 0.783 0.787 1e-174
>gi|255557233|ref|XP_002519647.1| ornithine aminotransferase, putative [Ricinus communis] gi|223541064|gb|EEF42620.1| ornithine aminotransferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/378 (83%), Positives = 345/378 (91%), Gaps = 4/378 (1%)

Query: 1   MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWG 60
           MKAL++QAEKLTLSSRAFYND+FP+FAERLTSMFGYDMVLPMNTGAEGVETALKLARKWG
Sbjct: 93  MKALKDQAEKLTLSSRAFYNDRFPLFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWG 152

Query: 61  YVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEK 120
           Y KKK + DEAIIVSCCGCFHGRT+A ISMSCDNEA RGFGPLLPGH KVDFGD  ALEK
Sbjct: 153 YEKKKITKDEAIIVSCCGCFHGRTIAVISMSCDNEATRGFGPLLPGHFKVDFGDEVALEK 212

Query: 121 IFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRM 180
           IFKE GD+IAGFLFEPIQGEAGV+IPPDGYLKAVRDLCSKYN+LMIADEIQ+GLAR+G+M
Sbjct: 213 IFKERGDRIAGFLFEPIQGEAGVVIPPDGYLKAVRDLCSKYNVLMIADEIQTGLARTGKM 272

Query: 181 LASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIA 240
           LA DWE+VRPD+VILGKALGGGVIPVSAVLADK+VMLCIQPGEHGSTFGGNPLASAVA+A
Sbjct: 273 LACDWEQVRPDVVILGKALGGGVIPVSAVLADKDVMLCIQPGEHGSTFGGNPLASAVAVA 332

Query: 241 SLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTAL-PVSA 299
           SLDV+ DE LAERSA LGEELR  L K+QQQFP+Y+KEVRGRGLFNAVEFD  AL P+SA
Sbjct: 333 SLDVVIDEGLAERSAQLGEELRDQLLKVQQQFPDYIKEVRGRGLFNAVEFDSKALSPISA 392

Query: 300 YDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKPKP-- 357
           YDICLK+KERGILAKPTHDTIVRLTPPLS+S +ELQEGSKAL +VLE DLP + K KP  
Sbjct: 393 YDICLKLKERGILAKPTHDTIVRLTPPLSMSLDELQEGSKALREVLEFDLPNLLKDKPEK 452

Query: 358 -ADAPATPCHRCGRNLYG 374
            + A +T C RCGRNLY 
Sbjct: 453 ASSAASTSCDRCGRNLYA 470




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224116376|ref|XP_002317282.1| predicted protein [Populus trichocarpa] gi|222860347|gb|EEE97894.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|346980456|gb|AEO51063.1| ornithine aminotransferase [Malus hupehensis] Back     alignment and taxonomy information
>gi|304650830|gb|ADM47437.1| ornithine aminotransferase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|449439181|ref|XP_004137365.1| PREDICTED: probable ornithine aminotransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15237392|ref|NP_199430.1| ornithine-delta-aminotransferase [Arabidopsis thaliana] gi|9757738|dbj|BAB08263.1| ornithine aminotransferase [Arabidopsis thaliana] gi|66792620|gb|AAY56412.1| At5g46180 [Arabidopsis thaliana] gi|115646724|gb|ABJ17095.1| At5g46180 [Arabidopsis thaliana] gi|332007967|gb|AED95350.1| ornithine-delta-aminotransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297791071|ref|XP_002863420.1| delta-OAT [Arabidopsis lyrata subsp. lyrata] gi|297309255|gb|EFH39679.1| delta-OAT [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|157890950|dbj|BAF81516.1| ornithine-oxo-acid transaminase [Brassica rapa] Back     alignment and taxonomy information
>gi|225443914|ref|XP_002278418.1| PREDICTED: probable ornithine aminotransferase [Vitis vinifera] gi|297740745|emb|CBI30927.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|169665583|gb|ACA63476.1| ornithine aminotransferase [Brassica napus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query374
TAIR|locus:2161398475 DELTA-OAT "AT5G46180" [Arabido 0.997 0.785 0.811 5e-163
UNIPROTKB|Q10G56473 OAT "Ornithine aminotransferas 0.997 0.788 0.737 2.3e-151
DICTYBASE|DDB_G0287913416 oatA "ornithine-oxo-acid trans 0.887 0.798 0.559 8.6e-104
CGD|CAL0000636436 CAR2 [Candida albicans (taxid: 0.938 0.805 0.530 2e-95
UNIPROTKB|Q59US9436 CAR2 "Putative uncharacterized 0.938 0.805 0.530 2e-95
POMBASE|SPBC21C3.08c438 car2 "ornithine transaminase C 0.941 0.803 0.525 7.8e-94
ASPGD|ASPL0000050437454 otaA [Emericella nidulans (tax 0.927 0.764 0.502 4.3e-93
FB|FBgn0022774431 Oat "Ornithine aminotransferas 0.871 0.756 0.520 1.7e-91
UNIPROTKB|P38021401 rocD "Ornithine aminotransfera 0.893 0.832 0.510 6.5e-90
SGD|S000004430424 CAR2 "L-ornithine transaminase 0.927 0.818 0.513 8.3e-90
TAIR|locus:2161398 DELTA-OAT "AT5G46180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1587 (563.7 bits), Expect = 5.0e-163, P = 5.0e-163
 Identities = 306/377 (81%), Positives = 339/377 (89%)

Query:     1 MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWG 60
             MKALQEQ EKLTLSSRAFYNDKFPVFAERLT+MFGYDMVLPMNTGAEGVETALKLARKWG
Sbjct:    98 MKALQEQVEKLTLSSRAFYNDKFPVFAERLTNMFGYDMVLPMNTGAEGVETALKLARKWG 157

Query:    61 YVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEK 120
             + KK    DEAIIVSCCGCFHGRTLA +SMSCDN+A RGFGPLLPG+LKVDFGD  +LEK
Sbjct:   158 HEKKNIPKDEAIIVSCCGCFHGRTLAIVSMSCDNDATRGFGPLLPGNLKVDFGDADSLEK 217

Query:   121 IFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRM 180
             IFKE GD+IAGFLFEPIQGEAGVIIPPDGYLKAVR+LC+KYN+LMIADE+QSGLARSG+M
Sbjct:   218 IFKEKGDRIAGFLFEPIQGEAGVIIPPDGYLKAVRELCTKYNVLMIADEVQSGLARSGKM 277

Query:   181 LASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIA 240
             LA DWEE+RPDMVILGKALGGGVIPVSAVLADK+VML I+PG+HGSTFGGNPLASAVA+A
Sbjct:   278 LACDWEEIRPDMVILGKALGGGVIPVSAVLADKDVMLHIKPGQHGSTFGGNPLASAVAMA 337

Query:   241 SLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTAL-PVSA 299
             SLDVI +EKL ERSA LGEELR  L +I++QFP Y+KEVRGRGLFNA+EF+  +L PVSA
Sbjct:   338 SLDVIVEEKLVERSASLGEELRIQLNEIKKQFPKYIKEVRGRGLFNAIEFNSESLSPVSA 397

Query:   300 YDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKPKPAD 359
             YDICL +KERG+LAKPTH+TIVRLTPPLSISS+EL++GS+ALHDVLELDLP + K     
Sbjct:   398 YDICLSLKERGVLAKPTHNTIVRLTPPLSISSDELRDGSEALHDVLELDLPNLLKINSGK 457

Query:   360 APA---TPCHRCGRNLY 373
              P    T C RCGRNLY
Sbjct:   458 TPVSHITECDRCGRNLY 474




GO:0004587 "ornithine-oxo-acid transaminase activity" evidence=ISS;IDA;IMP
GO:0005737 "cytoplasm" evidence=ISM
GO:0005739 "mitochondrion" evidence=IDA
GO:0006561 "proline biosynthetic process" evidence=IDA;IMP
GO:0006593 "ornithine catabolic process" evidence=IDA;IMP
GO:0019544 "arginine catabolic process to glutamate" evidence=IMP
GO:0008270 "zinc ion binding" evidence=IDA
GO:0009626 "plant-type hypersensitive response" evidence=TAS
GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IEP
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0007031 "peroxisome organization" evidence=RCA
GO:0010260 "organ senescence" evidence=RCA
GO:0009651 "response to salt stress" evidence=IDA
GO:0042538 "hyperosmotic salinity response" evidence=IDA
UNIPROTKB|Q10G56 OAT "Ornithine aminotransferase, mitochondrial" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287913 oatA "ornithine-oxo-acid transaminase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0000636 CAR2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59US9 CAR2 "Putative uncharacterized protein CAR2" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
POMBASE|SPBC21C3.08c car2 "ornithine transaminase Car2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000050437 otaA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
FB|FBgn0022774 Oat "Ornithine aminotransferase precursor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P38021 rocD "Ornithine aminotransferase" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
SGD|S000004430 CAR2 "L-ornithine transaminase (OTAse)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q81GP2OAT_BACCR2, ., 6, ., 1, ., 1, 30.47530.89300.8434yesno
C0ZBR4OAT_BREBN2, ., 6, ., 1, ., 1, 30.49270.89830.8421yesno
Q6GID1OAT2_STAAR2, ., 6, ., 1, ., 1, 30.52310.89570.8459yesno
C5D6R2OAT_GEOSW2, ., 6, ., 1, ., 1, 30.54490.86360.8115yesno
Q81TV3OAT_BACAN2, ., 6, ., 1, ., 1, 30.47530.89300.8434yesno
P60299OAT2_STAAW2, ., 6, ., 1, ., 1, 30.52600.89570.8459yesno
Q9P7L5OAT_SCHPO2, ., 6, ., 1, ., 1, 30.52030.94110.8036yesno
B9ITF9OAT_BACCQ2, ., 6, ., 1, ., 1, 30.47820.89300.8434yesno
Q7W1E4OAT_BORPA2, ., 6, ., 1, ., 1, 30.460.91170.8296yesno
B9DIU0OAT_STACT2, ., 6, ., 1, ., 1, 30.52750.89300.8434yesno
P07991OAT_YEAST2, ., 6, ., 1, ., 1, 30.51390.92780.8183yesno
C1EL61OAT_BACC32, ., 6, ., 1, ., 1, 30.47820.89300.8434yesno
Q9FNK4OAT_ARATH2, ., 6, ., 1, ., 1, 30.81160.99730.7852yesno
Q8CT82OAT_STAES2, ., 6, ., 1, ., 1, 30.52990.86360.8156yesno
C3P3K3OAT_BACAA2, ., 6, ., 1, ., 1, 30.47530.89300.8434yesno
P04181OAT_HUMAN2, ., 6, ., 1, ., 1, 30.50720.90640.7722yesno
Q5HHC8OAT2_STAAC2, ., 6, ., 1, ., 1, 30.52600.89570.8459yesno
Q3ZCF5OAT_BOVIN2, ., 6, ., 1, ., 1, 30.50430.90640.7722yesno
C4L2E7OAT_EXISA2, ., 6, ., 1, ., 1, 30.52460.89030.8325yesno
Q54JP5OAT_DICDI2, ., 6, ., 1, ., 1, 30.54330.91440.8221yesno
B9EAM9OAT_MACCJ2, ., 6, ., 1, ., 1, 30.54490.86360.8136yesno
Q8EP32OAT_OCEIH2, ., 6, ., 1, ., 1, 30.49270.89300.8391yesno
P38021OAT_BACSU2, ., 6, ., 1, ., 1, 30.50430.89300.8329yesno
Q6LFH8OAT_PLAF72, ., 6, ., 1, ., 1, 30.48380.89830.8115yesno
C3LBX0OAT_BACAC2, ., 6, ., 1, ., 1, 30.47530.89300.8434yesno
Q6GAW9OAT2_STAAS2, ., 6, ., 1, ., 1, 30.52600.89570.8459yesno
Q9VW26OAT_DROME2, ., 6, ., 1, ., 1, 30.52090.87160.7563yesno
Q89RB7OAT_BRAJA2, ., 6, ., 1, ., 1, 30.46700.91170.8440yesno
Q49W96OAT2_STAS12, ., 6, ., 1, ., 1, 30.52020.89570.8459yesno
P60298OAT2_STAAN2, ., 6, ., 1, ., 1, 30.52600.89570.8459yesno
Q5HQK4OAT_STAEQ2, ., 6, ., 1, ., 1, 30.52990.86360.8156yesno
Q7VSA0OAT_BORPE2, ., 6, ., 1, ., 1, 30.460.91170.8296yesno
Q10G56OAT_ORYSJ2, ., 6, ., 1, ., 1, 30.73470.99730.7885yesno
Q9K5Z2OAT_BACHD2, ., 6, ., 1, ., 1, 30.50.89570.8417yesno
P60297OAT2_STAAM2, ., 6, ., 1, ., 1, 30.52600.89570.8459yesno
P29758OAT_MOUSE2, ., 6, ., 1, ., 1, 30.50430.90640.7722yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.6.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
DELTA-OAT
delta-OAT; ornithine-oxo-acid transaminase; ornithine delta-aminotransferase (475 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
OTC
OTC (ORNITHINE CARBAMOYLTRANSFERASE); amino acid binding / carboxyl- or carbamoyltransferase/ o [...] (375 aa)
    0.993
AT2G37500
arginine biosynthesis protein ArgJ family; arginine biosynthesis protein ArgJ family; FUNCTIONS [...] (468 aa)
     0.986
AT4G08900
arginase; Encodes an arginase, likely to be involved in polyamine biosynthesis in pollen. (342 aa)
     0.966
AT2G19940
N-acetyl-gamma-glutamyl-phosphate reductase/ NAD or NADH binding / binding / catalytic/ oxidore [...] (401 aa)
    0.950
ALDH12A1
ALDH12A1; 1-pyrroline-5-carboxylate dehydrogenase/ 3-chloroallyl aldehyde dehydrogenase; Encode [...] (556 aa)
     0.931
AT4G17830
peptidase M20/M25/M40 family protein; peptidase M20/M25/M40 family protein; FUNCTIONS IN- metal [...] (440 aa)
      0.909
AT4G24830
arginosuccinate synthase family; arginosuccinate synthase family; FUNCTIONS IN- argininosuccina [...] (494 aa)
     0.908
AT4G38220
aminoacylase, putative / N-acyl-L-amino-acid amidohydrolase, putative; aminoacylase, putative / [...] (433 aa)
       0.899
AT3G57560
aspartate/glutamate/uridylate kinase family protein; encodes a N-acetylglutamate kinase, involv [...] (347 aa)
     0.897
AT5G10920
argininosuccinate lyase, putative / arginosuccinase, putative; argininosuccinate lyase, putativ [...] (517 aa)
    0.853

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
PLN02624474 PLN02624, PLN02624, ornithine-delta-aminotransfera 0.0
TIGR01885401 TIGR01885, Orn_aminotrans, ornithine aminotransfer 0.0
PTZ00125400 PTZ00125, PTZ00125, ornithine aminotransferase-lik 1e-175
PRK04073396 PRK04073, rocD, ornithine--oxo-acid transaminase; 1e-155
COG4992404 COG4992, ArgD, Ornithine/acetylornithine aminotran 1e-146
cd00610413 cd00610, OAT_like, Acetyl ornithine aminotransfera 1e-132
PRK00854401 PRK00854, rocD, ornithine--oxo-acid transaminase; 1e-127
PRK02627396 PRK02627, PRK02627, acetylornithine aminotransfera 1e-119
pfam00202338 pfam00202, Aminotran_3, Aminotransferase class-III 1e-110
COG0160447 COG0160, GabT, 4-aminobutyrate aminotransferase an 1e-104
TIGR00707379 TIGR00707, argD, transaminase, acetylornithine/suc 2e-94
PRK01278389 PRK01278, argD, acetylornithine transaminase prote 1e-85
PRK05769441 PRK05769, PRK05769, 4-aminobutyrate aminotransfera 3e-84
PRK11522459 PRK11522, PRK11522, putrescine--2-oxoglutarate ami 4e-84
PRK03244398 PRK03244, argD, acetylornithine aminotransferase; 1e-80
COG0161449 COG0161, BioA, Adenosylmethionine-8-amino-7-oxonon 3e-80
TIGR03372442 TIGR03372, putres_am_tran, putrescine aminotransfe 2e-74
PRK02936377 PRK02936, argD, acetylornithine aminotransferase; 4e-74
PRK08117433 PRK08117, PRK08117, 4-aminobutyrate aminotransfera 1e-73
TIGR00508417 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxon 1e-72
PRK05093403 PRK05093, argD, bifunctional N-succinyldiaminopime 1e-72
PLN00144382 PLN00144, PLN00144, acetylornithine transaminase 8e-69
TIGR03246397 TIGR03246, arg_catab_astC, succinylornithine trans 2e-66
PRK04612408 PRK04612, argD, acetylornithine transaminase prote 2e-65
PRK03715395 PRK03715, argD, acetylornithine transaminase prote 2e-64
PRK07495425 PRK07495, PRK07495, 4-aminobutyrate aminotransfera 3e-64
TIGR00700420 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransf 5e-63
PRK04013364 PRK04013, argD, acetylornithine/acetyl-lysine amin 2e-61
PRK06918451 PRK06918, PRK06918, 4-aminobutyrate aminotransfera 3e-60
PRK08593445 PRK08593, PRK08593, 4-aminobutyrate aminotransfera 1e-59
PRK06777421 PRK06777, PRK06777, 4-aminobutyrate aminotransfera 2e-58
PRK06058443 PRK06058, PRK06058, 4-aminobutyrate aminotransfera 2e-58
PRK06917447 PRK06917, PRK06917, hypothetical protein; Provisio 7e-58
PRK06082459 PRK06082, PRK06082, 4-aminobutyrate aminotransfera 2e-57
PRK12381406 PRK12381, PRK12381, bifunctional succinylornithine 1e-55
PRK07481449 PRK07481, PRK07481, hypothetical protein; Provisio 3e-53
PRK06062451 PRK06062, PRK06062, hypothetical protein; Provisio 4e-53
PRK08360443 PRK08360, PRK08360, 4-aminobutyrate aminotransfera 7e-53
PRK06916460 PRK06916, PRK06916, adenosylmethionine--8-amino-7- 2e-52
PRK09792421 PRK09792, PRK09792, 4-aminobutyrate transaminase; 2e-52
PRK04260375 PRK04260, PRK04260, acetylornithine aminotransfera 9e-52
PRK05964423 PRK05964, PRK05964, adenosylmethionine--8-amino-7- 2e-51
PRK07678451 PRK07678, PRK07678, aminotransferase; Validated 2e-51
PRK13360442 PRK13360, PRK13360, omega amino acid--pyruvate tra 8e-51
PRK09264425 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarat 2e-50
PRK07483443 PRK07483, PRK07483, hypothetical protein; Provisio 2e-50
TIGR02407412 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglu 1e-49
PRK06938464 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarat 6e-49
COG0001432 COG0001, HemL, Glutamate-1-semialdehyde aminotrans 1e-48
PRK09221445 PRK09221, PRK09221, beta alanine--pyruvate transam 2e-48
TIGR00709442 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminase 2e-48
PRK08088425 PRK08088, PRK08088, 4-aminobutyrate aminotransfera 1e-47
PRK06931459 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarat 2e-47
PRK05639457 PRK05639, PRK05639, 4-aminobutyrate aminotransfera 9e-46
PRK07480456 PRK07480, PRK07480, putative aminotransferase; Val 2e-45
PRK06105460 PRK06105, PRK06105, aminotransferase; Provisional 8e-44
PRK061481013 PRK06148, PRK06148, hypothetical protein; Provisio 1e-42
PRK06541460 PRK06541, PRK06541, hypothetical protein; Provisio 1e-41
PRK07986428 PRK07986, PRK07986, adenosylmethionine--8-amino-7- 2e-41
TIGR00713423 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-amin 7e-41
PRK06173429 PRK06173, PRK06173, adenosylmethionine--8-amino-7- 8e-40
PRK07036466 PRK07036, PRK07036, hypothetical protein; Provisio 9e-40
PLN02760504 PLN02760, PLN02760, 4-aminobutyrate:pyruvate trans 3e-38
PRK00062426 PRK00062, PRK00062, glutamate-1-semialdehyde amino 5e-37
PRK08297443 PRK08297, PRK08297, L-lysine aminotransferase; Pro 2e-36
TIGR03251431 TIGR03251, LAT_fam, L-lysine 6-transaminase 8e-36
PRK07482461 PRK07482, PRK07482, hypothetical protein; Provisio 2e-35
PRK12403460 PRK12403, PRK12403, putative aminotransferase; Pro 5e-35
PRK05965459 PRK05965, PRK05965, hypothetical protein; Provisio 1e-33
PRK06149972 PRK06149, PRK06149, hypothetical protein; Provisio 2e-32
PRK07030466 PRK07030, PRK07030, adenosylmethionine--8-amino-7- 2e-31
PRK08742472 PRK08742, PRK08742, adenosylmethionine--8-amino-7- 6e-29
PRK06943453 PRK06943, PRK06943, adenosylmethionine--8-amino-7- 6e-28
PRK00615433 PRK00615, PRK00615, glutamate-1-semialdehyde amino 1e-27
PRK05630422 PRK05630, PRK05630, adenosylmethionine--8-amino-7- 1e-27
PRK12389428 PRK12389, PRK12389, glutamate-1-semialdehyde amino 4e-26
TIGR00699464 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotran 2e-21
PLN02482474 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-a 4e-21
PRK06209431 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-a 5e-16
PRK07046453 PRK07046, PRK07046, aminotransferase; Validated 3e-15
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 2e-11
PLN02974817 PLN02974, PLN02974, adenosylmethionine-8-amino-7-o 1e-09
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 5e-06
COG0156388 COG0156, BioF, 7-keto-8-aminopelargonate synthetas 2e-05
PRK05958385 PRK05958, PRK05958, 8-amino-7-oxononanoate synthas 3e-04
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 3e-04
>gnl|CDD|215335 PLN02624, PLN02624, ornithine-delta-aminotransferase Back     alignment and domain information
 Score =  724 bits (1871), Expect = 0.0
 Identities = 303/378 (80%), Positives = 334/378 (88%), Gaps = 4/378 (1%)

Query: 1   MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWG 60
           +KAL EQAEKLTLSSRAFYNDKFP FAE LTSMFGYDMVLPMNTGAEGVETA+KLARKWG
Sbjct: 97  IKALTEQAEKLTLSSRAFYNDKFPEFAEYLTSMFGYDMVLPMNTGAEGVETAIKLARKWG 156

Query: 61  YVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEK 120
           Y KK    +EAIIVSCCGCFHGRTLAAISMSCDNEA RGFGPLLPGHLKVDFGD+ ALEK
Sbjct: 157 YEKKGIPKNEAIIVSCCGCFHGRTLAAISMSCDNEATRGFGPLLPGHLKVDFGDLDALEK 216

Query: 121 IFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRM 180
           IF+E GD+IA FLFEPIQGEAGV+IPPDGYLKAVR+LCSK+N+LMIADEIQ+GLAR+G+M
Sbjct: 217 IFEEDGDRIAAFLFEPIQGEAGVVIPPDGYLKAVRELCSKHNVLMIADEIQTGLARTGKM 276

Query: 181 LASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIA 240
           LA DWEEVRPD+VILGKALGGGVIPVSAVLADK+VMLCI+PGEHGSTFGGNPLASAVA+A
Sbjct: 277 LACDWEEVRPDVVILGKALGGGVIPVSAVLADKDVMLCIKPGEHGSTFGGNPLASAVAMA 336

Query: 241 SLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTAL-PVSA 299
           +L V++DEKLAERSA LG+ELR  L KIQ+QFP  +KEVRGRGL NAV  +   L PVSA
Sbjct: 337 ALQVVQDEKLAERSAKLGQELRDQLQKIQKQFPKLIKEVRGRGLLNAVVLNSPKLGPVSA 396

Query: 300 YDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKPKPAD 359
           YD+CLK+KERG+LAKPTHDTI+RL PPLSIS +ELQE SKAL DVLE DLPK++  K   
Sbjct: 397 YDVCLKLKERGLLAKPTHDTIIRLAPPLSISEDELQECSKALSDVLEHDLPKLQSAKKEK 456

Query: 360 APA---TPCHRCGRNLYG 374
            P    TPC RCGRNLY 
Sbjct: 457 TPKAAPTPCDRCGRNLYA 474


Length = 474

>gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase Back     alignment and domain information
>gnl|CDD|240281 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179736 PRK04073, rocD, ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>gnl|CDD|227325 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family Back     alignment and domain information
>gnl|CDD|234848 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>gnl|CDD|235056 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|201078 pfam00202, Aminotran_3, Aminotransferase class-III Back     alignment and domain information
>gnl|CDD|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233098 TIGR00707, argD, transaminase, acetylornithine/succinylornithine family Back     alignment and domain information
>gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|235599 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235112 PRK03244, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|223239 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|132415 TIGR03372, putres_am_tran, putrescine aminotransferase Back     alignment and domain information
>gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|233000 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|179933 PRK05093, argD, bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase Back     alignment and domain information
>gnl|CDD|132290 TIGR03246, arg_catab_astC, succinylornithine transaminase family Back     alignment and domain information
>gnl|CDD|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|236032 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>gnl|CDD|101376 PRK04013, argD, acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235885 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235685 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235884 PRK06917, PRK06917, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183486 PRK12381, PRK12381, bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>gnl|CDD|168967 PRK07481, PRK07481, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235687 PRK06062, PRK06062, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235656 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|181078 PRK07678, PRK07678, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|236027 PRK07483, PRK07483, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233853 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>gnl|CDD|235892 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|223080 COG0001, HemL, Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181707 PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>gnl|CDD|236149 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|235889 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180994 PRK07480, PRK07480, putative aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180401 PRK06105, PRK06105, aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235823 PRK06541, PRK06541, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181189 PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>gnl|CDD|233100 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>gnl|CDD|180441 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|235913 PRK07036, PRK07036, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215405 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>gnl|CDD|234607 PRK00062, PRK00062, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236224 PRK08297, PRK08297, L-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase Back     alignment and domain information
>gnl|CDD|236026 PRK07482, PRK07482, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|171472 PRK12403, PRK12403, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180330 PRK05965, PRK05965, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235716 PRK06149, PRK06149, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180800 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|236336 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|235894 PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|234803 PRK00615, PRK00615, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180174 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|183493 PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|129782 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>gnl|CDD|178100 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>gnl|CDD|180471 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>gnl|CDD|235917 PRK07046, PRK07046, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|215526 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|223234 COG0156, BioF, 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235655 PRK05958, PRK05958, 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 374
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 100.0
COG0160447 GabT 4-aminobutyrate aminotransferase and related 100.0
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 100.0
PLN02624474 ornithine-delta-aminotransferase 100.0
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 100.0
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 100.0
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 100.0
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 100.0
PRK05965459 hypothetical protein; Provisional 100.0
PRK01278389 argD acetylornithine transaminase protein; Provisi 100.0
PRK04612408 argD acetylornithine transaminase protein; Provisi 100.0
PRK07482461 hypothetical protein; Provisional 100.0
PLN00144382 acetylornithine transaminase 100.0
PRK07678451 aminotransferase; Validated 100.0
PRK12381406 bifunctional succinylornithine transaminase/acetyl 100.0
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK07481449 hypothetical protein; Provisional 100.0
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 100.0
PRK07483443 hypothetical protein; Provisional 100.0
PLN02760504 4-aminobutyrate:pyruvate transaminase 100.0
PRK07495425 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06062451 hypothetical protein; Provisional 100.0
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK03715395 argD acetylornithine transaminase protein; Provisi 100.0
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 100.0
PRK08593445 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06105460 aminotransferase; Provisional 100.0
PRK07036466 hypothetical protein; Provisional 100.0
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 100.0
PRK13360442 omega amino acid--pyruvate transaminase; Provision 100.0
PRK06541460 hypothetical protein; Provisional 100.0
PRK09221445 beta alanine--pyruvate transaminase; Provisional 100.0
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK06777421 4-aminobutyrate aminotransferase; Provisional 100.0
PRK07480456 putative aminotransferase; Validated 100.0
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 100.0
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 100.0
PRK06058443 4-aminobutyrate aminotransferase; Provisional 100.0
PRK09792421 4-aminobutyrate transaminase; Provisional 100.0
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 100.0
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 100.0
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 100.0
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 100.0
PRK06082459 4-aminobutyrate aminotransferase; Provisional 100.0
PRK08117433 4-aminobutyrate aminotransferase; Provisional 100.0
PRK05639457 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06917447 hypothetical protein; Provisional 100.0
PRK12403460 putative aminotransferase; Provisional 100.0
PRK08360443 4-aminobutyrate aminotransferase; Provisional 100.0
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 100.0
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 100.0
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 100.0
KOG1401433 consensus Acetylornithine aminotransferase [Amino 100.0
PRK03244398 argD acetylornithine aminotransferase; Provisional 100.0
PRK05769441 4-aminobutyrate aminotransferase; Provisional 100.0
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 100.0
PRK02936377 argD acetylornithine aminotransferase; Provisional 100.0
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 100.0
PTZ00125400 ornithine aminotransferase-like protein; Provision 100.0
PRK02627396 acetylornithine aminotransferase; Provisional 100.0
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 100.0
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 100.0
PRK08297443 L-lysine aminotransferase; Provisional 100.0
PRK061481013 hypothetical protein; Provisional 100.0
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 100.0
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 100.0
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 100.0
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 100.0
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 100.0
PRK06149972 hypothetical protein; Provisional 100.0
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 100.0
TIGR00707379 argD acetylornithine and succinylornithine aminotr 100.0
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 100.0
PRK08088425 4-aminobutyrate aminotransferase; Validated 100.0
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 100.0
PRK04260375 acetylornithine aminotransferase; Provisional 100.0
PRK07046453 aminotransferase; Validated 100.0
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 100.0
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 100.0
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 100.0
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 100.0
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 100.0
PLN02822481 serine palmitoyltransferase 99.97
PRK06207405 aspartate aminotransferase; Provisional 99.97
PRK07324373 transaminase; Validated 99.97
PRK13393406 5-aminolevulinate synthase; Provisional 99.97
PRK07682378 hypothetical protein; Validated 99.97
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.97
PRK09064407 5-aminolevulinate synthase; Validated 99.97
PRK06108382 aspartate aminotransferase; Provisional 99.97
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.97
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.97
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.97
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.97
PLN00175413 aminotransferase family protein; Provisional 99.97
PRK07681399 aspartate aminotransferase; Provisional 99.97
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.96
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.96
PRK07179407 hypothetical protein; Provisional 99.96
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.96
PRK06225380 aspartate aminotransferase; Provisional 99.96
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 99.96
PRK08960387 hypothetical protein; Provisional 99.96
PRK05957389 aspartate aminotransferase; Provisional 99.96
PRK07309391 aromatic amino acid aminotransferase; Validated 99.96
PRK06348384 aspartate aminotransferase; Provisional 99.96
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 99.96
PLN02187462 rooty/superroot1 99.96
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.96
PRK12414384 putative aminotransferase; Provisional 99.96
PRK09082386 methionine aminotransferase; Validated 99.96
PRK08636403 aspartate aminotransferase; Provisional 99.96
PRK09148405 aminotransferase; Validated 99.96
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.96
PRK08361391 aspartate aminotransferase; Provisional 99.96
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.96
PRK06290410 aspartate aminotransferase; Provisional 99.96
PRK07505402 hypothetical protein; Provisional 99.96
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.96
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.96
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.96
PRK13392410 5-aminolevulinate synthase; Provisional 99.96
PTZ00433412 tyrosine aminotransferase; Provisional 99.96
PLN02955476 8-amino-7-oxononanoate synthase 99.96
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.96
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.96
PRK08068389 transaminase; Reviewed 99.96
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.96
PRK07683387 aminotransferase A; Validated 99.96
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.96
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.96
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.96
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.96
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.96
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.96
PLN02483489 serine palmitoyltransferase 99.95
PRK05942394 aspartate aminotransferase; Provisional 99.95
PRK08912387 hypothetical protein; Provisional 99.95
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.95
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.95
PLN02656409 tyrosine transaminase 99.95
PRK08175395 aminotransferase; Validated 99.95
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.95
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.95
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.95
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.95
PRK06107402 aspartate aminotransferase; Provisional 99.95
PRK06855433 aminotransferase; Validated 99.95
PRK07337388 aminotransferase; Validated 99.95
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.95
PRK07777387 aminotransferase; Validated 99.95
PRK07550386 hypothetical protein; Provisional 99.95
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.95
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.95
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.95
PRK05764393 aspartate aminotransferase; Provisional 99.95
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.95
PRK07568397 aspartate aminotransferase; Provisional 99.95
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.95
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.95
PRK08363398 alanine aminotransferase; Validated 99.95
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.95
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.95
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.95
PRK05839374 hypothetical protein; Provisional 99.95
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.95
PTZ00377481 alanine aminotransferase; Provisional 99.95
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.95
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.94
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 99.94
PRK09105370 putative aminotransferase; Provisional 99.94
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.94
PRK03321352 putative aminotransferase; Provisional 99.94
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.94
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.94
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.94
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.94
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.94
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.94
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.94
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.94
PLN02721353 threonine aldolase 99.94
PLN02231534 alanine transaminase 99.94
PRK09275527 aspartate aminotransferase; Provisional 99.94
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.94
PTZ00376404 aspartate aminotransferase; Provisional 99.94
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.94
PRK06836394 aspartate aminotransferase; Provisional 99.94
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.94
PRK08637388 hypothetical protein; Provisional 99.94
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.94
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.94
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.94
PRK08354311 putative aminotransferase; Provisional 99.94
PRK09265404 aminotransferase AlaT; Validated 99.94
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.94
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.94
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.94
PRK07392360 threonine-phosphate decarboxylase; Validated 99.93
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.93
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.93
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.93
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.93
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.93
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.93
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.93
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.93
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.93
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.92
PLN026721082 methionine S-methyltransferase 99.92
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.92
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.92
PRK13520371 L-tyrosine decarboxylase; Provisional 99.92
PLN02397423 aspartate transaminase 99.91
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.91
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.91
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.91
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.91
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.91
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.91
PRK10534333 L-threonine aldolase; Provisional 99.91
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.91
PLN02409401 serine--glyoxylate aminotransaminase 99.91
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.91
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.91
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.91
KOG0634472 consensus Aromatic amino acid aminotransferase and 99.91
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.9
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 99.9
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.9
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.9
PRK07908349 hypothetical protein; Provisional 99.9
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.9
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.9
PLN02368407 alanine transaminase 99.9
PRK02948381 cysteine desulfurase; Provisional 99.89
PLN02242418 methionine gamma-lyase 99.89
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.89
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.89
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.89
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.88
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.88
TIGR01814406 kynureninase kynureninase. This model describes ky 99.88
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.88
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.87
PRK06767386 methionine gamma-lyase; Provisional 99.87
PRK08249398 cystathionine gamma-synthase; Provisional 99.87
PRK06234400 methionine gamma-lyase; Provisional 99.87
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.87
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.87
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.87
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.87
PRK07049427 methionine gamma-lyase; Validated 99.87
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.87
PRK08247366 cystathionine gamma-synthase; Reviewed 99.86
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.86
PLN02651364 cysteine desulfurase 99.86
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.86
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.86
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.86
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.86
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.86
PRK08045386 cystathionine gamma-synthase; Provisional 99.86
PRK06460376 hypothetical protein; Provisional 99.86
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.86
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.86
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.86
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.86
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.86
PRK07050394 cystathionine beta-lyase; Provisional 99.85
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.85
PRK07503403 methionine gamma-lyase; Provisional 99.85
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.85
PRK07269364 cystathionine gamma-synthase; Reviewed 99.84
PLN02414993 glycine dehydrogenase (decarboxylating) 99.84
PRK05968389 hypothetical protein; Provisional 99.84
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.84
PRK08776405 cystathionine gamma-synthase; Provisional 99.84
PRK14012404 cysteine desulfurase; Provisional 99.84
PRK07811388 cystathionine gamma-synthase; Provisional 99.84
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.83
PRK08861388 cystathionine gamma-synthase; Provisional 99.83
PRK08574385 cystathionine gamma-synthase; Provisional 99.83
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.83
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.83
PRK07582366 cystathionine gamma-lyase; Validated 99.83
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.83
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.83
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.82
PRK09028394 cystathionine beta-lyase; Provisional 99.81
KOG0633375 consensus Histidinol phosphate aminotransferase [A 99.81
PRK12566954 glycine dehydrogenase; Provisional 99.81
PRK08064390 cystathionine beta-lyase; Provisional 99.81
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.81
PRK05967395 cystathionine beta-lyase; Provisional 99.81
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.8
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.8
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.8
PRK05939397 hypothetical protein; Provisional 99.79
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.79
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.79
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.79
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.78
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 99.78
PLN02509464 cystathionine beta-lyase 99.78
PRK13580493 serine hydroxymethyltransferase; Provisional 99.78
PRK07671377 cystathionine beta-lyase; Provisional 99.78
PRK05367954 glycine dehydrogenase; Provisional 99.78
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.78
PRK08114395 cystathionine beta-lyase; Provisional 99.77
PRK02769380 histidine decarboxylase; Provisional 99.77
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.76
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.76
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.76
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.76
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.76
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.75
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.75
PRK03080378 phosphoserine aminotransferase; Provisional 99.75
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.74
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.74
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 99.73
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.72
PLN03226475 serine hydroxymethyltransferase; Provisional 99.72
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.72
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.72
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.7
PLN03032374 serine decarboxylase; Provisional 99.7
PRK06434384 cystathionine gamma-lyase; Validated 99.7
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.7
PRK04311464 selenocysteine synthase; Provisional 99.69
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.69
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.68
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.67
PLN02724 805 Molybdenum cofactor sulfurase 99.67
PLN02880490 tyrosine decarboxylase 99.67
PRK13237460 tyrosine phenol-lyase; Provisional 99.66
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.65
PLN02590539 probable tyrosine decarboxylase 99.64
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.64
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.63
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.61
PRK15029 755 arginine decarboxylase; Provisional 99.61
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.6
PLN02263470 serine decarboxylase 99.6
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.59
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.59
PRK13578 720 ornithine decarboxylase; Provisional 99.53
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.52
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.51
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.5
PRK15400 714 lysine decarboxylase CadA; Provisional 99.49
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.48
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 99.47
PLN02271586 serine hydroxymethyltransferase 99.46
PLN02452365 phosphoserine transaminase 99.45
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.43
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.43
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 99.42
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.4
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.4
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.39
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.36
PRK12462364 phosphoserine aminotransferase; Provisional 99.33
PRK05367 954 glycine dehydrogenase; Provisional 99.26
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.23
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.17
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 99.15
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.94
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 98.94
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 98.93
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 98.93
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 98.91
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.86
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 98.83
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 98.79
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 98.79
KOG0629510 consensus Glutamate decarboxylase and related prot 98.78
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 98.74
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 98.71
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 98.33
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 98.28
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 98.15
PRK12566 954 glycine dehydrogenase; Provisional 98.15
COG4100416 Cystathionine beta-lyase family protein involved i 98.13
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 98.11
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 97.64
KOG3843432 consensus Predicted serine hydroxymethyltransferas 97.43
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 97.27
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 96.05
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=1e-59  Score=420.02  Aligned_cols=335  Identities=45%  Similarity=0.723  Sum_probs=318.9

Q ss_pred             ChHHHHHHHhccccCcCCCCCcHHHHHHHHhcccC-CCeEEecCChHHHHHHHHHHHHHcccccccCCCCccEEEEeccC
Q 017259            1 MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFG-YDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGC   79 (374)
Q Consensus         1 ~~a~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~-~~~~~~~~~gs~a~~~al~~~~~~~~~~~G~~~~~~~vi~~~~~   79 (374)
                      ++|+.+|++++++.++.+.++...+|+++|++..+ .++++|+|||+||+|.|++++|.++.     ++++.+||.+..+
T Consensus        64 v~al~~Q~~kl~h~sn~~~~~~~~~la~~L~~~s~~~d~vff~NSGaEA~EaAiKlARk~~~-----~~~k~~Iia~~ns  138 (404)
T COG4992          64 VEALKEQAEKLWHVSNLFYNEPQAELAEKLVELSPFADRVFFCNSGAEANEAALKLARKYTG-----DPEKSKIIAFENS  138 (404)
T ss_pred             HHHHHHHHHHhhhcccccCChHHHHHHHHHHhhCccccEEEEcCCcHHHHHHHHHHHHHHcC-----CCCCcEEEEEcCC
Confidence            47899999999999999999999999999999996 99999999999999999999998763     3456899999999


Q ss_pred             CCCcccccccccCCccccccCCCCCCCceeccCCCHHHHHHHHHhcCCcEEEEEEccccCCCCcccCChhHHHHHHHHHH
Q 017259           80 FHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCS  159 (374)
Q Consensus        80 yhg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~le~~l~~~~~~~~~vi~~~~~~~~g~~~~~~~~l~~l~~l~~  159 (374)
                      |||.+.++.++++++.++.+|.|+.+++.++||+|+++++++++   ++|++|++||+++.+|.+.+++++++++.++|+
T Consensus       139 FHGRT~galS~t~~~ky~~~F~Pl~~g~~~vpfnDi~al~~ai~---~~taAvivEPIQGEgGV~~~~~~fl~~lr~lCd  215 (404)
T COG4992         139 FHGRTLGALSATGQPKYRKGFGPLLPGFRHVPFNDIEALEAAID---EDTAAVIVEPIQGEGGVIPAPPEFLKALRELCD  215 (404)
T ss_pred             cCCccceeeeccCChhhccCCCCCCCCceecCCCCHHHHHHHhc---cCeEEEEEecccCCCCCCCCCHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999   589999999999999999999999999999999


Q ss_pred             hcCCEEEEeccccCCcccccCcccccCCCCCcEEEecccccCCccchhhheeCHHHHhhcCCCCCCCCCCCCHHHHHHHH
Q 017259          160 KYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAI  239 (374)
Q Consensus       160 ~~~i~li~Dea~~~~~~~g~~~~~~~~~~~~d~~s~sK~~~~G~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~aa~  239 (374)
                      +||+++|.||+|+|+||+|+.|+++++++.||+++++|++|||+ |+|.+++++.+.+.+.+..|++||.+|+++++++.
T Consensus       216 ~~g~LLI~DEVQtG~GRTGk~fA~e~~gV~PDI~tlaK~LgGG~-PigA~la~~~~~~~~~~G~HgSTfGGNpLacAv~~  294 (404)
T COG4992         216 EHGALLILDEVQTGLGRTGKLFAYEHYGVEPDILTLAKALGGGF-PIGAMLATEEIASAFTPGDHGSTFGGNPLACAVAL  294 (404)
T ss_pred             HhCeEEEEeccccCCCccchHHHHHHhCCCCCEEEeeccccCCc-cceeeEEchhhhhcCCCCcccCCCCcCHHHHHHHH
Confidence            99999999999999999999999999999999999999999998 99999999777888999999999999999999999


Q ss_pred             HHHHHHhhhcHHHHHHHHHHHHHHHHHHHHHhCCCceeeEEEEeeeEEEEeccCCCchhHHHHHHHHHHCCeEeccCCCC
Q 017259          240 ASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDT  319 (374)
Q Consensus       240 ~al~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~l~~~Gi~v~~~~~~  319 (374)
                      ++++.+.++++.++.++.+++++++|+++...+| ++..+++.|+++++++....   .+.++++.|.++|+++.+.+++
T Consensus       295 a~l~~l~~e~ll~~v~~~g~~~~~~L~~l~~~~~-~v~~vRG~GLmiGiel~~~~---~a~~~~~~~~~~gvL~~~a~~~  370 (404)
T COG4992         295 AVLEVLLEEGLLENVREKGEYLLQRLRELKRRYP-LVKEVRGRGLMIGIELKEPY---RARDIVRALREEGVLVLPAGPN  370 (404)
T ss_pred             HHHHHHcchhHHHHHHHHHHHHHHHHHHHhhcCC-ceeeeecceeEEEEEecCcc---cHHHHHHHHHHCCeEEecCCCC
Confidence            9999999999999999999999999999998886 89999999999999997653   4789999999999999999999


Q ss_pred             EEEEecCCCCCHHHHHHHHHHHHHHHhccC
Q 017259          320 IVRLTPPLSISSNELQEGSKALHDVLELDL  349 (374)
Q Consensus       320 ~lRi~~~~~~~~e~i~~~~~~l~~~~~~~~  349 (374)
                      .+|+.||+.++++++++++++|+++++ ..
T Consensus       371 ViR~~PpL~i~~eei~~~~~~l~~~l~-~~  399 (404)
T COG4992         371 VIRFLPPLVITEEEIDEALDALERALA-AA  399 (404)
T ss_pred             eEEecCCccCCHHHHHHHHHHHHHHHH-Hh
Confidence            999999999999999999999999998 54



>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
2byj_A439 Ornithine Aminotransferase Mutant Y85i Length = 439 3e-96
1oat_A439 Ornithine Aminotransferase Length = 439 3e-96
2can_A402 Human Ornithine Aminotransferase Complexed With L-C 5e-96
2byl_A439 Structure Of Ornithine Aminotransferase Triple Muta 3e-95
3lg0_A422 Structure Of Plasmodium Falciparum Ornithine Delta- 9e-92
3ruy_A392 Crystal Structure Of The Ornithine-Oxo Acid Transam 4e-91
1z7d_A433 Ornithine Aminotransferase Py00104 From Plasmodium 5e-87
2eh6_A375 Crystal Structure Of Acetylornithine Aminotransfera 1e-46
2pb0_A420 Structure Of Biosynthetic N-Acetylornithine Aminotr 4e-46
2e54_A385 Crystal Structure Of Acetylornithine Aminotransfera 3e-45
2ord_A397 Crystal Structure Of Acetylornithine Aminotransfera 8e-45
3nx3_A395 Crystal Structure Of Acetylornithine Aminotransfera 8e-43
4adb_A406 Structural And Functional Study Of Succinyl-ornithi 2e-42
1vef_A395 Acetylornithine Aminotransferase From Thermus Therm 5e-41
3oks_A451 Crystal Structure Of 4-Aminobutyrate Transaminase F 5e-41
2eo5_A419 Crystal Structure Of 4-Aminobutyrate Aminotransfera 4e-39
3q8n_A453 Crystal Structure Of 4-Aminobutyrate Transaminase F 1e-36
3r4t_A467 Crystal Structure Of 4-Aminobutyrate Aminotransfera 2e-36
3du4_A448 Crystal Structure Of 7-Keto-8-Aminopelargonic Acid 3e-36
3dod_A448 Crystal Structure Of Plp Bound 7,8-diaminopelargoni 3e-36
1szs_A426 The Structure Of Gamma-aminobutyrate Aminotransfera 2e-34
1sf2_A426 Structure Of E. Coli Gamma-Aminobutyrate Aminotrans 3e-34
1szu_A426 The Structure Of Gamma-Aminobutyrate Aminotransfera 7e-34
1szk_A426 The Structure Of Gamma-Aminobutyrate Aminotransfera 1e-33
4ffc_A453 Crystal Structure Of A 4-Aminobutyrate Aminotransfe 2e-32
3n5m_A452 Crystals Structure Of A Bacillus Anthracis Aminotra 1e-30
4atp_A456 Structure Of Gaba-Transaminase A1r958 From Arthroba 2e-30
1z3z_A431 The Crystal Structure Of A Dgd Mutant: Q52a Length 4e-29
1dgd_A432 An Alkali Metal Ion Size-Dependent Switch In The Ac 4e-29
1m0n_A433 Structure Of Dialkylglycine Decarboxylase Complexed 4e-29
1d7r_A433 Crystal Structure Of The Complex Of 2,2-Dialkylglyc 4e-29
3nui_A478 Crystal Structure Of Omega-Transferase From Vibrio 7e-28
4a6r_A459 Crystal Structure Of The Omega Transaminase From Ch 1e-27
1qj3_A429 Crystal Structure Of 7,8-Diaminopelargonic Acid Syn 4e-27
3tft_A457 Crystal Structure Of 7,8-Diaminopelargonic Acid Syn 4e-27
4e3r_A473 Plp-Bound Aminotransferase Mutant Crystal Structure 6e-27
4grx_A465 Structure Of An Omega-Aminotransferase From Paracoc 6e-27
1s09_A429 Crystal Structure Of The Y144f Mutant Of 7,8- Diami 9e-27
1dty_A429 Crystal Structure Of Adenosylmethionine-8-Amino-7-O 1e-26
1mgv_A429 Crystal Structure Of The R391a Mutant Of 7,8-Diamin 1e-26
3i4j_A430 Crystal Structure Of Aminotransferase, Class Iii Fr 1e-26
4e3q_A473 Pmp-Bound Form Of Aminotransferase Crystal Structur 1e-26
1s08_A429 Crystal Structure Of The D147n Mutant Of 7,8- Diami 1e-26
1s0a_A429 Crystal Structure Of The Y17f Mutant Of 7,8- Diamin 2e-26
3lv2_A462 Crystal Structure Of Mycobacterium Tuberculosis 7,8 3e-26
1s07_A429 Crystal Structure Of The R253a Mutant Of 7,8-Diamin 3e-26
3bv0_A437 Crystal Structure Of Plp Bound 7,8-Diaminopelargoni 3e-26
1s06_A429 Crystal Structure Of The R253k Mutant Of 7,8- Diami 5e-26
2jjf_A449 N328a Mutant Of M. Tuberculosis Rv3290c Length = 44 2e-25
2cin_A449 Lysine Aminotransferase From M. Tuberculosis In The 2e-25
2jje_A449 Crystal Structure Of T330s Mutant Of Rv3290c From M 5e-25
2jjh_A449 E243 Mutant Of M. Tuberculosis Rv3290c Length = 449 9e-25
3hmu_A472 Crystal Structure Of A Class Iii Aminotransferase F 1e-23
3a8u_X449 Crystal Structure Of Omega-Amino Acid:pyruvate Amin 5e-23
2epj_A434 Crystal Structure Of Glutamate-1-Semialdehyde 2,1-A 7e-23
2e7u_A424 Crystal Structure Of Glutamate-1-Semialdehyde 2,1-A 8e-23
3gju_A459 Crystal Structure Of A Putative Aminotransferase (M 1e-22
2gsa_A432 Crystal Structure Of Glutamate-1-Semialdehyde Amino 1e-22
3fcr_A459 Crystal Structure Of Putative Aminotransferase (Yp_ 2e-22
2hoy_A432 Inter-Subunit Signaling In Gsam Length = 432 2e-22
3fqa_A427 Gabaculien Complex Of Gabaculine Resistant Gsam Ver 3e-22
3fq7_A427 Gabaculine Complex Of Gsam Length = 427 3e-22
3fq8_A427 M248i Mutant Of Gsam Length = 427 6e-22
3dxw_A452 The Crystal Structure Of Alpha-Amino-Epsilon-Caprol 8e-22
2zuk_A439 The Crystal Structure Of Alpha-Amino-Epsilon-Caprol 9e-22
2cfb_A411 Glutamate-1-Semialdehyde 2,1-Aminomutase From Therm 1e-21
3i5t_A476 Crystal Structure Of Aminotransferase Prk07036 From 1e-21
3bs8_A438 Crystal Structure Of Glutamate 1-Semialdehyde Amino 4e-21
3k28_A429 Crystal Structure Of A Glutamate-1-Semialdehyde Ami 4e-20
4e77_A429 2.0a Crystal Structure Of A Glutamate-1-Semialdehyd 5e-19
3l44_A434 Crystal Structure Of Bacillus Anthracis Heml-1, Glu 2e-18
1ohv_A472 4-aminobutyrate-aminotransferase From Pig Length = 9e-16
2yku_A465 Structural Determinants Of The Beta-Selectivity Of 2e-09
2cy8_A453 Crystal Structure Of D-Phenylglycine Aminotransfera 2e-08
4ao9_A454 Biochemical Properties And Crystal Structure Of A N 2e-08
4a0g_A831 Structure Of Bifunctional Dapa Aminotransferase-Dtb 2e-07
4a0f_A831 Structure Of Selenomethionine Substituted Bifunctio 5e-06
>pdb|2BYJ|A Chain A, Ornithine Aminotransferase Mutant Y85i Length = 439 Back     alignment and structure

Iteration: 1

Score = 348 bits (892), Expect = 3e-96, Method: Compositional matrix adjust. Identities = 175/345 (50%), Positives = 236/345 (68%), Gaps = 6/345 (1%) Query: 1 MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWG 60 + AL+ Q +KLTL+SRAFYN+ + E +T +F Y VLPMNTG E ETA KLARKWG Sbjct: 98 VNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWG 157 Query: 61 YVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEK 120 Y K +A IV G F GRTL+AIS S D + GFGP +PG + + D+ ALE+ Sbjct: 158 YTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALER 217 Query: 121 IFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRM 180 ++ +A F+ EPIQGEAGV++P GYL VR+LC+++ +L IADEIQ+GLAR+GR Sbjct: 218 ALQDP--NVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRW 275 Query: 181 LASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIA 240 LA D+E VRPD+V+LGKAL GG+ PVSAVL D ++ML I+PGEHGST+GGNPL VAIA Sbjct: 276 LAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIA 335 Query: 241 SLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAY 300 +L+V+ +E LAE + LG LR L K+ + V VRG+GL NA+ +T A+ Sbjct: 336 ALEVLEEENLAENADKLGIILRNELMKLPS---DVVTAVRGKGLLNAIVIKETK-DWDAW 391 Query: 301 DICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVL 345 +CL++++ G+LAKPTH I+R PPL I +EL+E + ++ + Sbjct: 392 KVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 436
>pdb|1OAT|A Chain A, Ornithine Aminotransferase Length = 439 Back     alignment and structure
>pdb|2CAN|A Chain A, Human Ornithine Aminotransferase Complexed With L-Canaline Length = 402 Back     alignment and structure
>pdb|2BYL|A Chain A, Structure Of Ornithine Aminotransferase Triple Mutant Y85i Y55a G320f Length = 439 Back     alignment and structure
>pdb|3LG0|A Chain A, Structure Of Plasmodium Falciparum Ornithine Delta-Aminotransferase Length = 422 Back     alignment and structure
>pdb|3RUY|A Chain A, Crystal Structure Of The Ornithine-Oxo Acid Transaminase Rocd From Bacillus Anthracis Length = 392 Back     alignment and structure
>pdb|1Z7D|A Chain A, Ornithine Aminotransferase Py00104 From Plasmodium Yoelii Length = 433 Back     alignment and structure
>pdb|2EH6|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From Aquifex Aeolicus Vf5 Length = 375 Back     alignment and structure
>pdb|2PB0|A Chain A, Structure Of Biosynthetic N-Acetylornithine Aminotransferase From Salmonella Typhimurium: Studies On Substrate Specificity And Inhibitor Binding Length = 420 Back     alignment and structure
>pdb|2E54|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From Thermotoga Maritima Length = 385 Back     alignment and structure
>pdb|2ORD|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Ec 2.6.1.11) (Acoat) (Tm1785) From Thermotoga Maritima At 1.40 A Resolution Length = 397 Back     alignment and structure
>pdb|3NX3|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Argd) From Campylobacter Jejuni Length = 395 Back     alignment and structure
>pdb|4ADB|A Chain A, Structural And Functional Study Of Succinyl-ornithine Transaminase From E. Coli Length = 406 Back     alignment and structure
>pdb|1VEF|A Chain A, Acetylornithine Aminotransferase From Thermus Thermophilus Hb8 Length = 395 Back     alignment and structure
>pdb|3OKS|A Chain A, Crystal Structure Of 4-Aminobutyrate Transaminase From Mycobacterium Smegmatis Length = 451 Back     alignment and structure
>pdb|2EO5|A Chain A, Crystal Structure Of 4-Aminobutyrate Aminotransferase From Sulfolobus Tokodaii Strain7 Length = 419 Back     alignment and structure
>pdb|3Q8N|A Chain A, Crystal Structure Of 4-Aminobutyrate Transaminase From Mycobacterium Smegmatis Length = 453 Back     alignment and structure
>pdb|3R4T|A Chain A, Crystal Structure Of 4-Aminobutyrate Aminotransferase Gabt From Mycobacterium Marinum Covalently Bound To Pyridoxal Phosphate Length = 467 Back     alignment and structure
>pdb|3DU4|A Chain A, Crystal Structure Of 7-Keto-8-Aminopelargonic Acid Bound 7,8- Diaminopelargonic Acid Synthase In Bacillus Subtilis Length = 448 Back     alignment and structure
>pdb|3DOD|A Chain A, Crystal Structure Of Plp Bound 7,8-diaminopelargonic Acid Synthase In Bacillus Subtilis Length = 448 Back     alignment and structure
>pdb|1SZS|A Chain A, The Structure Of Gamma-aminobutyrate Aminotransferase Mutant: I50q Length = 426 Back     alignment and structure
>pdb|1SF2|A Chain A, Structure Of E. Coli Gamma-Aminobutyrate Aminotransferase Length = 426 Back     alignment and structure
>pdb|1SZU|A Chain A, The Structure Of Gamma-Aminobutyrate Aminotransferase Mutant: V241a Length = 426 Back     alignment and structure
>pdb|1SZK|A Chain A, The Structure Of Gamma-Aminobutyrate Aminotransferase Mutant: E211s Length = 426 Back     alignment and structure
>pdb|4FFC|A Chain A, Crystal Structure Of A 4-Aminobutyrate Aminotransferase (Gabt) From Mycobacterium Abscessus Length = 453 Back     alignment and structure
>pdb|3N5M|A Chain A, Crystals Structure Of A Bacillus Anthracis Aminotransferase Length = 452 Back     alignment and structure
>pdb|4ATP|A Chain A, Structure Of Gaba-Transaminase A1r958 From Arthrobacter Aurescens In Complex With Plp Length = 456 Back     alignment and structure
>pdb|1Z3Z|A Chain A, The Crystal Structure Of A Dgd Mutant: Q52a Length = 431 Back     alignment and structure
>pdb|1DGD|A Chain A, An Alkali Metal Ion Size-Dependent Switch In The Active Site Structure Of Dialkylglycine Decarboxylase Length = 432 Back     alignment and structure
>pdb|1M0N|A Chain A, Structure Of Dialkylglycine Decarboxylase Complexed With 1- Aminocyclopentanephosphonate Length = 433 Back     alignment and structure
>pdb|1D7R|A Chain A, Crystal Structure Of The Complex Of 2,2-Dialkylglycine Decarboxylase With 5pa Length = 433 Back     alignment and structure
>pdb|3NUI|A Chain A, Crystal Structure Of Omega-Transferase From Vibrio Fluvialis Js17 Length = 478 Back     alignment and structure
>pdb|4A6R|A Chain A, Crystal Structure Of The Omega Transaminase From Chromobacterium Violaceum In The Apo Form, Crystallised From Polyacrylic Acid Length = 459 Back     alignment and structure
>pdb|1QJ3|A Chain A, Crystal Structure Of 7,8-Diaminopelargonic Acid Synthase In Complex With 7-Keto-8-Aminopelargonic Acid Length = 429 Back     alignment and structure
>pdb|3TFT|A Chain A, Crystal Structure Of 7,8-Diaminopelargonic Acid Synthase (Bioa) From Mycobacterium Tuberculosis, Pre-Reaction Complex With A 3,6- Dihydropyrid-2-One Heterocycle Inhibitor Length = 457 Back     alignment and structure
>pdb|4E3R|A Chain A, Plp-Bound Aminotransferase Mutant Crystal Structure From Vibrio Fluvialis Length = 473 Back     alignment and structure
>pdb|4GRX|A Chain A, Structure Of An Omega-Aminotransferase From Paracoccus Denitrificans Length = 465 Back     alignment and structure
>pdb|1S09|A Chain A, Crystal Structure Of The Y144f Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|1DTY|A Chain A, Crystal Structure Of Adenosylmethionine-8-Amino-7-Oxonanoate Aminotransferase With Pyridoxal Phosphate Cofactor. Length = 429 Back     alignment and structure
>pdb|1MGV|A Chain A, Crystal Structure Of The R391a Mutant Of 7,8-Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|3I4J|A Chain A, Crystal Structure Of Aminotransferase, Class Iii From Deinococcus Radiodurans Length = 430 Back     alignment and structure
>pdb|4E3Q|A Chain A, Pmp-Bound Form Of Aminotransferase Crystal Structure From Vibrio Fluvialis Length = 473 Back     alignment and structure
>pdb|1S08|A Chain A, Crystal Structure Of The D147n Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|1S0A|A Chain A, Crystal Structure Of The Y17f Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|3LV2|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis 7,8-Diaminopelargonic Acid Synthase In Complex With Substrate Analog Sinefungin Length = 462 Back     alignment and structure
>pdb|1S07|A Chain A, Crystal Structure Of The R253a Mutant Of 7,8-Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|3BV0|A Chain A, Crystal Structure Of Plp Bound 7,8-Diaminopelargonic Acid Synthase In Mycobacterium Tuberculosis Length = 437 Back     alignment and structure
>pdb|1S06|A Chain A, Crystal Structure Of The R253k Mutant Of 7,8- Diaminopelargonic Acid Synthase Length = 429 Back     alignment and structure
>pdb|2JJF|A Chain A, N328a Mutant Of M. Tuberculosis Rv3290c Length = 449 Back     alignment and structure
>pdb|2CIN|A Chain A, Lysine Aminotransferase From M. Tuberculosis In The Internal Aldimine Form Length = 449 Back     alignment and structure
>pdb|2JJE|A Chain A, Crystal Structure Of T330s Mutant Of Rv3290c From M. Tuberculosis Length = 449 Back     alignment and structure
>pdb|2JJH|A Chain A, E243 Mutant Of M. Tuberculosis Rv3290c Length = 449 Back     alignment and structure
>pdb|3HMU|A Chain A, Crystal Structure Of A Class Iii Aminotransferase From Silicibacter Pomeroyi Length = 472 Back     alignment and structure
>pdb|3A8U|X Chain X, Crystal Structure Of Omega-Amino Acid:pyruvate Aminotransferase Length = 449 Back     alignment and structure
>pdb|2EPJ|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde 2,1-Aminomutase From Aeropyrum Pernix Length = 434 Back     alignment and structure
>pdb|2E7U|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde 2,1-Aminomutase From Thermus Thermophilus Hb8 Length = 424 Back     alignment and structure
>pdb|2GSA|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde Aminomutase (Aminotransferase, Wild-Type Form) Length = 432 Back     alignment and structure
>pdb|2HOY|A Chain A, Inter-Subunit Signaling In Gsam Length = 432 Back     alignment and structure
>pdb|3FQA|A Chain A, Gabaculien Complex Of Gabaculine Resistant Gsam Version Length = 427 Back     alignment and structure
>pdb|3FQ7|A Chain A, Gabaculine Complex Of Gsam Length = 427 Back     alignment and structure
>pdb|3FQ8|A Chain A, M248i Mutant Of Gsam Length = 427 Back     alignment and structure
>pdb|3DXW|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam Length = 452 Back     alignment and structure
>pdb|2ZUK|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam (Different Binding Mode) Length = 439 Back     alignment and structure
>pdb|2CFB|A Chain A, Glutamate-1-Semialdehyde 2,1-Aminomutase From Thermosynechococcus Elongatus Length = 411 Back     alignment and structure
>pdb|3I5T|A Chain A, Crystal Structure Of Aminotransferase Prk07036 From Rhodobacter Sphaeroides Kd131 Length = 476 Back     alignment and structure
>pdb|3BS8|A Chain A, Crystal Structure Of Glutamate 1-Semialdehyde Aminotransferase Complexed With Pyridoxamine-5'-Phosphate From Bacillus Subtilis Length = 438 Back     alignment and structure
>pdb|3K28|A Chain A, Crystal Structure Of A Glutamate-1-Semialdehyde Aminotransferase From Bacillus Anthracis With Bound Pyridoxal 5'phosphate Length = 429 Back     alignment and structure
>pdb|4E77|A Chain A, 2.0a Crystal Structure Of A Glutamate-1-Semialdehyde Aminotransferase From Yersinia Pestis Co92 Length = 429 Back     alignment and structure
>pdb|3L44|A Chain A, Crystal Structure Of Bacillus Anthracis Heml-1, Glutamate Semialdehyde Aminotransferase Length = 434 Back     alignment and structure
>pdb|1OHV|A Chain A, 4-aminobutyrate-aminotransferase From Pig Length = 472 Back     alignment and structure
>pdb|2YKU|A Chain A, Structural Determinants Of The Beta-Selectivity Of A Bacterial Aminotransferase Length = 465 Back     alignment and structure
>pdb|2CY8|A Chain A, Crystal Structure Of D-Phenylglycine Aminotransferase (D-Phgat) From Pseudomonas Strutzeri St-201 Length = 453 Back     alignment and structure
>pdb|4AO9|A Chain A, Biochemical Properties And Crystal Structure Of A Novel Beta-phenylalanine Aminotransferase From Variovorax Paradoxus Length = 454 Back     alignment and structure
>pdb|4A0G|A Chain A, Structure Of Bifunctional Dapa Aminotransferase-Dtb Synthetase From Arabidopsis Thaliana In Its Apo Form. Length = 831 Back     alignment and structure
>pdb|4A0F|A Chain A, Structure Of Selenomethionine Substituted Bifunctional Dapa Aminotransferase-Dethiobiotin Synthetase From Arabidopsis Thaliana In Its Apo Form. Length = 831 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
1z7d_A433 Ornithine aminotransferase; structural genomics co 0.0
3ruy_A392 Ornithine aminotransferase; structural genomics, c 0.0
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 0.0
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 1e-132
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 1e-119
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 1e-118
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 1e-117
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 1e-117
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 1e-113
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 1e-113
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 1e-112
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 1e-110
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 1e-110
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 1e-109
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 1e-107
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 1e-101
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 1e-84
3nui_A478 Pyruvate transaminase; amino transferase, transfer 2e-82
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 5e-81
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 5e-80
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 1e-79
3hmu_A472 Aminotransferase, class III; structural genomics, 7e-79
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 2e-78
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 2e-77
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 1e-75
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 1e-75
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 1e-74
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 8e-61
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 1e-41
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 2e-39
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 1e-36
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 2e-36
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 4e-36
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 8e-36
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 8e-36
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 3e-33
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 2e-06
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Length = 433 Back     alignment and structure
 Score =  549 bits (1416), Expect = 0.0
 Identities = 158/345 (45%), Positives = 224/345 (64%), Gaps = 5/345 (1%)

Query: 2   KALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGY 61
            A+  QA+ LT+ SRAF++    +    LT++ GYD VL MNTGAE  ETA KL RKWGY
Sbjct: 88  NAMINQAKNLTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWGY 147

Query: 62  VKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKI 121
             KK   + A IV C   F GRTL  IS S   +    FGP  P   KV + D+ ALE+ 
Sbjct: 148 EVKKIPENMAKIVVCKNNFSGRTLGCISASTTKKCTSNFGPFAPQFSKVPYDDLEALEEE 207

Query: 122 FKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRML 181
            K+    +  F+ EPIQGEAGVI+P D YL+ V D+C KYN+L +ADE+Q+GL R+G++L
Sbjct: 208 LKD--PNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLL 265

Query: 182 ASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIAS 241
                 V+PD+++LGKAL GG  P+SAVLA+ ++ML I+PGEHGST+GGNPLA+++ + +
Sbjct: 266 CVHHYNVKPDVILLGKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEA 325

Query: 242 LDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYD 301
           L+V+ +EKL E +  LG    ++L +  +     V++VRG+GL  A+EF      V+  D
Sbjct: 326 LNVLINEKLCENAEKLGGPFLENLKRELKDSK-IVRDVRGKGLLCAIEFKNEL--VNVLD 382

Query: 302 ICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLE 346
           ICLK+KE G++ +  HD  +RLTPPL I+  +L E ++ +   ++
Sbjct: 383 ICLKLKENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTVK 427


>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} Length = 392 Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Length = 439 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Length = 395 Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Length = 451 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Length = 420 Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Length = 397 Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Length = 395 Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Length = 426 Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Length = 449 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Length = 375 Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Length = 433 Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Length = 453 Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Length = 419 Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Length = 439 Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Length = 472 Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Length = 452 Back     alignment and structure
>3nui_A Pyruvate transaminase; amino transferase, transferase; 2.00A {Vibrio fluvialis} Length = 478 Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, pyridoxal phosphate, PSI-2, protein structure initiative; 1.70A {Deinococcus radiodurans} Length = 430 Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Length = 449 Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Length = 460 Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Length = 472 Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} PDB: 3drd_A 3du4_A* Length = 448 Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Length = 459 Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Length = 457 Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Length = 429 Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Length = 476 Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Length = 831 Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Length = 465 Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Length = 453 Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} Length = 434 Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Length = 434 Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Length = 427 Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Length = 429 Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} PDB: 3bs8_A* Length = 429 Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Length = 424 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 100.0
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 100.0
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 100.0
1z7d_A433 Ornithine aminotransferase; structural genomics co 100.0
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 100.0
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 100.0
3hmu_A472 Aminotransferase, class III; structural genomics, 100.0
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 100.0
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 100.0
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 100.0
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 100.0
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 100.0
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 100.0
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 100.0
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 100.0
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 100.0
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 100.0
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 100.0
3ruy_A392 Ornithine aminotransferase; structural genomics, c 100.0
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 100.0
4adb_A406 Succinylornithine transaminase; transferase, PLP e 100.0
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 100.0
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 100.0
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 100.0
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 100.0
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 100.0
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 100.0
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 100.0
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 100.0
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 100.0
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 100.0
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 100.0
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 100.0
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 100.0
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 100.0
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 100.0
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 100.0
3l8a_A421 METC, putative aminotransferase, probable beta-cys 100.0
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 100.0
3aow_A448 Putative uncharacterized protein PH0207; protein-P 100.0
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 100.0
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 100.0
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.98
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.98
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.98
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.98
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.97
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.97
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.97
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.97
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.97
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.97
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.97
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.97
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.97
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.97
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.97
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.97
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.97
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.97
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.97
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.97
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.97
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.97
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.97
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.97
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.97
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.97
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.97
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.97
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.97
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.97
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.97
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.97
3ele_A398 Amino transferase; RER070207001803, structural gen 99.97
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.97
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.97
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.97
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.97
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.97
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.97
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.97
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.97
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.97
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.97
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.97
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.97
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.97
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.97
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.97
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.97
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.96
3rq1_A418 Aminotransferase class I and II; structural genomi 99.96
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.96
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.96
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.96
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.96
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.96
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.96
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.96
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.96
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.96
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.96
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.96
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.96
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.96
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.96
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.96
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.96
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.92
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.96
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.96
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.96
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.95
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.95
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.95
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.95
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.95
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.95
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.95
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.95
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.95
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.95
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.95
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.95
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.95
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.95
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.95
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.95
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.95
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.95
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.95
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.95
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.94
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.94
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.94
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.94
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.94
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.94
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.94
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.94
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.94
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.94
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.94
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.94
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.94
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.94
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.93
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.93
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.93
1svv_A359 Threonine aldolase; structural genomics, structura 99.93
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.93
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.93
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.93
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.93
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.93
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.93
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.93
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.93
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.93
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.93
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.93
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.93
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.93
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.92
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.92
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.92
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.92
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.92
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.92
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.92
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.92
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.92
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.92
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.92
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.92
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.92
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.92
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.92
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.91
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.91
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.91
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.91
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.91
2fnu_A375 Aminotransferase; protein-product complex, structu 99.91
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.91
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.91
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.91
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.9
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.9
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.9
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.9
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.9
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.9
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.9
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.89
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.89
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.89
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.89
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.89
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.89
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.88
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.88
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.88
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.88
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.88
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.87
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.87
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.87
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.86
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.85
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.85
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.84
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.84
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.84
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.84
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.83
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.83
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.83
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.82
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.82
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.81
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.8
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.79
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.78
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.78
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.77
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.74
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.74
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.73
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.67
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.66
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.63
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.42
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
Probab=100.00  E-value=2.3e-47  Score=362.21  Aligned_cols=336  Identities=30%  Similarity=0.537  Sum_probs=289.6

Q ss_pred             hHHHHHHHhccccCcC-CCCCcHHHHHHHHhccc---CCCeEEecCChHHHHHHHHHHHHHcccccccCCCCccEEEEec
Q 017259            2 KALQEQAEKLTLSSRA-FYNDKFPVFAERLTSMF---GYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCC   77 (374)
Q Consensus         2 ~a~~~~~~~~~~~~~~-~~~~~~~~l~~~l~~~~---~~~~~~~~~~gs~a~~~al~~~~~~~~~~~G~~~~~~~vi~~~   77 (374)
                      +|+.++++++.+.... .+.+...+++++|++..   +.++++|++|||+|++.|+++++.+.        +|++|+.++
T Consensus        87 ~Ai~~q~~~~~~~~~~~~~~~~~~~lae~L~~~~p~~~~~~v~f~~sGsEA~e~AlklAr~~t--------~r~~ii~~~  158 (456)
T 4atq_A           87 AAVQEAAAHFTHTCFMVTPYEGYVAVTEQLNRLTPGDHAKRTVLFNSGAEAVENAVKVARLAT--------GRDAVVAFD  158 (456)
T ss_dssp             HHHHHHHHHCSCCTTTTSCCHHHHHHHHHHHHHSSCSSCEEEEEESSHHHHHHHHHHHHHHHH--------CCCEEEEET
T ss_pred             HHHHHHHhhccCcccCccCcHHHHHHHHHHHHhCCCCCCcEEEEeCChHHHHHHHHHHHhhhh--------cCCeEEEEe
Confidence            6889999998886654 44667788999999987   35689999999999999999998764        348999999


Q ss_pred             cCCCCcccccccccCCcc-ccccCCCCCCCceeccCC-----------CHHHHHHHHH---h--cCCcEEEEEEccccCC
Q 017259           78 GCFHGRTLAAISMSCDNE-AIRGFGPLLPGHLKVDFG-----------DITALEKIFK---E--SGDQIAGFLFEPIQGE  140 (374)
Q Consensus        78 ~~yhg~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~-----------d~~~le~~l~---~--~~~~~~~vi~~~~~~~  140 (374)
                      ++|||.+..+.++++... ++..+.|...++..+|++           +.+.+++.++   +  .++++++|++||+++.
T Consensus       159 ~~yHG~t~~als~t~~~~~~~~~~~p~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~iAAvivEPiqg~  238 (456)
T 4atq_A          159 HAYHGRTNLTMALTAKAMPYKTNFGPFAPEVYRMPMSYPFREENPEITGAEAAKRAITMIEKQIGGDQVAAIIIEPIQGE  238 (456)
T ss_dssp             TCCCCSSHHHHHHCCCCTTTTTTSCSCCSSEEEECCCCGGGCSSTTCCHHHHHHHHHHHHHHHTCGGGEEEEEECSSBTT
T ss_pred             cccCCccccccccccCccccccCCCCccccceecccccccccCCCcccHHHHHHHHHHHHHHhhcCCceEEEEeccccCC
Confidence            999999999888877643 455666766666666653           2333333332   1  3468999999999999


Q ss_pred             CCcccCChhHHHHHHHHHHhcCCEEEEeccccCCcccccCcccccCCCCCcEEEecccccCCccchhhheeCHHHHhhcC
Q 017259          141 AGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQ  220 (374)
Q Consensus       141 ~g~~~~~~~~l~~l~~l~~~~~i~li~Dea~~~~~~~g~~~~~~~~~~~~d~~s~sK~~~~G~~~~G~~~~~~~~~~~~~  220 (374)
                      +|.+.++++++++|.++|++||+++|+||+++||+|+|..|+++++++.||+++++|+++||+ |+|.+++++++++.+.
T Consensus       239 gG~~~p~~~fl~~lr~lc~~~gillI~DEV~tG~GRtG~~~a~e~~gv~PDivt~gK~lggg~-P~~av~~~~~i~~~~~  317 (456)
T 4atq_A          239 GGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFCRTGEWFAVDHEGVVPDIITMAKGIAGGL-PLSAITGRADLLDAVH  317 (456)
T ss_dssp             TTCBCCCTTHHHHHHHHHHHHTCEEEEECTTTTTTTTSSSSGGGGTTCCCSEEEECGGGGTTS-SCEEEEEEHHHHTTSC
T ss_pred             CCccccchhhhHHHHHHHhhcCCceEecccccccCCccccccccccCCCCchhhhhhcccCcC-CceeeEecHHHHhccc
Confidence            999999999999999999999999999999999999999999999999999999999999998 9999999999999999


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHHHHHhCC----CceeeEEEEeeeEEEEeccCCC-
Q 017259          221 PGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFP----NYVKEVRGRGLFNAVEFDKTAL-  295 (374)
Q Consensus       221 ~~~~~~~~~~~~~~~~aa~~al~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~----~~~~~~~~~g~~~~~~~~~~~~-  295 (374)
                      +..+++||+++++++++++++|+.++++++.++.++..+++.+.|+++..+++    +++.++++.|.++.+++.++.. 
T Consensus       318 ~~~~~~Tf~gnpla~aaala~L~~i~~~~l~~~~~~~g~~l~~~L~~l~~~~~~~~~~~v~~VRG~Gl~~giel~~~~~~  397 (456)
T 4atq_A          318 PGGLGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAAELSAGGGSVVGDIRGRGAMLAIELVQPGSK  397 (456)
T ss_dssp             TTSSCCSSSSCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHCC-----CEEEEEEETTEEEEEEBCTTSC
T ss_pred             ccCCCCCCCCChHHHHhhHHHHHHHhhccHHHHHHHHHHHHHHHHHHHHHhcccccCCceEEeeecceEEEEEEecCCCC
Confidence            98899999999999999999999999999999999999999999999987753    4678899999999999854321 


Q ss_pred             ---chhHHHHHHHHHHCCeEeccCC--CCEEEEecCCCCCHHHHHHHHHHHHHHHh
Q 017259          296 ---PVSAYDICLKMKERGILAKPTH--DTIVRLTPPLSISSNELQEGSKALHDVLE  346 (374)
Q Consensus       296 ---~~~~~~~~~~l~~~Gi~v~~~~--~~~lRi~~~~~~~~e~i~~~~~~l~~~~~  346 (374)
                         ......+.+.|+++|+++.+++  ++.||+.|+++.|++++++++++|+++++
T Consensus       398 ~~~~~~~~~v~~~~~~~Gvl~~~~g~~~~~irl~PpL~it~~~id~~l~~l~~al~  453 (456)
T 4atq_A          398 EPNAELTKAVAAACLKEGVIILTCGTYGNVIRLLPPLVISDELLIDGLEVLAAAIK  453 (456)
T ss_dssp             CBCHHHHHHHHHHHHHTTEECEEECTTSCEEEECCCTTCCHHHHHHHHHHHHHHHH
T ss_pred             CcCHHHHHHHHHHHHHCCCEEEecCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Confidence               2346689999999999998753  58999999999999999999999999987



>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 374
d2byla1404 c.67.1.4 (A:36-439) Ornithine aminotransferase {Hu 1e-93
d1z7da1404 c.67.1.4 (A:7-410) Ornithine aminotransferase {Pla 3e-90
d1vefa1387 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine a 2e-78
d1sffa_425 c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA 4e-64
d2gsaa_427 c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase 1e-55
d1s0aa_429 c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxonona 8e-51
d1zoda1431 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {P 2e-44
d1ohwa_461 c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA 1e-39
d2v1pa1467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 3e-27
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 7e-25
d1m6sa_343 c.67.1.1 (A:) Low-specificity threonine aldolase { 3e-19
d1v72a1345 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps 3e-09
d1c7ga_456 c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbi 5e-09
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 4e-07
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 404 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Ornithine aminotransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  283 bits (726), Expect = 1e-93
 Identities = 174/345 (50%), Positives = 235/345 (68%), Gaps = 6/345 (1%)

Query: 1   MKALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWG 60
           + AL+ Q +KLTL+SRAFYN+    + E +T +F Y  VLPMNTG E  ETA KLARKWG
Sbjct: 63  VNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWG 122

Query: 61  YVKKKFSIDEAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEK 120
           Y  K     +A IV   G F GRTL+AIS S D  +  GFGP +PG   + + D+ ALE+
Sbjct: 123 YTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALER 182

Query: 121 IFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRM 180
             ++    +A F+ EPIQGEAGV++P  GYL  VR+LC+++ +L IADEIQ+GLAR+GR 
Sbjct: 183 ALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRW 240

Query: 181 LASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIA 240
           LA D+E VRPD+V+LGKAL GG+ PVSAVL D ++ML I+PGEH ST+GGNPL   VAIA
Sbjct: 241 LAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHFSTYGGNPLGCRVAIA 300

Query: 241 SLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAY 300
           +L+V+ +E LAE +  LG  LR  L K+     + V  VRG+GL NA+   +T     A+
Sbjct: 301 ALEVLEEENLAENADKLGIILRNELMKLPS---DVVTAVRGKGLLNAIVIKETK-DWDAW 356

Query: 301 DICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVL 345
            +CL++++ G+LAKPTH  I+R  PPL I  +EL+E  + ++  +
Sbjct: 357 KVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI 401


>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 404 Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Length = 425 Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Length = 427 Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Length = 429 Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Length = 431 Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Length = 461 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Length = 343 Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Length = 456 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 100.0
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 100.0
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 100.0
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 100.0
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 100.0
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 100.0
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 100.0
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.97
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.97
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.97
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.96
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.96
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.96
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.96
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.96
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.96
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.96
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.96
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.96
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.95
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.95
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.95
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.95
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.95
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.95
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.95
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.95
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.94
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.94
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.93
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.93
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.92
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.91
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.9
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.89
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.88
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.88
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.88
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.88
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.88
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.88
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.87
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.87
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.86
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.86
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.86
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.85
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.85
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.84
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.84
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.84
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.83
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.82
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.81
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.8
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.8
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.8
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.79
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.79
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.79
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.79
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.79
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.78
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.78
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.76
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.75
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.75
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.75
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.73
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.71
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.69
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.68
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.65
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.64
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.63
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.61
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.51
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.5
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.49
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.42
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.42
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.36
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 99.32
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.27
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 99.21
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 80.65
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Ornithine aminotransferase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.2e-48  Score=359.10  Aligned_cols=339  Identities=51%  Similarity=0.881  Sum_probs=307.3

Q ss_pred             hHHHHHHHhccccCcCCCCCcHHHHHHHHhcccCCCeEEecCChHHHHHHHHHHHHHcccccccCCCCccEEEEeccCCC
Q 017259            2 KALQEQAEKLTLSSRAFYNDKFPVFAERLTSMFGYDMVLPMNTGAEGVETALKLARKWGYVKKKFSIDEAIIVSCCGCFH   81 (374)
Q Consensus         2 ~a~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~gs~a~~~al~~~~~~~~~~~G~~~~~~~vi~~~~~yh   81 (374)
                      +|++++++++.+....+.++...++++.+++..+.+++++++||++|++.|+++++.+.+..++...++.+++.+.++||
T Consensus        64 ~Av~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~sGseA~e~Aik~ar~~~~~~~~~~~~~~~i~~~~~~~h  143 (404)
T d2byla1          64 NALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFW  143 (404)
T ss_dssp             HHHHHHHTTCCCCCTTEEESSHHHHHHHHHHHHTCSEEEEESSHHHHHHHHHHHHHHHHHHTTCCCTTCCEEEEETTCCC
T ss_pred             HHHHHHHhhCCCcccccccchHHHHHHhhhhcccccccccccCccccchhHHHHHHHHhhhccccccccccccccCCCcc
Confidence            68899999888777666678888899999998899999999999999999999999876555544555689999999999


Q ss_pred             CcccccccccCCccccccCCCCCCCceeccCCCHHHHHHHHHhcCCcEEEEEEccccCCCCcccCChhHHHHHHHHHHhc
Q 017259           82 GRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKY  161 (374)
Q Consensus        82 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~le~~l~~~~~~~~~vi~~~~~~~~g~~~~~~~~l~~l~~l~~~~  161 (374)
                      |.+..+.+.++.+..+..+.|...++..+|++|++++++.+..  ++++++++||+++++|.+.++++++++|.++|++|
T Consensus       144 g~t~~~~~~~~~~~~~~~~~p~~~~~~~~p~~d~~~l~~~l~~--~~iAaviiEPi~g~~G~~~~~~~~l~~l~~lc~~~  221 (404)
T d2byla1         144 GRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRH  221 (404)
T ss_dssp             CCSHHHHTTCCCHHHHTTSCSCCTTEEEECTTCHHHHHHHHTS--TTEEEEEECSSBTTTTSBCCCTTHHHHHHHHHHHH
T ss_pred             ccccceeccCCCcccccCCCCCCCCeeEecccCHHHHHHhcCC--CCeEEEEECCccCCCCCccCCHHHHHHHHHHHHhc
Confidence            9999999999999999999999888999999999999999974  58999999999999999999999999999999999


Q ss_pred             CCEEEEeccccCCcccccCcccccCCCCCcEEEecccccCCccchhhheeCHHHHhhcCCCCCCCCCCCCHHHHHHHHHH
Q 017259          162 NILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIAS  241 (374)
Q Consensus       162 ~i~li~Dea~~~~~~~g~~~~~~~~~~~~d~~s~sK~~~~G~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~aa~~a  241 (374)
                      |+++|+||+++||+|+|..++++.+++.||+++++|+++||++|+|.++.++++++.+.+..+++||++++++++++.++
T Consensus       222 g~llI~DEV~tGfgR~G~~~a~~~~gv~PDi~~~gK~l~gG~~p~~av~~~~~i~~~~~~~~~~~T~~gnpl~~aaa~a~  301 (404)
T d2byla1         222 QVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHFSTYGGNPLGCRVAIAA  301 (404)
T ss_dssp             TCEEEEECTTTTTTTTSSSSGGGGGTCCCSEEEECGGGGTTSSCCEEEEECHHHHTTSCTTSSCCSSTTCHHHHHHHHHH
T ss_pred             CeEEEeeccccccccccccchhhhcCCCCCEEEECchhhCCCccceeeeechhhhhccCCCCCCcCCCcCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999998549999999999999999988999999999999999999


Q ss_pred             HHHHhhhcHHHHHHHHHHHHHHHHHHHHHhCCCceeeEEEEeeeEEEEeccCCCchhHHHHHHHHHHCCeEeccCCCCEE
Q 017259          242 LDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIV  321 (374)
Q Consensus       242 l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~l~~~Gi~v~~~~~~~l  321 (374)
                      |+.++++++.++.++..+++.+.|+++..   +.+..+++.|.+..+.+.+... ....++.+.|+++|+++.+.+++.+
T Consensus       302 L~~i~~~~l~~~~~~~g~~l~~~l~~l~~---~~i~~vRg~Gl~~~i~~~~~~~-~~~~~~~~~l~~~Gvl~~~~~~~~i  377 (404)
T d2byla1         302 LEVLEEENLAENADKLGIILRNELMKLPS---DVVTAVRGKGLLNAIVIKETKD-WDAWKVCLRLRDNGLLAKPTHGDII  377 (404)
T ss_dssp             HHHHHHTTHHHHHHHHHHHHHHHHHTSCT---TTEEEEEEETTEEEEEECCCSS-CCHHHHHHHHHHTTEECEEEETTEE
T ss_pred             HHHHHhcCchhhhhHhhHHHHHHHHhhcc---ccceeeeecccEEEEEEecCCc-hhHHHHHHHHHhCCeEEecCCCCEE
Confidence            99999999999999999999999988742   4677889999999998854321 2567899999999999998778999


Q ss_pred             EEecCCCCCHHHHHHHHHHHHHHHh
Q 017259          322 RLTPPLSISSNELQEGSKALHDVLE  346 (374)
Q Consensus       322 Ri~~~~~~~~e~i~~~~~~l~~~~~  346 (374)
                      |++|+++.|++|+++++++|+++++
T Consensus       378 ~l~PpL~it~~~id~~~~~l~~al~  402 (404)
T d2byla1         378 RFAPPLVIKEDELRESIEIINKTIL  402 (404)
T ss_dssp             EECCCTTCCHHHHHHHHHHHHHHHH
T ss_pred             EEECCcCCCHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999987



>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure