Citrus Sinensis ID: 017279


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370----
MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSIPHPAH
cccccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHcccccccccccccccccccccccEEcccccccccHHHHHHHHHHcccccccccccEEEEcccccccHHHHHHHHHHcccccccccccc
ccccccccccccHHHHHHHcccccccccccccccccccccccHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEcHHHHHHccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHccccccEEEccccccccccccccEEEccccccccHHHHHHHHHHccccHHcccccEEEccccHHHHHHHHHHHHHHHHHHHccccccc
mvgeatnlssedLNLCFEKMMMAgagadraggvkmdgvvitewkDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTlvlrqdkpqledNAVEAIANschdlqdldlsksfklsdrSLYALAhgcpnltrlnisgctsfsDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNqlqslnlgwcedvgdvgvmnlaygcpdlrsldlcgcvcitdDSVIALangcphlrslGLYYCRNITDRAIYSLAQsgvknkpgiwesmkgrydeeglqslnisqctaltppavqalcdtfpalhtcsgrhslvmsgclnltsvhcvcagqshrtassiphpah
mvgeatnlsseDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLaqsgvknkpgIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQshrtassiphpah
MVGEATNLSSEDLNLCFEKmmmagagadraggVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSIPHPAH
************LNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAG**************
*************************************VVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSIPH***
********SSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQ*************
**********************************M*GVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSI*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSIPHPAH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query374 2.2.26 [Sep-21-2011]
Q9LPL4360 F-box protein SKP2A OS=Ar yes no 0.954 0.991 0.749 1e-163
O49286360 F-box protein SKP2B OS=Ar no no 0.959 0.997 0.738 1e-160
A6H779 423 F-box/LRR-repeat protein yes no 0.668 0.591 0.303 1e-24
Q96IG2 436 F-box/LRR-repeat protein no no 0.703 0.603 0.288 3e-23
Q58DG6 436 F-box/LRR-repeat protein no no 0.703 0.603 0.288 3e-23
Q9QZH7276 F-box/LRR-repeat protein no no 0.668 0.905 0.286 7e-23
Q9UKC9423 F-box/LRR-repeat protein no no 0.711 0.628 0.294 7e-23
Q5R3Z8423 F-box/LRR-repeat protein yes no 0.711 0.628 0.294 9e-23
Q9CZV8 436 F-box/LRR-repeat protein yes no 0.703 0.603 0.285 1e-22
Q8BH16423 F-box/LRR-repeat protein no no 0.679 0.600 0.292 1e-22
>sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 Back     alignment and function desciption
 Score =  575 bits (1482), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/375 (74%), Positives = 321/375 (85%), Gaps = 18/375 (4%)

Query: 1   MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDE 60
           M GEA    S +L+ CF+KM             KM+G+ I EWKDIP+ELL+RILSLVD+
Sbjct: 3   MGGEA----SMELDQCFQKM-------------KMEGISIKEWKDIPVELLMRILSLVDD 45

Query: 61  PTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLE 120
             VIVASGVC+GWRDAI  GLT L LSWC NNMN+LVLSL PK  KLQTL LRQDKPQLE
Sbjct: 46  RNVIVASGVCTGWRDAISFGLTRLRLSWCNNNMNSLVLSLVPKFVKLQTLNLRQDKPQLE 105

Query: 121 DNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLC 180
           DNAVEAIAN CH+LQ+LDLSKS K++DRSLYALAHGCP+LT+LN+SGCTSFSD A+AYL 
Sbjct: 106 DNAVEAIANHCHELQELDLSKSLKITDRSLYALAHGCPDLTKLNLSGCTSFSDTAIAYLT 165

Query: 181 GFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLR 240
            FCRKLK+LNLCGCVKA TD AL+AIG NCNQ+QSLNLGWCE++ D GVM+LAYGCPDLR
Sbjct: 166 RFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQMQSLNLGWCENISDDGVMSLAYGCPDLR 225

Query: 241 SLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESM- 299
           +LDLCGCV ITD+SV+ALA+ C HLRSLGLYYCRNITDRA+YSLAQSGVKNKPG W+S+ 
Sbjct: 226 TLDLCGCVLITDESVVALADWCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKPGSWKSVK 285

Query: 300 KGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCA 359
           KG+YDEEGL+SLNISQCTALTP AVQA+CD+FPALHTCSGRHSLVMSGCLNLT+VHC C 
Sbjct: 286 KGKYDEEGLRSLNISQCTALTPSAVQAVCDSFPALHTCSGRHSLVMSGCLNLTTVHCACI 345

Query: 360 GQSHRTASSIPHPAH 374
            Q+HR  +++PHPAH
Sbjct: 346 LQAHRAHNAVPHPAH 360




Component of SCF(SKP2A) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins (including cell cycle repressors). Acts as an auxin receptor. Regulates the stability of the transcription factors E2FC and DPB, repressors of cell proliferation. Confers increase tolerance to osmotic stress by promoting cell division, especially in meristems. Promotes the formation of lateral root primordia.
Arabidopsis thaliana (taxid: 3702)
>sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 Back     alignment and function description
>sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 Back     alignment and function description
>sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 Back     alignment and function description
>sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 Back     alignment and function description
>sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 Back     alignment and function description
>sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 Back     alignment and function description
>sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query374
255558466373 F-box/LRR-repeat protein, putative [Rici 0.997 1.0 0.839 1e-179
224082382363 predicted protein [Populus trichocarpa] 0.970 1.0 0.818 1e-174
224066761358 predicted protein [Populus trichocarpa] 0.914 0.955 0.850 1e-170
302142727428 unnamed protein product [Vitis vinifera] 0.983 0.859 0.775 1e-163
359492292370 PREDICTED: F-box protein SKP2B-like [Vit 0.983 0.994 0.775 1e-163
449453019376 PREDICTED: F-box protein SKP2A-like [Cuc 0.997 0.992 0.766 1e-163
18394987360 F-box protein SKP2A [Arabidopsis thalian 0.954 0.991 0.749 1e-161
21554029360 F-box protein AtFBL5 [Arabidopsis thalia 0.954 0.991 0.749 1e-161
312282179367 unnamed protein product [Thellungiella h 0.973 0.991 0.750 1e-160
217073061368 unknown [Medicago truncatula] 0.983 1.0 0.740 1e-159
>gi|255558466|ref|XP_002520258.1| F-box/LRR-repeat protein, putative [Ricinus communis] gi|223540477|gb|EEF42044.1| F-box/LRR-repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  632 bits (1630), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 314/374 (83%), Positives = 336/374 (89%), Gaps = 1/374 (0%)

Query: 1   MVGEATNLSSEDLNLCFEKMMMAGAGADRAGGVKMDGVVITEWKDIPMELLLRILSLVDE 60
           MVG    L SEDLN CFEK+MMAGA  +  G VKM+GVVITEWKDIPMELLLRI+SLVD+
Sbjct: 1   MVG-GGKLRSEDLNRCFEKLMMAGAAGNTEGRVKMEGVVITEWKDIPMELLLRIVSLVDD 59

Query: 61  PTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLE 120
            T+I+ASGVCSGWRDAICLGLTHL LSWCKN+MNNLVL LAPK TKL+TLVLRQDKPQLE
Sbjct: 60  RTIIMASGVCSGWRDAICLGLTHLCLSWCKNHMNNLVLWLAPKFTKLETLVLRQDKPQLE 119

Query: 121 DNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLC 180
           DNAVEAIA  CHDL+DLDLSKSFKL+D SLYALAHGCPNLT+LNISGCTSFSD  L YL 
Sbjct: 120 DNAVEAIARYCHDLEDLDLSKSFKLTDCSLYALAHGCPNLTKLNISGCTSFSDGGLEYLT 179

Query: 181 GFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLR 240
           GFCRKLKILNLCGCVKAATD ALQAIGRNC+QLQSLNLGWCE+VGDVGVM+LAYGCPDLR
Sbjct: 180 GFCRKLKILNLCGCVKAATDRALQAIGRNCSQLQSLNLGWCENVGDVGVMSLAYGCPDLR 239

Query: 241 SLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMK 300
           +LDLCGCV ITDDSVIALA  C HLRSLGLYYCRNITDRA+YSL  S VKNKP +WES+K
Sbjct: 240 TLDLCGCVNITDDSVIALAYRCLHLRSLGLYYCRNITDRAMYSLVHSRVKNKPAMWESVK 299

Query: 301 GRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAG 360
           GR DEEGL+SLNISQCTALTPPAVQALCD FPALHTCSGRHSLVMSGCLNLTSVHC CA 
Sbjct: 300 GRCDEEGLRSLNISQCTALTPPAVQALCDCFPALHTCSGRHSLVMSGCLNLTSVHCACAV 359

Query: 361 QSHRTASSIPHPAH 374
           Q+HRT   IP+PAH
Sbjct: 360 QAHRTFRFIPNPAH 373




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224082382|ref|XP_002306672.1| predicted protein [Populus trichocarpa] gi|222856121|gb|EEE93668.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224066761|ref|XP_002302202.1| predicted protein [Populus trichocarpa] gi|222843928|gb|EEE81475.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302142727|emb|CBI19930.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492292|ref|XP_002268441.2| PREDICTED: F-box protein SKP2B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449453019|ref|XP_004144256.1| PREDICTED: F-box protein SKP2A-like [Cucumis sativus] gi|449517068|ref|XP_004165568.1| PREDICTED: F-box protein SKP2A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18394987|ref|NP_564139.1| F-box protein SKP2A [Arabidopsis thaliana] gi|75177240|sp|Q9LPL4.1|SKP2A_ARATH RecName: Full=F-box protein SKP2A; AltName: Full=FBL5-like protein; Short=AtFBL5; AltName: Full=SKP2-like protein 1; Short=AtSKP2;1 gi|9454572|gb|AAF87895.1|AC015447_5 Unknown protein [Arabidopsis thaliana] gi|16604366|gb|AAL24189.1| At1g21410/F24J8_17 [Arabidopsis thaliana] gi|19699206|gb|AAL90969.1| At1g21410/F24J8_17 [Arabidopsis thaliana] gi|332191979|gb|AEE30100.1| F-box protein SKP2A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21554029|gb|AAM63110.1| F-box protein AtFBL5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312282179|dbj|BAJ33955.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|217073061|gb|ACJ84890.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query374
TAIR|locus:2027082360 SKP2A [Arabidopsis thaliana (t 0.914 0.95 0.790 2e-152
TAIR|locus:2025222360 SKP2B "AT1G77000" [Arabidopsis 0.959 0.997 0.736 1e-148
UNIPROTKB|A6H779423 FBXL2 "F-box/LRR-repeat protei 0.548 0.484 0.371 5e-28
UNIPROTKB|F1PWK1422 FBXL2 "Uncharacterized protein 0.548 0.485 0.352 1.3e-27
UNIPROTKB|Q9UKC9423 FBXL2 "F-box/LRR-repeat protei 0.548 0.484 0.352 1.7e-27
UNIPROTKB|Q5R3Z8423 FBXL2 "F-box/LRR-repeat protei 0.548 0.484 0.352 1.7e-27
RGD|1562243422 Fbxl2 "F-box and leucine-rich 0.556 0.492 0.342 2.8e-27
UNIPROTKB|F1NHD2423 FBXL2 "Uncharacterized protein 0.556 0.491 0.342 9.4e-27
MGI|MGI:1919429423 Fbxl2 "F-box and leucine-rich 0.556 0.491 0.333 9.4e-27
TAIR|locus:2166978405 AT5G23340 [Arabidopsis thalian 0.716 0.661 0.303 1.5e-26
TAIR|locus:2027082 SKP2A [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1487 (528.5 bits), Expect = 2.0e-152, P = 2.0e-152
 Identities = 271/343 (79%), Positives = 309/343 (90%)

Query:    33 VKMDGVVITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNN 92
             +KM+G+ I EWKDIP+ELL+RILSLVD+  VIVASGVC+GWRDAI  GLT L LSWC NN
Sbjct:    18 MKMEGISIKEWKDIPVELLMRILSLVDDRNVIVASGVCTGWRDAISFGLTRLRLSWCNNN 77

Query:    93 MNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYA 152
             MN+LVLSL PK  KLQTL LRQDKPQLEDNAVEAIAN CH+LQ+LDLSKS K++DRSLYA
Sbjct:    78 MNSLVLSLVPKFVKLQTLNLRQDKPQLEDNAVEAIANHCHELQELDLSKSLKITDRSLYA 137

Query:   153 LAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQ 212
             LAHGCP+LT+LN+SGCTSFSD A+AYL  FCRKLK+LNLCGCVKA TD AL+AIG NCNQ
Sbjct:   138 LAHGCPDLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQ 197

Query:   213 LQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYY 272
             +QSLNLGWCE++ D GVM+LAYGCPDLR+LDLCGCV ITD+SV+ALA+ C HLRSLGLYY
Sbjct:   198 MQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLRSLGLYY 257

Query:   273 CRNITDRAIYSLAQSGVKNKPGIWESMK-GRYDEEGLQSLNISQCTALTPPAVQALCDTF 331
             CRNITDRA+YSLAQSGVKNKPG W+S+K G+YDEEGL+SLNISQCTALTP AVQA+CD+F
Sbjct:   258 CRNITDRAMYSLAQSGVKNKPGSWKSVKKGKYDEEGLRSLNISQCTALTPSAVQAVCDSF 317

Query:   332 PALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSIPHPAH 374
             PALHTCSGRHSLVMSGCLNLT+VHC C  Q+HR  +++PHPAH
Sbjct:   318 PALHTCSGRHSLVMSGCLNLTTVHCACILQAHRAHNAVPHPAH 360




GO:0005737 "cytoplasm" evidence=ISM
GO:0005515 "protein binding" evidence=IPI
GO:0019005 "SCF ubiquitin ligase complex" evidence=IDA;IPI
GO:0031146 "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process" evidence=IDA;IPI
GO:0005634 "nucleus" evidence=IDA
GO:0010311 "lateral root formation" evidence=IMP
GO:0051781 "positive regulation of cell division" evidence=IMP
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0071365 "cellular response to auxin stimulus" evidence=IDA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2025222 SKP2B "AT1G77000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LPL4SKP2A_ARATHNo assigned EC number0.74930.95450.9916yesno
O49286SKP2B_ARATHNo assigned EC number0.73860.95980.9972nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_V1038
hypothetical protein (364 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 7e-24
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 2e-11
smart0036726 smart00367, LRR_CC, Leucine-rich repeat - CC (cyst 2e-05
smart0036726 smart00367, LRR_CC, Leucine-rich repeat - CC (cyst 2e-04
pfam1293747 pfam12937, F-box-like, F-box-like 0.001
smart0036726 smart00367, LRR_CC, Leucine-rich repeat - CC (cyst 0.002
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
 Score = 98.2 bits (245), Expect = 7e-24
 Identities = 58/155 (37%), Positives = 79/155 (50%), Gaps = 6/155 (3%)

Query: 130 SCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKIL 189
           +C+ L+ L L  S  + D  L ALA  CPNL  L++  C + +D  +  L   C KL+ +
Sbjct: 50  NCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPKLQTI 109

Query: 190 NLCGCVK--AATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGC-PDLRSLDLCG 246
           NL         TD +L A+G+NC  LQ++    C DV D GV  LA GC   L  L L  
Sbjct: 110 NLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGC-DVTDKGVWELASGCSKSLERLSLNN 168

Query: 247 CVCITDDSVIAL--ANGCPHLRSLGLYYCRNITDR 279
           C  +TD S+ A+  +N  P+L  L    C  ITD 
Sbjct: 169 CRNLTDQSIPAILASNYFPNLSVLEFRGCPLITDF 203


Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
>gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 374
KOG4341483 consensus F-box protein containing LRR [General fu 99.96
KOG4341483 consensus F-box protein containing LRR [General fu 99.95
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.95
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.86
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.52
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.51
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.5
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.26
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.22
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.15
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.08
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.88
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.88
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.75
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.74
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.69
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.53
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.52
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.47
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.46
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.28
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.23
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.15
KOG3864221 consensus Uncharacterized conserved protein [Funct 98.05
KOG3864221 consensus Uncharacterized conserved protein [Funct 98.02
smart0025641 FBOX A Receptor for Ubiquitination Targets. 97.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.89
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.66
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.64
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.5
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.3
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.25
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.24
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.09
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 96.97
KOG4237 498 consensus Extracellular matrix protein slit, conta 96.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 96.9
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.9
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.89
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.69
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.64
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.51
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.47
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.36
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.24
KOG4308 478 consensus LRR-containing protein [Function unknown 95.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.75
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.74
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.67
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.58
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 95.57
KOG0617264 consensus Ras suppressor protein (contains leucine 95.45
PLN03150623 hypothetical protein; Provisional 95.3
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 95.22
KOG4308478 consensus LRR-containing protein [Function unknown 95.13
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.1
smart0025641 FBOX A Receptor for Ubiquitination Targets. 94.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 94.91
PLN03150623 hypothetical protein; Provisional 94.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 94.68
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 94.41
KOG2997366 consensus F-box protein FBX9 [General function pre 94.23
KOG0617264 consensus Ras suppressor protein (contains leucine 93.9
PRK15386 426 type III secretion protein GogB; Provisional 93.79
PRK15386 426 type III secretion protein GogB; Provisional 93.62
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.39
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.37
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.1
KOG0281499 consensus Beta-TrCP (transducin repeats containing 92.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 92.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 91.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 89.31
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 89.0
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 86.02
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 84.53
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 83.76
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
Probab=99.96  E-value=1.3e-30  Score=225.03  Aligned_cols=286  Identities=28%  Similarity=0.497  Sum_probs=219.2

Q ss_pred             CCCCHHHHHHHhcCCCccchhhhcccchhHHHhh------------------------------hccCceeecccccccc
Q 017279           44 KDIPMELLLRILSLVDEPTVIVASGVCSGWRDAI------------------------------CLGLTHLSLSWCKNNM   93 (374)
Q Consensus        44 ~~Lp~eil~~If~~L~~~~l~~~~~vc~~w~~~~------------------------------~~~l~~L~l~~~~~~~   93 (374)
                      ..||.|++.+||++|+.+.+++++++|+.|...+                              +..++.+.+.++....
T Consensus        73 ~~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG~r~v~  152 (483)
T KOG4341|consen   73 RSLPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRGCRAVG  152 (483)
T ss_pred             ccCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhccccccccccccccCC
Confidence            3455555555555555555555555555555433                              2347888888888888


Q ss_pred             hHHHHHHhhcCCCCcEEEeeCCCCCCChHHHHHHHHhCCCCCEEecCCCCCCCHHHHHHHHhcCCCCcEEeecCCCCCCH
Q 017279           94 NNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSD  173 (374)
Q Consensus        94 ~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~  173 (374)
                      ...+..+...||++++|++. .+..+++..+..+.++|++|++|++-.|..+++..++.++..|++|++|++++|+.++.
T Consensus       153 ~sslrt~~~~CpnIehL~l~-gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi~~  231 (483)
T KOG4341|consen  153 DSSLRTFASNCPNIEHLALY-GCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQISG  231 (483)
T ss_pred             cchhhHHhhhCCchhhhhhh-cceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchhhc
Confidence            88888888999999999998 88899999999999999999999999988999999999999999999999999998888


Q ss_pred             HHHHHHHhcCCCCcEEEcCCCccCccHHHHHHHHhcCCCCCEEeccCCCCCCHHHHHHHHhcCCCCCeeecCCCCCCCHH
Q 017279          174 HALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDD  253 (374)
Q Consensus       174 ~~~~~l~~~~~~L~~L~L~~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~l~~~  253 (374)
                      .++..+...+..++.+.+.+|.. ...+.+..+...++.+-++++..|..++|+++..+..+|..|+.|..++|..+++.
T Consensus       232 ~gv~~~~rG~~~l~~~~~kGC~e-~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~~d~  310 (483)
T KOG4341|consen  232 NGVQALQRGCKELEKLSLKGCLE-LELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTDITDE  310 (483)
T ss_pred             CcchHHhccchhhhhhhhccccc-ccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCCCchH
Confidence            88888887888888888888875 67777777887888888888888888888888888888888888988888888888


Q ss_pred             HHHHHHhcCCCCceEecCCCCCCCHHHHHHHHhcCCCCCCccccccccccCCCCCcEEecCCCCCCCHHHHHHHHhhCCC
Q 017279          254 SVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPA  333 (374)
Q Consensus       254 ~l~~l~~~~~~L~~L~l~~~~~i~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~l~~l~~~~~~  333 (374)
                      .+..+.+++++|+.|-++.|.++++.++..++..+                 +.|+.+++-+|..+++..+..+.     
T Consensus       311 ~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~-----------------~~Le~l~~e~~~~~~d~tL~sls-----  368 (483)
T KOG4341|consen  311 VLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNC-----------------PHLERLDLEECGLITDGTLASLS-----  368 (483)
T ss_pred             HHHHHhcCCCceEEEeccccchhhhhhhhhhhcCC-----------------hhhhhhcccccceehhhhHhhhc-----
Confidence            88888888888999999888888888888888776                 44555555444444444333333     


Q ss_pred             ccCCCCCceEEecCCcccccc
Q 017279          334 LHTCSGRHSLVMSGCLNLTSV  354 (374)
Q Consensus       334 l~~~~~L~~L~ls~C~~l~~~  354 (374)
                       .+||.||+|.++.|..+|.+
T Consensus       369 -~~C~~lr~lslshce~itD~  388 (483)
T KOG4341|consen  369 -RNCPRLRVLSLSHCELITDE  388 (483)
T ss_pred             -cCCchhccCChhhhhhhhhh
Confidence             34444455555555555444



>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
1fs2_A272 Insights Into Scf Ubiquitin Ligases From The Struct 2e-14
1fqv_A336 Insights Into Scf Ubiquitin Ligases From The Struct 1e-13
2p1m_B 594 Tir1-ask1 Complex Structure Length = 594 2e-08
3ogk_B592 Structure Of Coi1-Ask1 In Complex With Coronatine A 1e-07
>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272 Back     alignment and structure

Iteration: 1

Score = 76.3 bits (186), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 68/245 (27%), Positives = 103/245 (42%), Gaps = 22/245 (8%) Query: 43 WKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMNNLVLSLAP 102 W +P ELLL I S + P ++ SGVC W SL Sbjct: 9 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDE------------------SLWQ 50 Query: 103 KLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTR 162 L + + + +E + + I + C LQ+L L + +LSD + LA NL R Sbjct: 51 TLDEFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSL-EGLRLSDPIVNTLAKN-SNLVR 108 Query: 163 LNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNL-GWC 221 LN+SGC+ FS+ AL L C +L LNL C + A+ + LNL G+ Sbjct: 109 LNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYR 168 Query: 222 EDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAI 281 +++ + L CP+L LDL V + +D +L+ L L C +I + Sbjct: 169 KNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-LNYLQHLSLSRCYDIIPETL 227 Query: 282 YSLAQ 286 L + Sbjct: 228 LELGE 232
>pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336 Back     alignment and structure
>pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 Back     alignment and structure
>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-40
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-49
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-41
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-22
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-44
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-40
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-32
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 6e-16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-10
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-15
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-14
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-13
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-12
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-10
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 7e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-04
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-04
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
 Score =  187 bits (477), Expect = 8e-57
 Identities = 77/335 (22%), Positives = 124/335 (37%), Gaps = 54/335 (16%)

Query: 41  TEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAICLGLTHLSLSWCKNNMN------ 94
             W  +P ELLL I S +  P ++  SGVC  W           +L     N++      
Sbjct: 7   VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGR 66

Query: 95  --------------NLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLS 140
                          +   LA   +  +   +      +E + +  I + C  LQ+L L 
Sbjct: 67  LLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLE 126

Query: 141 KSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATD 200
              +LSD  +  LA    NL RLN+SGC+ FS+ AL  L   C +L  LNL  C      
Sbjct: 127 -GLRLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEK 184

Query: 201 YALQAIGRNCNQLQSLNL-GWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALA 259
           +   A+      +  LNL G+ +++    +  L   CP+L  LDL   V + +D      
Sbjct: 185 HVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF 244

Query: 260 NGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTAL 319
               +L+ L L  C +I    +  L +                     L++L +     +
Sbjct: 245 Q-LNYLQHLSLSRCYDIIPETLLELGEI------------------PTLKTLQVFGI--V 283

Query: 320 TPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSV 354
               +Q L +  P L             C + T++
Sbjct: 284 PDGTLQLLKEALPHLQIN----------CSHFTTI 308


>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.97
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.94
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.72
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.6
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.55
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.44
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.42
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.39
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.39
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.35
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.17
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.15
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.1
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.08
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.02
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.02
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.01
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.01
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.0
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.99
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.99
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.98
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.95
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.93
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.92
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.91
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.91
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.9
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.88
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.88
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.87
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.82
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.78
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.78
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.77
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.75
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.73
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.7
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.69
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.69
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.65
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.62
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.55
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.46
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.45
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.34
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.32
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.26
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.25
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.19
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.15
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.1
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.03
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.02
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.94
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.94
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.93
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.92
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.9
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.82
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.61
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.49
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.45
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.44
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.41
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.37
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.34
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.31
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 97.29
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.18
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.09
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 97.07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.02
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.79
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.78
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.63
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.61
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 95.11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 95.01
4fdw_A401 Leucine rich hypothetical protein; putative cell s 94.68
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 93.95
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 91.78
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 90.91
4fdw_A401 Leucine rich hypothetical protein; putative cell s 90.84
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 90.77
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 84.74
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.97  E-value=4.4e-30  Score=231.67  Aligned_cols=281  Identities=25%  Similarity=0.371  Sum_probs=189.9

Q ss_pred             cCCccCCCCHHHHHHHhcCCCccchhhhcccchhHHHhhh--ccCceeecccccccchHHHHHHhhcCCCCcEEEeeCCC
Q 017279           39 VITEWKDIPMELLLRILSLVDEPTVIVASGVCSGWRDAIC--LGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDK  116 (374)
Q Consensus        39 ~~~~~~~Lp~eil~~If~~L~~~~l~~~~~vc~~w~~~~~--~~l~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  116 (374)
                      ....|.+||+|++.+||+|++..++.+++.|||+|+.++.  ..++.++++...... ..+..+.  .++++.++++  .
T Consensus         5 ~~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~-~~~~~~~--~~~l~~L~l~--~   79 (336)
T 2ast_B            5 PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHP-DVTGRLL--SQGVIAFRCP--R   79 (336)
T ss_dssp             --CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCCH-HHHHHHH--HTTCSEEECT--T
T ss_pred             ccCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCCH-HHHHhhh--hccceEEEcC--C
Confidence            3568999999999999999999999999999999999875  338899998765442 2222211  1577777777  3


Q ss_pred             CCCChHHHHHHHHhCCCCCEEecCCCCCCCHHHHHHHHhcCCCCcEEeecCCCCCCHHHHHHHHhcCCCCcEEEcCCCcc
Q 017279          117 PQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVK  196 (374)
Q Consensus       117 ~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~~~~l~~~~~~L~~L~L~~~~~  196 (374)
                      +.+...... + ..+++|++|+++++ .+++..+..+...+++|++|++++| .+++.....+. .+++|++|+++++..
T Consensus        80 n~l~~~~~~-~-~~~~~L~~L~L~~~-~l~~~~~~~~~~~~~~L~~L~L~~~-~l~~~~~~~l~-~~~~L~~L~L~~~~~  154 (336)
T 2ast_B           80 SFMDQPLAE-H-FSPFRVQHMDLSNS-VIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLA-KNSNLVRLNLSGCSG  154 (336)
T ss_dssp             CEECSCCCS-C-CCCBCCCEEECTTC-EECHHHHHHHHTTBCCCSEEECTTC-BCCHHHHHHHT-TCTTCSEEECTTCBS
T ss_pred             ccccccchh-h-ccCCCCCEEEccCC-CcCHHHHHHHHhhCCCCCEEeCcCc-ccCHHHHHHHh-cCCCCCEEECCCCCC
Confidence            322221111 1 13677888888876 4666656666666788888888775 56655554443 478888888887633


Q ss_pred             CccHHHHHHHHhcCCCCCEEeccCCCCCCHHHHHHHHhcCC-CCCeeecCCCC-CCCHHHHHHHHhcCCCCceEecCCCC
Q 017279          197 AATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCP-DLRSLDLCGCV-CITDDSVIALANGCPHLRSLGLYYCR  274 (374)
Q Consensus       197 ~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~-~L~~L~l~~~~-~l~~~~l~~l~~~~~~L~~L~l~~~~  274 (374)
                       +++..+..+...+++|++|+++++..+++..+......++ +|++|++++|. .+++..+......+++|+.|++++|.
T Consensus       155 -l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~  233 (336)
T 2ast_B          155 -FSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSV  233 (336)
T ss_dssp             -CCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCT
T ss_pred             -CCHHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCC
Confidence             5666666666677888888887764577766666666777 88888888765 57766666666667888888888776


Q ss_pred             CCCHHHHHHHHhcCCCCCCccccccccccCCCCCcEEecCCCCCCCHHHHHHHHhhCCCccCCCCCceEEecCCcccccc
Q 017279          275 NITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSV  354 (374)
Q Consensus       275 ~i~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~l~~l~~~~~~l~~~~~L~~L~ls~C~~l~~~  354 (374)
                      .+++..+..+..                  +++|++|++++|..+++..+..       +..+++|+.|++++|  +++.
T Consensus       234 ~l~~~~~~~l~~------------------l~~L~~L~l~~~~~~~~~~~~~-------l~~~~~L~~L~l~~~--i~~~  286 (336)
T 2ast_B          234 MLKNDCFQEFFQ------------------LNYLQHLSLSRCYDIIPETLLE-------LGEIPTLKTLQVFGI--VPDG  286 (336)
T ss_dssp             TCCGGGGGGGGG------------------CTTCCEEECTTCTTCCGGGGGG-------GGGCTTCCEEECTTS--SCTT
T ss_pred             cCCHHHHHHHhC------------------CCCCCEeeCCCCCCCCHHHHHH-------HhcCCCCCEEeccCc--cCHH
Confidence            566555554433                  3677777777766666544322       245677777777777  5554


Q ss_pred             cce
Q 017279          355 HCV  357 (374)
Q Consensus       355 ~~~  357 (374)
                      .+.
T Consensus       287 ~~~  289 (336)
T 2ast_B          287 TLQ  289 (336)
T ss_dssp             CHH
T ss_pred             HHH
Confidence            443



>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 374
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.5 bits (145), Expect = 6e-11
 Identities = 49/211 (23%), Positives = 85/211 (40%), Gaps = 9/211 (4%)

Query: 78  CLGLTHLSLSWCKNNMNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDL 137
              + H+ LS     ++ L   +  + +KLQ   L  +  +L D  V  +A + + L  L
Sbjct: 45  PFRVQHMDLSNSVIEVSTL-HGILSQCSKLQN--LSLEGLRLSDPIVNTLAKNSN-LVRL 100

Query: 138 DLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFS-DHALAYLCGFCRKLKILNLCGCVK 196
           +LS     S+ +L  L   C  L  LN+S C  F+  H    +      +  LNL G  K
Sbjct: 101 NLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRK 160

Query: 197 AATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVI 256
                 L  + R C  L  L+L     + +            L+ L L  C  I  ++++
Sbjct: 161 NLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-LNYLQHLSLSRCYDIIPETLL 219

Query: 257 ALANGCPHLRSLGLYYCRNITDRAIYSLAQS 287
            L    P L++L ++    + D  +  L ++
Sbjct: 220 ELGE-IPTLKTLQVFGI--VPDGTLQLLKEA 247


>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.91
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.9
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.44
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.91
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.88
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.67
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.52
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.5
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.46
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.42
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.39
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.36
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.32
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.23
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.2
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.17
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.13
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.12
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.87
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.84
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.82
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.68
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.51
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.25
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.24
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.89
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.87
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.53
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 96.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.16
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.75
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 95.38
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 95.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 93.82
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 93.33
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=1.4e-23  Score=182.08  Aligned_cols=215  Identities=27%  Similarity=0.449  Sum_probs=172.3

Q ss_pred             CCCCcEEEeeCCCCCCChHHHHHHHHhCCCCCEEecCCCCCCCHHHHHHHHhcCCCCcEEeecCCCCCCHHHHHHHHhcC
Q 017279          104 LTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFC  183 (374)
Q Consensus       104 ~~~L~~L~l~~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~~~~l~~~~  183 (374)
                      ..+|++|+++  ...+++..+..+...|++|++|++.++ .+++..+..+.+ +++|++|++++|..+++.++..+...+
T Consensus        45 ~~~L~~LdLs--~~~i~~~~l~~l~~~c~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~~l~~~~  120 (284)
T d2astb2          45 PFRVQHMDLS--NSVIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSC  120 (284)
T ss_dssp             CBCCCEEECT--TCEECHHHHHHHHTTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHHHHHHHC
T ss_pred             CCCCCEEECC--CCccCHHHHHHHHHhCCCccccccccc-CCCcHHHHHHhc-CCCCcCccccccccccccccchhhHHH
Confidence            3578899998  557788888888888999999999987 678887777765 789999999998889998888888889


Q ss_pred             CCCcEEEcCCCccCccHHHHHH-HHhcCCCCCEEeccCC-CCCCHHHHHHHHhcCCCCCeeecCCCCCCCHHHHHHHHhc
Q 017279          184 RKLKILNLCGCVKAATDYALQA-IGRNCNQLQSLNLGWC-EDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANG  261 (374)
Q Consensus       184 ~~L~~L~L~~~~~~~~~~~~~~-l~~~~~~L~~L~l~~~-~~~~~~~~~~l~~~~~~L~~L~l~~~~~l~~~~l~~l~~~  261 (374)
                      ++|++|++++|.. +++..+.. +...+++|+.|+++++ ..+++.++..+...||+|++|++++|..+++..+..+.+ 
T Consensus       121 ~~L~~L~ls~c~~-~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~-  198 (284)
T d2astb2         121 SRLDELNLSWCFD-FTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-  198 (284)
T ss_dssp             TTCCEEECCCCTT-CCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGG-
T ss_pred             Hhccccccccccc-cccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcc-
Confidence            9999999998875 66666654 5556788999999875 357888888888889999999999988898888877765 


Q ss_pred             CCCCceEecCCCCCCCHHHHHHHHhcCCCCCCccccccccccCCCCCcEEecCCCCCCCHHHHHHHHhhCCCccCCCCCc
Q 017279          262 CPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRH  341 (374)
Q Consensus       262 ~~~L~~L~l~~~~~i~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~l~~l~~~~~~l~~~~~L~  341 (374)
                      +++|++|++++|..+++.++..++..                  ++|+.|++++|  +++..+..+...      ||+|+
T Consensus       199 ~~~L~~L~L~~C~~i~~~~l~~L~~~------------------~~L~~L~l~~~--~~d~~l~~l~~~------lp~L~  252 (284)
T d2astb2         199 LNYLQHLSLSRCYDIIPETLLELGEI------------------PTLKTLQVFGI--VPDGTLQLLKEA------LPHLQ  252 (284)
T ss_dssp             CTTCCEEECTTCTTCCGGGGGGGGGC------------------TTCCEEECTTS--SCTTCHHHHHHH------STTSE
T ss_pred             cCcCCEEECCCCCCCChHHHHHHhcC------------------CCCCEEeeeCC--CCHHHHHHHHHh------Ccccc
Confidence            89999999999988998887766543                  89999999987  777778877744      44444


Q ss_pred             eEEecCCcccccc
Q 017279          342 SLVMSGCLNLTSV  354 (374)
Q Consensus       342 ~L~ls~C~~l~~~  354 (374)
                      .    .|..++.+
T Consensus       253 i----~~~~ls~~  261 (284)
T d2astb2         253 I----NCSHFTTI  261 (284)
T ss_dssp             E----SCCCSCCT
T ss_pred             c----cCccCCCC
Confidence            2    45566554



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure