Citrus Sinensis ID: 017290

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370----
MGSTEGTYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGMEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKE
cccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEEEEcccccccccccccEEEEcccccccccccccccEEEEHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHHHHHHHccccccEEEcccccccccEEHHHHHHHHHHHHHccccccEEccccccccHHHHHHHHHHHcccccccEEccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
ccccccccccEEHHHccccccccccccEEEEEccHHHHHHHHHHHHHHcccEEEEEEcccccccccccccEEEEEEccccHHHHHHHHccccEEEEEEHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHcccccccEEccccccccEEEHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHcHHHHHHHcccHHHccccEEEccccccEcccHHHccccc
mgstegtygaytyeelerepywpseklriSVTGAGGFIASHIARRLKSEGHYiiasdwkknehmtedmfchefHLVDLRVMDNCLKVTKGVDHVFNLAadmggmgfiqsNHSVIMYNNTMISFNMLEASRISGVKRFFYAssaciypefkqletnvslkesdawpaepqdaygleKLASEELCKHYTkdfgiecrvgrfhniygpfgtwkgmekapAAFCRKAltstdkfemwgdglqtrsFTFIDECVEGVLRltksdfrepvnigsdemVSMNEMAEIVLSfedkklpihhipgpegvrgrnsdntlikeklgwapsmklkdglRITYFWIKEQIEKEKtqgidlsvygsskvvgtqapvqlgslraadgke
mgstegtygaytyeelerepywpSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGMEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVlrltksdfrepvnigsdemvSMNEMAEIVLSFEDKKLPIHHipgpegvrgrnsdNTLIKEklgwapsmklkdGLRITYFWIKEQIEKEKTQGIDLSVygsskvvgtqapvqlgslraadgke
MGSTEGTYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGMEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKE
*******YGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLK***AW*****DAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGMEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHI*************TLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVV******************
**********************PSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGMEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKE***************************************
MGSTEGTYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGMEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKE
******TYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGMEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQ**S********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSTEGTYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGMEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query374 2.2.26 [Sep-21-2011]
A3C4S4378 GDP-mannose 3,5-epimerase yes no 1.0 0.989 0.928 0.0
A2Z7B3378 GDP-mannose 3,5-epimerase N/A no 1.0 0.989 0.925 0.0
Q2R1V8371 GDP-mannose 3,5-epimerase no no 0.973 0.981 0.936 0.0
Q93VR3377 GDP-mannose 3,5-epimerase yes no 1.0 0.992 0.904 0.0
Q6GMI9418 UDP-glucuronic acid decar yes no 0.802 0.717 0.274 5e-25
Q5PQX0420 UDP-glucuronic acid decar yes no 0.802 0.714 0.265 1e-23
Q91XL3420 UDP-glucuronic acid decar yes no 0.802 0.714 0.265 1e-23
Q8NBZ7420 UDP-glucuronic acid decar yes no 0.802 0.714 0.265 1e-23
Q5R885420 UDP-glucuronic acid decar yes no 0.802 0.714 0.265 1e-23
Q6DF08421 UDP-glucuronic acid decar yes no 0.807 0.717 0.260 8e-23
>sp|A3C4S4|GME1_ORYSJ GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. japonica GN=GME-1 PE=1 SV=1 Back     alignment and function desciption
 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/378 (92%), Positives = 364/378 (96%), Gaps = 4/378 (1%)

Query: 1   MGSTE--GT-YGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASD 57
           MGS+E  GT YG YTY ELERE YWPSEKLRIS+TGAGGFI SHIARRLKSEGHYIIASD
Sbjct: 1   MGSSEKNGTAYGEYTYAELEREQYWPSEKLRISITGAGGFIGSHIARRLKSEGHYIIASD 60

Query: 58  WKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYN 117
           WKKNEHMTEDMFCHEFHLVDLRVMDNCLKVT GVDHVFNLAADMGGMGFIQSNHSVIMYN
Sbjct: 61  WKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTNGVDHVFNLAADMGGMGFIQSNHSVIMYN 120

Query: 118 NTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKL 177
           NTMISFNMLEA+RI+GVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKL
Sbjct: 121 NTMISFNMLEAARINGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKL 180

Query: 178 ASEELCKHYTKDFGIECRVGRFHNIYGPFGTWK-GMEKAPAAFCRKALTSTDKFEMWGDG 236
           A+EELCKHYTKDFGIECRVGRFHNIYGPFGTWK G EKAPAAFCRKA TSTD+FEMWGDG
Sbjct: 181 ATEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDG 240

Query: 237 LQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPG 296
           LQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEI+LSFED++LPIHHIPG
Sbjct: 241 LQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIILSFEDRELPIHHIPG 300

Query: 297 PEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVV 356
           PEGVRGRNSDNTLIKEKLGWAP+MKLKDGLR TYFWIKEQIEKEKTQG+D++ YGSSKVV
Sbjct: 301 PEGVRGRNSDNTLIKEKLGWAPTMKLKDGLRFTYFWIKEQIEKEKTQGVDIAGYGSSKVV 360

Query: 357 GTQAPVQLGSLRAADGKE 374
            TQAPVQLGSLRAADGKE
Sbjct: 361 STQAPVQLGSLRAADGKE 378
Catalyzes a reversible epimerization of GDP-D-mannose that precedes the committed step in the biosynthesis of vitamin C (L-ascorbate), resulting in the hydrolysis of the highly energetic glycosyl-pyrophosphoryl linkage. Able to catalyze 2 distinct epimerization reactions and can release both GDP-L-galactose and GDP-L-gulose from GDP-mannose.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 5EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 8
>sp|A2Z7B3|GME1_ORYSI GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. indica GN=OsI_032456 PE=2 SV=1 Back     alignment and function description
>sp|Q2R1V8|GME2_ORYSJ GDP-mannose 3,5-epimerase 2 OS=Oryza sativa subsp. japonica GN=GME-2 PE=2 SV=2 Back     alignment and function description
>sp|Q93VR3|GME_ARATH GDP-mannose 3,5-epimerase OS=Arabidopsis thaliana GN=At5g28840 PE=1 SV=1 Back     alignment and function description
>sp|Q6GMI9|UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2 Back     alignment and function description
>sp|Q5PQX0|UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1 Back     alignment and function description
>sp|Q91XL3|UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=2 SV=1 Back     alignment and function description
>sp|Q8NBZ7|UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R885|UXS1_PONAB UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1 Back     alignment and function description
>sp|Q6DF08|UXS1_XENTR UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query374
319739579375 putative GDP-mannose-3,5-epimerase [Citr 1.0 0.997 0.986 0.0
255580957376 dtdp-glucose 4-6-dehydratase, putative [ 1.0 0.994 0.954 0.0
80973462376 GDP-D-mannose-3',5'-epimerase [Malpighia 1.0 0.994 0.954 0.0
225451338376 PREDICTED: GDP-mannose 3,5-epimerase 1 [ 1.0 0.994 0.952 0.0
146432257376 GDP-mannose-3',5'-epimerase [Vitis vinif 1.0 0.994 0.949 0.0
224125640375 predicted protein [Populus trichocarpa] 1.0 0.997 0.938 0.0
147794688376 hypothetical protein VITISV_003948 [Viti 1.0 0.994 0.946 0.0
224130650375 predicted protein [Populus trichocarpa] 1.0 0.997 0.936 0.0
225432858376 PREDICTED: GDP-mannose 3,5-epimerase 1 i 1.0 0.994 0.944 0.0
449442927376 PREDICTED: GDP-mannose 3,5-epimerase 1-l 1.0 0.994 0.938 0.0
>gi|319739579|gb|ADV59924.1| putative GDP-mannose-3,5-epimerase [Citrus unshiu] Back     alignment and taxonomy information
 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/375 (98%), Positives = 372/375 (99%), Gaps = 1/375 (0%)

Query: 1   MGSTEGTYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKK 60
           MGS+EGTYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKK
Sbjct: 1   MGSSEGTYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKK 60

Query: 61  NEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTM 120
           NEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTM
Sbjct: 61  NEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTM 120

Query: 121 ISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASE 180
           ISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASE
Sbjct: 121 ISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASE 180

Query: 181 ELCKHYTKDFGIECRVGRFHNIYGPFGTWK-GMEKAPAAFCRKALTSTDKFEMWGDGLQT 239
           ELCKHYTKDFGIECRVGRFHNIYGPFGTWK G EKAPAAFCRKALTSTDKFEMWGDGLQT
Sbjct: 181 ELCKHYTKDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQT 240

Query: 240 RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEG 299
           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEG
Sbjct: 241 RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEG 300

Query: 300 VRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQ 359
           VRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKT GIDLSVYGSSKVVGTQ
Sbjct: 301 VRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTPGIDLSVYGSSKVVGTQ 360

Query: 360 APVQLGSLRAADGKE 374
           APVQLGSLRAADG+E
Sbjct: 361 APVQLGSLRAADGQE 375

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255580957|ref|XP_002531297.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis] gi|223529130|gb|EEF31110.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|80973462|gb|ABB53472.1| GDP-D-mannose-3',5'-epimerase [Malpighia glabra] Back     alignment and taxonomy information
>gi|225451338|ref|XP_002279377.1| PREDICTED: GDP-mannose 3,5-epimerase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|146432257|gb|ABQ41112.1| GDP-mannose-3',5'-epimerase [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125640|ref|XP_002319639.1| predicted protein [Populus trichocarpa] gi|222858015|gb|EEE95562.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147794688|emb|CAN69149.1| hypothetical protein VITISV_003948 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130650|ref|XP_002328342.1| predicted protein [Populus trichocarpa] gi|222838057|gb|EEE76422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225432858|ref|XP_002283898.1| PREDICTED: GDP-mannose 3,5-epimerase 1 isoform 1 [Vitis vinifera] gi|359477586|ref|XP_003631999.1| PREDICTED: GDP-mannose 3,5-epimerase 1 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442927|ref|XP_004139232.1| PREDICTED: GDP-mannose 3,5-epimerase 1-like [Cucumis sativus] gi|449482982|ref|XP_004156461.1| PREDICTED: GDP-mannose 3,5-epimerase 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query374
TAIR|locus:2150441377 GME ""GDP-D-mannose 3',5'-epim 1.0 0.992 0.904 3.3e-189
TIGR_CMR|GSU_1815311 GSU_1815 "NAD-dependent epimer 0.794 0.954 0.294 1.2e-26
ZFIN|ZDB-GENE-020419-37418 uxs1 "UDP-glucuronic acid deca 0.807 0.722 0.273 1.2e-26
UNIPROTKB|E1BMI4420 UXS1 "Uncharacterized protein" 0.807 0.719 0.267 8.4e-26
UNIPROTKB|B3KV61363 UXS1 "UDP-glucuronate decarbox 0.807 0.831 0.263 8.4e-26
UNIPROTKB|Q8NBZ7420 UXS1 "UDP-glucuronic acid deca 0.807 0.719 0.263 8.4e-26
UNIPROTKB|F1SU22397 UXS1 "Uncharacterized protein" 0.807 0.760 0.263 8.4e-26
MGI|MGI:1915133420 Uxs1 "UDP-glucuronate decarbox 0.807 0.719 0.263 8.4e-26
RGD|628680420 Uxs1 "UDP-glucuronate decarbox 0.807 0.719 0.263 8.4e-26
UNIPROTKB|Q5PQX0420 Uxs1 "UDP-glucuronic acid deca 0.807 0.719 0.263 8.4e-26
TAIR|locus:2150441 GME ""GDP-D-mannose 3',5'-epimerase"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1834 (650.7 bits), Expect = 3.3e-189, P = 3.3e-189
 Identities = 341/377 (90%), Positives = 363/377 (96%)

Query:     1 MGSTEGT-YGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWK 59
             MG+T GT YGAYTY+ELERE YWPSE L+IS+TGAGGFIASHIARRLK EGHY+IASDWK
Sbjct:     1 MGTTNGTDYGAYTYKELEREQYWPSENLKISITGAGGFIASHIARRLKHEGHYVIASDWK 60

Query:    60 KNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNT 119
             KNEHMTEDMFC EFHLVDLRVM+NCLKVT+GVDHVFNLAADMGGMGFIQSNHSVIMYNNT
Sbjct:    61 KNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNT 120

Query:   120 MISFNMLEASRISGVKRFFYASSACIYPEFKQLET-NVSLKESDAWPAEPQDAYGLEKLA 178
             MISFNM+EA+RI+G+KRFFYASSACIYPEFKQLET NVSLKESDAWPAEPQDAYGLEKLA
Sbjct:   121 MISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAYGLEKLA 180

Query:   179 SEELCKHYTKDFGIECRVGRFHNIYGPFGTWKG-MEKAPAAFCRKALTSTDKFEMWGDGL 237
             +EELCKHY KDFGIECR+GRFHNIYGPFGTWKG  EKAPAAFCRKA TSTD+FEMWGDGL
Sbjct:   181 TEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDGL 240

Query:   238 QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGP 297
             QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAE+VLSFE+KKLPIHHIPGP
Sbjct:   241 QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGP 300

Query:   298 EGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVG 357
             EGVRGRNSDN LIKEKLGWAP+M+LK+GLRITYFWIKEQIEKEK +G D+S+YGSSKVVG
Sbjct:   301 EGVRGRNSDNNLIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGSDVSLYGSSKVVG 360

Query:   358 TQAPVQLGSLRAADGKE 374
             TQAPVQLGSLRAADGKE
Sbjct:   361 TQAPVQLGSLRAADGKE 377
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0009225 "nucleotide-sugar metabolic process" evidence=ISS
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0047918 "GDP-mannose 3,5-epimerase activity" evidence=ISS;IDA
GO:0019853 "L-ascorbic acid biosynthetic process" evidence=TAS
GO:0051287 "NAD binding" evidence=TAS
GO:0005829 "cytosol" evidence=IDA
TIGR_CMR|GSU_1815 GSU_1815 "NAD-dependent epimerase/dehydratase family protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020419-37 uxs1 "UDP-glucuronic acid decarboxylase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMI4 UXS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B3KV61 UXS1 "UDP-glucuronate decarboxylase 1, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NBZ7 UXS1 "UDP-glucuronic acid decarboxylase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SU22 UXS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1915133 Uxs1 "UDP-glucuronate decarboxylase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|628680 Uxs1 "UDP-glucuronate decarboxylase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5PQX0 Uxs1 "UDP-glucuronic acid decarboxylase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2R1V8GME2_ORYSJ5, ., 1, ., 3, ., 1, 80.93690.97320.9811nono
Q93VR3GME_ARATH5, ., 1, ., 3, ., 1, 80.90451.00.9920yesno
A2Z7B3GME1_ORYSI5, ., 1, ., 3, ., 1, 80.92591.00.9894N/Ano
A3C4S4GME1_ORYSJ5, ., 1, ., 3, ., 1, 80.92851.00.9894yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.1.3.180.993
3rd Layer5.1.30.998

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00031181001
SubName- Full=Chromosome chr14 scaffold_54, whole genome shotgun sequence; (376 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00036807001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (373 aa)
•    •• 0.927
GSVIVG00027274001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (452 aa)
     •• 0.909
GSVIVG00018410001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (361 aa)
     •• 0.905

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
PLN02695370 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase 0.0
cd05273328 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP- 0.0
cd05256304 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e 2e-59
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 5e-58
cd08946200 cd08946, SDR_e, extended (e) SDRs 5e-53
cd05230305 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase 6e-50
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 1e-48
cd05234305 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, 2e-39
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 1e-37
cd05253332 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimera 3e-35
cd05239300 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, exte 2e-34
cd05264300 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase 1e-29
PLN02206442 PLN02206, PLN02206, UDP-glucuronate decarboxylase 2e-25
PLN02166436 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase 2e-24
PLN02725306 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5- 2e-23
TIGR04180297 TIGR04180, EDH_00030, NAD dependent epimerase/dehy 5e-22
cd05246315 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydra 1e-21
cd05260316 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase 5e-19
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehyd 2e-18
cd05258337 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, e 3e-18
cd05248317 cd05248, ADP_GME_SDR_e, ADP-L-glycero-D-mannohepto 6e-18
cd05232303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 2e-17
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cel 4e-17
TIGR02197314 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-hep 7e-17
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 9e-17
cd05247323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 9e-15
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envel 2e-14
PRK15181348 PRK15181, PRK15181, Vi polysaccharide biosynthesis 2e-12
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 4e-12
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 4e-12
COG1089345 COG1089, Gmd, GDP-D-mannose dehydratase [Cell enve 3e-11
cd05240306 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase 3e-11
PLN02260 668 PLN02260, PLN02260, probable rhamnose biosynthetic 9e-11
cd08957307 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptic 1e-10
cd09813335 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD 2e-09
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 3e-09
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 6e-09
cd05238305 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a n 1e-07
PLN02427386 PLN02427, PLN02427, UDP-apiose/xylose synthase 1e-07
cd05245293 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 2e-07
cd05193295 cd05193, AR_like_SDR_e, aldehyde reductase, flavon 6e-07
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimera 6e-07
cd05237287 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l 9e-07
cd05254280 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4 1e-06
cd08958293 cd08958, FR_SDR_e, flavonoid reductase (FR), exten 2e-06
COG0702275 COG0702, COG0702, Predicted nucleoside-diphosphate 2e-06
cd05227301 cd05227, AR_SDR_e, aldehyde reductase, extended (e 3e-06
cd05261248 cd05261, CAPF_like_SDR_e, capsular polysaccharide 1e-05
cd05271273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 3e-05
cd05243203 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 6e-05
PRK10217355 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; 6e-05
PRK10675338 PRK10675, PRK10675, UDP-galactose-4-epimerase; Pro 1e-04
cd05263293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 1e-04
PLN02240352 PLN02240, PLN02240, UDP-glucose 4-epimerase 3e-04
PRK11908347 PRK11908, PRK11908, NAD-dependent epimerase/dehydr 5e-04
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [C 8e-04
cd05252336 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydrata 8e-04
PRK11150308 PRK11150, rfaD, ADP-L-glycero-D-mannoheptose-6-epi 0.001
cd05272308 cd05272, TDH_SDR_e, L-threonine dehydrogenase, ext 0.002
cd05259282 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ethe 0.002
COG1086588 COG1086, COG1086, Predicted nucleoside-diphosphate 0.002
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 0.004
>gnl|CDD|178298 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase Back     alignment and domain information 
 Score =  802 bits (2073), Expect = 0.0
 Identities = 341/369 (92%), Positives = 356/369 (96%), Gaps = 1/369 (0%)

Query: 7   TYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTE 66
           +YGAYT  ELEREPYWPSEKLRI +TGAGGFIASHIARRLK+EGHYIIASDWKKNEHM+E
Sbjct: 2   SYGAYTLAELEREPYWPSEKLRICITGAGGFIASHIARRLKAEGHYIIASDWKKNEHMSE 61

Query: 67  DMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNML 126
           DMFCHEFHLVDLRVM+NCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNML
Sbjct: 62  DMFCHEFHLVDLRVMENCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNML 121

Query: 127 EASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLASEELCKHY 186
           EA+RI+GVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLA+EELCKHY
Sbjct: 122 EAARINGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKLATEELCKHY 181

Query: 187 TKDFGIECRVGRFHNIYGPFGTWK-GMEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFI 245
           TKDFGIECR+GRFHNIYGPFGTWK G EKAPAAFCRKALTSTD+FEMWGDG QTRSFTFI
Sbjct: 182 TKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDEFEMWGDGKQTRSFTFI 241

Query: 246 DECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNS 305
           DECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEI LSFE+KKLPI HIPGPEGVRGRNS
Sbjct: 242 DECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIALSFENKKLPIKHIPGPEGVRGRNS 301

Query: 306 DNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLG 365
           DNTLIKEKLGWAP+M+LKDGLRITYFWIKEQIEKEK +G D + Y SSKVVGTQAPVQLG
Sbjct: 302 DNTLIKEKLGWAPTMRLKDGLRITYFWIKEQIEKEKAEGSDAAAYSSSKVVGTQAPVQLG 361

Query: 366 SLRAADGKE 374
           SLRAADGKE
Sbjct: 362 SLRAADGKE 370

Length = 370
>gnl|CDD|187581 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP-mannose-3',5'-epimerase (GME)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187563 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187550 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup 5, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|177856 PLN02206, PLN02206, UDP-glucuronate decarboxylase Back     alignment and domain information
>gnl|CDD|165812 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|178326 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family Back     alignment and domain information
>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187559 cd05248, ADP_GME_SDR_e, ADP-L-glycero-D-mannoheptose 6-epimerase (GME), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233775 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|185103 PRK15181, PRK15181, Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information
>gnl|CDD|224014 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup 3, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|215146 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme Back     alignment and domain information
>gnl|CDD|187660 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptica enzymes WbmH and WbmG-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid dehydrogenase-like protein)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187549 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a nucleoside-diphosphate-sugar 4-epimerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178047 PLN02427, PLN02427, UDP-apiose/xylose synthase Back     alignment and domain information
>gnl|CDD|187556 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 Back     alignment and domain information
>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase, and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187564 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4-hexulose reductase and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187571 cd05261, CAPF_like_SDR_e, capsular polysaccharide assembling protein (CAPF) like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 Back     alignment and domain information
>gnl|CDD|182313 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|182639 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase Back     alignment and domain information
>gnl|CDD|183375 PRK11908, PRK11908, NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>gnl|CDD|224016 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|182998 PRK11150, rfaD, ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|187580 cd05272, TDH_SDR_e, L-threonine dehydrogenase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase (PCBER) like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 374
PLN02695370 GDP-D-mannose-3',5'-epimerase 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PLN02166436 dTDP-glucose 4,6-dehydratase 100.0
PLN02427386 UDP-apiose/xylose synthase 100.0
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein 100.0
PLN02206442 UDP-glucuronate decarboxylase 100.0
PLN02572442 UDP-sulfoquinovose synthase 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
PLN02653340 GDP-mannose 4,6-dehydratase 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 100.0
PLN02240352 UDP-glucose 4-epimerase 100.0
PLN00198338 anthocyanidin reductase; Provisional 100.0
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 100.0
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 100.0
PLN02214342 cinnamoyl-CoA reductase 100.0
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 100.0
PRK10675338 UDP-galactose-4-epimerase; Provisional 100.0
PLN02260 668 probable rhamnose biosynthetic enzyme 100.0
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 100.0
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 100.0
PLN02650351 dihydroflavonol-4-reductase 100.0
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 100.0
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 100.0
PLN02896353 cinnamyl-alcohol dehydrogenase 100.0
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 100.0
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 100.0
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 100.0
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 100.0
PLN00016378 RNA-binding protein; Provisional 100.0
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 100.0
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 100.0
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 100.0
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 100.0
CHL00194317 ycf39 Ycf39; Provisional 100.0
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 100.0
PLN02686367 cinnamoyl-CoA reductase 100.0
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 100.0
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 100.0
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 100.0
PRK05865 854 hypothetical protein; Provisional 100.0
PLN02778298 3,5-epimerase/4-reductase 100.0
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 100.0
PLN02583297 cinnamoyl-CoA reductase 100.0
PRK07201 657 short chain dehydrogenase; Provisional 99.98
PLN02996491 fatty acyl-CoA reductase 99.97
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.97
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.96
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.96
PLN02260668 probable rhamnose biosynthetic enzyme 99.96
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.96
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.95
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.95
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.95
PRK12320 699 hypothetical protein; Provisional 99.95
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.94
PLN02503605 fatty acyl-CoA reductase 2 99.93
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.92
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.92
KOG2774366 consensus NAD dependent epimerase [General functio 99.91
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.91
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.91
COG3320382 Putative dehydrogenase domain of multifunctional n 99.9
PRK06482276 short chain dehydrogenase; Provisional 99.89
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.89
PLN03209 576 translocon at the inner envelope of chloroplast su 99.88
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.87
PRK09135249 pteridine reductase; Provisional 99.86
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.86
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK05875276 short chain dehydrogenase; Provisional 99.85
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.85
PRK08263275 short chain dehydrogenase; Provisional 99.85
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.85
PRK06180277 short chain dehydrogenase; Provisional 99.84
PRK07775274 short chain dehydrogenase; Provisional 99.84
PRK07806248 short chain dehydrogenase; Provisional 99.84
PRK07774250 short chain dehydrogenase; Provisional 99.84
PRK07074257 short chain dehydrogenase; Provisional 99.84
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.84
PRK06138252 short chain dehydrogenase; Provisional 99.83
PRK06914280 short chain dehydrogenase; Provisional 99.83
PRK07067257 sorbitol dehydrogenase; Provisional 99.83
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.83
PRK06194287 hypothetical protein; Provisional 99.83
PRK12828239 short chain dehydrogenase; Provisional 99.83
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.82
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.82
PRK12746254 short chain dehydrogenase; Provisional 99.82
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.82
PRK06182273 short chain dehydrogenase; Validated 99.82
PRK12829264 short chain dehydrogenase; Provisional 99.82
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.82
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.82
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.82
PRK07060245 short chain dehydrogenase; Provisional 99.81
PRK12827249 short chain dehydrogenase; Provisional 99.81
PRK05876275 short chain dehydrogenase; Provisional 99.81
PRK06128300 oxidoreductase; Provisional 99.81
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.81
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.81
PRK08219227 short chain dehydrogenase; Provisional 99.8
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.8
PRK05993277 short chain dehydrogenase; Provisional 99.8
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.8
PRK07890258 short chain dehydrogenase; Provisional 99.8
PRK06179270 short chain dehydrogenase; Provisional 99.8
PRK09186256 flagellin modification protein A; Provisional 99.79
PRK08264238 short chain dehydrogenase; Validated 99.79
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.78
PRK06181263 short chain dehydrogenase; Provisional 99.78
PRK08017256 oxidoreductase; Provisional 99.78
PRK09134258 short chain dehydrogenase; Provisional 99.78
PRK06701290 short chain dehydrogenase; Provisional 99.78
PRK07856252 short chain dehydrogenase; Provisional 99.78
PRK09291257 short chain dehydrogenase; Provisional 99.77
PRK12939250 short chain dehydrogenase; Provisional 99.77
PRK05717255 oxidoreductase; Validated 99.77
PRK10538248 malonic semialdehyde reductase; Provisional 99.77
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.77
PRK07024257 short chain dehydrogenase; Provisional 99.77
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.77
PRK06500249 short chain dehydrogenase; Provisional 99.77
PRK06398258 aldose dehydrogenase; Validated 99.77
PLN02253280 xanthoxin dehydrogenase 99.77
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.77
PRK07577234 short chain dehydrogenase; Provisional 99.77
PRK06123248 short chain dehydrogenase; Provisional 99.77
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 99.76
PRK07454241 short chain dehydrogenase; Provisional 99.76
PRK07326237 short chain dehydrogenase; Provisional 99.76
PRK06523260 short chain dehydrogenase; Provisional 99.76
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.76
PRK08628258 short chain dehydrogenase; Provisional 99.76
PRK06841255 short chain dehydrogenase; Provisional 99.76
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.76
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.75
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.75
PRK07985294 oxidoreductase; Provisional 99.75
PRK06101240 short chain dehydrogenase; Provisional 99.75
PRK07825273 short chain dehydrogenase; Provisional 99.75
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.75
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.75
PRK08324681 short chain dehydrogenase; Validated 99.75
COG2910211 Putative NADH-flavin reductase [General function p 99.75
PRK12937245 short chain dehydrogenase; Provisional 99.75
PRK05650270 short chain dehydrogenase; Provisional 99.75
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
PRK12744257 short chain dehydrogenase; Provisional 99.74
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
PRK07109334 short chain dehydrogenase; Provisional 99.74
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.74
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.74
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.74
PRK07814263 short chain dehydrogenase; Provisional 99.74
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.74
PRK07035252 short chain dehydrogenase; Provisional 99.74
PRK07102243 short chain dehydrogenase; Provisional 99.74
PRK08643256 acetoin reductase; Validated 99.74
PRK12747252 short chain dehydrogenase; Provisional 99.74
PRK07478254 short chain dehydrogenase; Provisional 99.74
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.73
PRK09242257 tropinone reductase; Provisional 99.73
PRK12743256 oxidoreductase; Provisional 99.73
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.73
PRK08251248 short chain dehydrogenase; Provisional 99.73
PRK07904253 short chain dehydrogenase; Provisional 99.72
PRK08267260 short chain dehydrogenase; Provisional 99.72
PRK07041230 short chain dehydrogenase; Provisional 99.72
PRK06949258 short chain dehydrogenase; Provisional 99.72
PRK07063260 short chain dehydrogenase; Provisional 99.72
PRK05866293 short chain dehydrogenase; Provisional 99.72
PRK06196315 oxidoreductase; Provisional 99.72
PRK06947248 glucose-1-dehydrogenase; Provisional 99.72
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.72
PRK05693274 short chain dehydrogenase; Provisional 99.71
PRK07069251 short chain dehydrogenase; Validated 99.71
PRK08277278 D-mannonate oxidoreductase; Provisional 99.71
COG0300265 DltE Short-chain dehydrogenases of various substra 99.71
PRK06114254 short chain dehydrogenase; Provisional 99.71
PRK12742237 oxidoreductase; Provisional 99.71
PRK07023243 short chain dehydrogenase; Provisional 99.7
PRK06172253 short chain dehydrogenase; Provisional 99.7
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.7
PRK09072263 short chain dehydrogenase; Provisional 99.7
PRK08265261 short chain dehydrogenase; Provisional 99.7
PRK05867253 short chain dehydrogenase; Provisional 99.7
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.7
PRK06057255 short chain dehydrogenase; Provisional 99.7
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.7
PRK06198260 short chain dehydrogenase; Provisional 99.7
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.69
PRK07576264 short chain dehydrogenase; Provisional 99.69
PRK06139330 short chain dehydrogenase; Provisional 99.69
PRK06483236 dihydromonapterin reductase; Provisional 99.68
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.68
PRK08339263 short chain dehydrogenase; Provisional 99.68
PRK06924251 short chain dehydrogenase; Provisional 99.68
PRK08226263 short chain dehydrogenase; Provisional 99.68
PRK07677252 short chain dehydrogenase; Provisional 99.67
PRK05872296 short chain dehydrogenase; Provisional 99.67
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.67
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.67
PRK08278273 short chain dehydrogenase; Provisional 99.67
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.66
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.66
PRK06197306 short chain dehydrogenase; Provisional 99.66
PRK08589272 short chain dehydrogenase; Validated 99.66
PRK08703239 short chain dehydrogenase; Provisional 99.66
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.66
PRK06953222 short chain dehydrogenase; Provisional 99.65
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.65
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.64
PRK05854313 short chain dehydrogenase; Provisional 99.64
PRK08936261 glucose-1-dehydrogenase; Provisional 99.64
PRK07062265 short chain dehydrogenase; Provisional 99.64
PRK08177225 short chain dehydrogenase; Provisional 99.64
PRK08340259 glucose-1-dehydrogenase; Provisional 99.64
PRK07578199 short chain dehydrogenase; Provisional 99.64
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.63
PRK07831262 short chain dehydrogenase; Provisional 99.63
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.63
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.63
PRK06484520 short chain dehydrogenase; Validated 99.63
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.63
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.62
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 99.62
PRK07832272 short chain dehydrogenase; Provisional 99.61
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.61
PRK07201657 short chain dehydrogenase; Provisional 99.61
PRK05884223 short chain dehydrogenase; Provisional 99.61
PRK06125259 short chain dehydrogenase; Provisional 99.61
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.6
PRK12367245 short chain dehydrogenase; Provisional 99.6
PRK05855582 short chain dehydrogenase; Validated 99.59
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.58
PRK09009235 C factor cell-cell signaling protein; Provisional 99.58
PRK07791286 short chain dehydrogenase; Provisional 99.57
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 99.57
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.55
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.55
PLN02780320 ketoreductase/ oxidoreductase 99.54
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.54
PRK06940275 short chain dehydrogenase; Provisional 99.54
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.54
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.54
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.53
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.53
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.53
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.51
PRK06484 520 short chain dehydrogenase; Validated 99.51
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.5
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 99.5
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.5
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 99.49
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.48
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.48
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.47
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.47
PRK05599246 hypothetical protein; Provisional 99.47
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 99.46
KOG4288283 consensus Predicted oxidoreductase [General functi 99.42
PRK08303305 short chain dehydrogenase; Provisional 99.42
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.39
PLN00015308 protochlorophyllide reductase 99.38
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.38
PRK08862227 short chain dehydrogenase; Provisional 99.37
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.36
KOG0725270 consensus Reductases with broad range of substrate 99.36
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.34
COG1028251 FabG Dehydrogenases with different specificities ( 99.3
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.29
KOG1208314 consensus Dehydrogenases with different specificit 99.27
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 99.24
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.24
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.19
PTZ00325321 malate dehydrogenase; Provisional 99.11
KOG1611249 consensus Predicted short chain-type dehydrogenase 99.1
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.08
PLN00106323 malate dehydrogenase 99.08
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 99.05
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.05
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.05
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 98.99
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 98.99
PRK08309177 short chain dehydrogenase; Provisional 98.96
PRK06720169 hypothetical protein; Provisional 98.88
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 98.82
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 98.75
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 98.74
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 98.7
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 98.66
PRK09620229 hypothetical protein; Provisional 98.63
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 98.62
PRK05086312 malate dehydrogenase; Provisional 98.48
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 98.47
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 98.45
PRK06732229 phosphopantothenate--cysteine ligase; Validated 98.45
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 98.38
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.2
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 98.2
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 98.18
KOG2733423 consensus Uncharacterized membrane protein [Functi 98.17
COG0569225 TrkA K+ transport systems, NAD-binding component [ 98.1
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 98.1
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 98.08
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 98.05
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 98.05
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 98.0
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 97.97
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.95
PRK14982340 acyl-ACP reductase; Provisional 97.92
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.92
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.9
COG0623259 FabI Enoyl-[acyl-carrier-protein] 97.86
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 97.85
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.84
PRK09496 453 trkA potassium transporter peripheral membrane com 97.84
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.81
COG3268382 Uncharacterized conserved protein [Function unknow 97.81
PRK04148134 hypothetical protein; Provisional 97.8
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 97.72
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.71
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.69
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 97.67
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 97.66
PRK00048257 dihydrodipicolinate reductase; Provisional 97.66
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 97.66
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.63
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 97.63
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.59
PLN02383344 aspartate semialdehyde dehydrogenase 97.57
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 97.52
PRK09496453 trkA potassium transporter peripheral membrane com 97.52
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.5
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 97.48
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.46
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.44
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 97.42
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 97.4
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 97.39
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.39
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.33
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.32
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.3
PRK05442326 malate dehydrogenase; Provisional 97.27
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 97.26
PRK08040336 putative semialdehyde dehydrogenase; Provisional 97.26
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.25
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.25
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 97.23
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 97.23
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 97.21
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.21
cd01483143 E1_enzyme_family Superfamily of activating enzymes 97.17
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 97.16
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 97.14
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 97.13
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 97.13
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 97.09
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 97.08
PRK06223307 malate dehydrogenase; Reviewed 97.07
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.07
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.06
PRK08328231 hypothetical protein; Provisional 97.05
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 97.04
PRK03659601 glutathione-regulated potassium-efflux system prot 97.03
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 97.03
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 97.02
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 97.02
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.99
PTZ00117319 malate dehydrogenase; Provisional 96.97
PTZ00082321 L-lactate dehydrogenase; Provisional 96.97
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 96.95
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 96.95
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 96.94
PLN00112444 malate dehydrogenase (NADP); Provisional 96.91
PRK10669558 putative cation:proton antiport protein; Provision 96.91
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 96.9
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.89
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 96.88
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 96.86
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.86
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.85
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 96.85
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 96.85
PRK08655437 prephenate dehydrogenase; Provisional 96.83
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 96.83
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 96.83
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 96.81
PRK08223287 hypothetical protein; Validated 96.8
PRK03562621 glutathione-regulated potassium-efflux system prot 96.79
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.77
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 96.76
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.76
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 96.75
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 96.74
PRK15116268 sulfur acceptor protein CsdL; Provisional 96.73
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 96.72
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 96.72
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.71
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 96.71
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.7
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.7
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.7
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 96.7
PLN02602350 lactate dehydrogenase 96.67
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 96.66
PRK07574385 formate dehydrogenase; Provisional 96.64
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 96.64
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.63
PRK05600370 thiamine biosynthesis protein ThiF; Validated 96.63
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.62
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.62
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 96.62
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 96.59
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 96.58
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 96.57
PRK07877 722 hypothetical protein; Provisional 96.56
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.54
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.53
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.53
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.52
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.51
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 96.49
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.47
PLN02353 473 probable UDP-glucose 6-dehydrogenase 96.47
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.46
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.46
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.45
PRK06849389 hypothetical protein; Provisional 96.44
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.43
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 96.43
TIGR00036266 dapB dihydrodipicolinate reductase. 96.41
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 96.39
PRK07417279 arogenate dehydrogenase; Reviewed 96.38
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 96.37
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 96.36
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 96.36
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.34
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.33
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.33
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.3
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 96.3
PRK10537393 voltage-gated potassium channel; Provisional 96.29
PRK07411390 hypothetical protein; Validated 96.29
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.29
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.24
PRK06444197 prephenate dehydrogenase; Provisional 96.23
PRK13403335 ketol-acid reductoisomerase; Provisional 96.22
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 96.2
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 96.19
PRK06249313 2-dehydropantoate 2-reductase; Provisional 96.19
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.19
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.18
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 96.18
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.17
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 96.16
COG0027394 PurT Formate-dependent phosphoribosylglycinamide f 96.16
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 96.14
PRK06719157 precorrin-2 dehydrogenase; Validated 96.12
PRK13243333 glyoxylate reductase; Reviewed 96.09
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 96.08
PLN02948 577 phosphoribosylaminoimidazole carboxylase 96.06
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.05
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 96.04
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 96.04
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.04
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 96.03
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 96.02
COG4982866 3-oxoacyl-[acyl-carrier protein] 96.01
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 96.0
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 95.99
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.99
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.98
PLN02928347 oxidoreductase family protein 95.97
PLN02775286 Probable dihydrodipicolinate reductase 95.97
PRK08818370 prephenate dehydrogenase; Provisional 95.95
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 95.94
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 95.94
PRK12921305 2-dehydropantoate 2-reductase; Provisional 95.92
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.92
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 95.92
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 95.92
PLN03139386 formate dehydrogenase; Provisional 95.92
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.91
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 95.91
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 95.9
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 95.89
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 95.88
PRK09880343 L-idonate 5-dehydrogenase; Provisional 95.88
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information 
Probab=100.00  E-value=5.7e-56  Score=415.17  Aligned_cols=368  Identities=93%  Similarity=1.476  Sum_probs=313.8

Q ss_pred             ccccchhhhhccCCCCCCCCCeEEEEcCcchhHHHHHHHHHhCCCEEEEEeCCCCcccccccccceeEEecccchhhHhh
Q 017290            7 TYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLK   86 (374)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~ilItGatG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~i~~~~~dl~~~~~~~~   86 (374)
                      ++++|++.++++.+.|+...|+||||||+||||+++++.|+++||+|++++|.............+++.+|+++.+.+..
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~IlVtGgtGfIG~~l~~~L~~~G~~V~~v~r~~~~~~~~~~~~~~~~~~Dl~d~~~~~~   81 (370)
T PLN02695          2 SYGAYTLAELEREPYWPSEKLRICITGAGGFIASHIARRLKAEGHYIIASDWKKNEHMSEDMFCHEFHLVDLRVMENCLK   81 (370)
T ss_pred             CccccchhhcCCCCCCCCCCCEEEEECCccHHHHHHHHHHHhCCCEEEEEEeccccccccccccceEEECCCCCHHHHHH
Confidence            57899999999999999999999999999999999999999999999999987543222112235788899999988888


Q ss_pred             hccCCCEEEEcccccCCcccccCCcceehhhhHHHHHHHHHHHHhCCCCeEEEeecccccCCCcccccccCCCCCCCCCC
Q 017290           87 VTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNVSLKESDAWPA  166 (374)
Q Consensus        87 ~~~~~d~vi~~a~~~~~~~~~~~~~~~~~~~n~~~~~~ll~a~~~~~~~~~i~~Ss~~vy~~~~~~~~~~~~~e~~~~~~  166 (374)
                      +++++|+|||+|+..+.......++...+..|+.++.+++++|++.++++|||+||.++|+.......+.++.|++.++.
T Consensus        82 ~~~~~D~Vih~Aa~~~~~~~~~~~~~~~~~~N~~~t~nll~aa~~~~vk~~V~~SS~~vYg~~~~~~~~~~~~E~~~~p~  161 (370)
T PLN02695         82 VTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEAARINGVKRFFYASSACIYPEFKQLETNVSLKESDAWPA  161 (370)
T ss_pred             HHhCCCEEEEcccccCCccccccCchhhHHHHHHHHHHHHHHHHHhCCCEEEEeCchhhcCCccccCcCCCcCcccCCCC
Confidence            88899999999987543223333445567789999999999999999999999999999997543222224667664567


Q ss_pred             CCCCchHHhHHHHHHHHHHHHhhhCCcEEEEeeCcccCCCCCCCC-CCCcHHHHHHHHhccCCceEeeCCCcccccceeH
Q 017290          167 EPQDAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKG-MEKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFI  245 (374)
Q Consensus       167 ~~~~~y~~sK~~~E~~~~~~~~~~~~~~~ilR~~~v~g~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  245 (374)
                      .|.+.|+.+|..+|.+++.+....+++++++||+.+|||+..+.. ....+..++...+..+.++.+++++++.++|+|+
T Consensus       162 ~p~s~Yg~sK~~~E~~~~~~~~~~g~~~~ilR~~~vyGp~~~~~~~~~~~~~~~~~~~~~~~~~i~~~g~g~~~r~~i~v  241 (370)
T PLN02695        162 EPQDAYGLEKLATEELCKHYTKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDEFEMWGDGKQTRSFTFI  241 (370)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhCCCEEEEEECCccCCCCCccccccccHHHHHHHHHcCCCCeEEeCCCCeEEeEEeH
Confidence            788999999999999999999888999999999999999754322 2234566777766656788888999999999999


Q ss_pred             HHHHHHHHhhhccCCCCcEEecCCCccCHHHHHHHHHHhcCCCCCcccCCCCCCCcccccchHHHHHhcCCCcCCCHHHH
Q 017290          246 DECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDG  325 (374)
Q Consensus       246 ~Dva~~i~~~~~~~~~~~~~i~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~d~~k~~~~lg~~p~~~~~~~  325 (374)
                      +|++++++.++++..+++||+++++.+++.|+++.+.+..|.+.++...+.+........|++|++++|||.|+++++++
T Consensus       242 ~D~a~ai~~~~~~~~~~~~nv~~~~~~s~~el~~~i~~~~g~~~~i~~~~~~~~~~~~~~d~sk~~~~lgw~p~~~l~e~  321 (370)
T PLN02695        242 DECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIALSFENKKLPIKHIPGPEGVRGRNSDNTLIKEKLGWAPTMRLKDG  321 (370)
T ss_pred             HHHHHHHHHHHhccCCCceEecCCCceeHHHHHHHHHHHhCCCCCceecCCCCCccccccCHHHHHHhcCCCCCCCHHHH
Confidence            99999999998887788999999999999999999999999877766666555556677899999999999999999999


Q ss_pred             HHHHHHHHHHhhhhhhhcCceEEEecCCcccCCCCCcccCccccccCCC
Q 017290          326 LRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKE  374 (374)
Q Consensus       326 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  374 (374)
                      |+++++|+++......+++.+...|.+++....|.|++++++|++||||
T Consensus       322 i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  370 (370)
T PLN02695        322 LRITYFWIKEQIEKEKAEGSDAAAYSSSKVVGTQAPVQLGSLRAADGKE  370 (370)
T ss_pred             HHHHHHHHHHHHHhhhccccchhhhcccccccccCceeccccccccCCC
Confidence            9999999999999999999999999999999999999999999999997

>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
2c59_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 0.0
2c54_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 0.0
2c5a_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 0.0
2c5e_A379 Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana 0.0
4ef7_B337 Udp-Xylose Synthase Length = 337 7e-25
3ehe_A313 Crystal Structure Of Udp-Glucose 4 Epimerase (Gale- 3e-24
2b69_A343 Crystal Structure Of Human Udp-Glucoronic Acid Deca 4e-24
3aw9_A308 Structure Of Udp-Galactose 4-Epimerase Mutant Lengt 7e-24
3icp_A312 Crystal Structure Of Udp-Galactose 4-Epimerase Leng 9e-24
1e6u_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Le 4e-18
1e7s_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase K1 5e-18
1e7q_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase S1 6e-18
1bsv_A321 Gdp-Fucose Synthetase From Escherichia Coli Complex 7e-18
3ruc_A351 Specific Recognition Of N-Acetylated Substrates And 1e-17
1e7r_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Y1 1e-17
1bws_A321 Crystal Structure Of Gdp-4-Keto-6-Deoxy-D-Mannose E 1e-17
3lu1_A364 Crystal Structure Analysis Of Wbgu: A Udp-Galnac 4- 2e-17
3ru9_A351 Specific Recognition Of N-Acetylated Substrates And 2e-17
3ru7_A351 Specific Recognition Of N-Acetylated Substrates And 2e-17
1r6d_A337 Crystal Structure Of Desiv Double Mutant (Dtdp-Gluc 7e-15
1r66_A337 Crystal Structure Of Desiv (Dtdp-Glucose 4,6-Dehydr 1e-14
1sb8_A352 Crystal Structure Of Pseudomonas Aeruginosa Udp-N-A 4e-14
3vps_A321 Structure Of A Novel Nad Dependent-Ndp-Hexosamine 5 7e-14
2p5u_A311 Crystal Structure Of Thermus Thermophilus Hb8 Udp-G 7e-12
2pzj_A377 Crystal Structure Of The Bordetella Bronchiseptica 1e-11
3m2p_A311 The Crystal Structure Of Udp-N-Acetylglucosamine 4- 2e-11
2c20_A330 Crystal Structure Of Udp-Glucose 4-Epimerase Length 4e-11
2hun_A336 Crystal Structure Of Hypothetical Protein Ph0414 Fr 1e-10
3sxp_A362 Crystal Structure Of Helicobacter Pylori Adp-L-Glyc 3e-10
1kep_A348 The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydra 2e-09
4id9_A347 Crystal Structure Of A Short-Chain DehydrogenaseRED 2e-08
3rft_A267 Crystal Structure Of Uronate Dehydrogenase From Agr 8e-08
3ay3_A267 Crystal Structure Of Glucuronic Acid Dehydrogeanse 1e-07
1lrj_A338 Crystal Structure Of E. Coli Udp-Galactose 4-Epimer 3e-07
1lrk_A338 Crystal Structure Of Escherichia Coli Udp-Galactose 5e-07
1kvs_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 5e-07
1kvq_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 5e-07
1eq2_A310 The Crystal Structure Of Adp-L-Glycero-D-Mannohepto 7e-07
3rfx_A267 Crystal Structure Of Uronate Dehydrogenase From Agr 7e-07
2udp_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 7e-07
4egb_A346 3.0 Angstrom Resolution Crystal Structure Of Dtdp-G 9e-07
1kvt_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 1e-06
1kvr_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 1e-06
1a9z_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 2e-06
1kvu_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-06
2x6t_A357 Agme Bound To Adp-B-Mannose Length = 357 4e-06
1a9y_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 4e-06
1g1a_A361 The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydra 4e-06
1orr_A347 Crystal Structure Of Cdp-tyvelose 2-epimerase Compl 1e-05
3a1n_A317 Crystal Structure Of L-Threonine Dehydrogenase From 9e-05
4b8w_A319 Crystal Structure Of Human Gdp-L-Fucose Synthase Wi 1e-04
4b8z_A320 Crystal Structure Of Human Gdp-l-fucose Synthase Wi 1e-04
2pk3_A321 Crystal Structure Of A Gdp-4-Keto-6-Deoxy-D-Mannose 2e-04
1z45_A 699 Crystal Structure Of The Gal10 Fusion Protein Galac 2e-04
1z73_A358 Crystal Structure Of E. Coli Arna Dehydrogenase (de 3e-04
3a9w_A317 Crystal Structure Of L-Threonine Bound L-Threonine 3e-04
2q1w_A333 Crystal Structure Of The Bordetella Bronchiseptica 3e-04
2bll_A345 Apo-Structure Of The C-Terminal Decarboxylase Domai 4e-04
1z74_A358 Crystal Structure Of E.Coli Arna Dehydrogenase (Dec 5e-04
1z7e_A660 Crystal Structure Of Full Length Arna Length = 660 6e-04
1z7b_A358 Crystal Structure Of E.Coli Arna Dehydrogenase (Dec 6e-04
1z75_A358 Crystal Structure Of Arna Dehydrogenase (decarboxyl 6e-04
1u9j_A358 Crystal Structure Of E. Coli Arna (Pmri) Decarboxyl 6e-04
>pdb|2C59|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), With Gdp-Alpha-D-Mannose And Gdp-Beta-L-Galactose Bound In The Active Site. Length = 379 Back     alignment and structure 
Iteration: 1

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/377 (90%), Positives = 363/377 (96%), Gaps = 3/377 (0%)
Query: 1   MGSTEGT-YGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWK 59
           MG+T GT YGAYTY+ELERE YWPSE L+IS+TGAGGFIASHIARRLK EGHY+IASDWK
Sbjct: 3   MGTTNGTDYGAYTYKELEREQYWPSENLKISITGAGGFIASHIARRLKHEGHYVIASDWK 62
Query: 60  KNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNT 119
           KNEHMTEDMFC EFHLVDLRVM+NCLKVT+GVDHVFNLAADMGGMGFIQSNHSVIMYNNT
Sbjct: 63  KNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNT 122
Query: 120 MISFNMLEASRISGVKRFFYASSACIYPEFKQLET-NVSLKESDAWPAEPQDAYGLEKLA 178
           MISFNM+EA+RI+G+KRFFYASSACIYPEFKQLET NVSLKESDAWPAEPQDAYGLEKLA
Sbjct: 123 MISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAYGLEKLA 182
Query: 179 SEELCKHYTKDFGIECRVGRFHNIYGPFGTWKG-MEKAPAAFCRKALTSTDKFEMWGDGL 237
           +EELCKHY KDFGIECR+GRFHNIYGPFGTWKG  EKAPAAFCRKA TSTD+FEMWGDGL
Sbjct: 183 TEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDGL 242
Query: 238 QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGP 297
           QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAE+VLSFE+KKLPIHHIPGP
Sbjct: 243 QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGP 302
Query: 298 EGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVG 357
           EGVRGRNSDN LIKEKLGWAP+M+LK+GLRITYFWIKEQIEKEK +G D+S+YGSSKVVG
Sbjct: 303 EGVRGRNSDNNLIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGSDVSLYGSSKVVG 362
Query: 358 TQAPVQLGSLRAADGKE 374
           TQAPVQLGSLRAADGKE
Sbjct: 363 TQAPVQLGSLRAADGKE 379
>pdb|2C54|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), K178r, With Gdp-Beta-L-Gulose And Gdp-4-Keto-Beta-L-Gulose Bound In Active Site. Length = 379 Back     alignment and structure
>pdb|2C5A|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), Y174f, With Gdp-Beta-L-Galactose Bound In The Active Site Length = 379 Back     alignment and structure
>pdb|2C5E|A Chain A, Gdp-Mannose-3', 5' -Epimerase (Arabidopsis Thaliana), K217a, With Gdp-Alpha-D-Mannose Bound In The Active Site. Length = 379 Back     alignment and structure
>pdb|3EHE|A Chain A, Crystal Structure Of Udp-Glucose 4 Epimerase (Gale-1) From Archaeoglobus Fulgidus Length = 313 Back     alignment and structure
>pdb|2B69|A Chain A, Crystal Structure Of Human Udp-Glucoronic Acid Decarboxylase Length = 343 Back     alignment and structure
>pdb|3AW9|A Chain A, Structure Of Udp-Galactose 4-Epimerase Mutant Length = 308 Back     alignment and structure
>pdb|3ICP|A Chain A, Crystal Structure Of Udp-Galactose 4-Epimerase Length = 312 Back     alignment and structure
>pdb|1E6U|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Length = 321 Back     alignment and structure
>pdb|1E7S|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase K140r Length = 321 Back     alignment and structure
>pdb|1E7Q|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase S107a Length = 321 Back     alignment and structure
>pdb|1BSV|A Chain A, Gdp-Fucose Synthetase From Escherichia Coli Complex With Nadph Length = 321 Back     alignment and structure
>pdb|3RUC|A Chain A, Specific Recognition Of N-Acetylated Substrates And Domain Flexibility In Wbgu: A Udp-Galnac 4-Epimerase Length = 351 Back     alignment and structure
>pdb|1E7R|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Y136e Length = 321 Back     alignment and structure
>pdb|1BWS|A Chain A, Crystal Structure Of Gdp-4-Keto-6-Deoxy-D-Mannose EpimeraseREDUCTASE From Escherichia Coli A Key Enzyme In The Biosynthesis Of Gdp-L- Fucose Length = 321 Back     alignment and structure
>pdb|3LU1|A Chain A, Crystal Structure Analysis Of Wbgu: A Udp-Galnac 4-Epimerase Length = 364 Back     alignment and structure
>pdb|3RU9|A Chain A, Specific Recognition Of N-Acetylated Substrates And Domain Flexibility In Wbgu: A Udp-Galnac 4-Epimerase Length = 351 Back     alignment and structure
>pdb|3RU7|A Chain A, Specific Recognition Of N-Acetylated Substrates And Domain Flexibility In Wbgu: A Udp-Galnac 4-Epimerase Length = 351 Back     alignment and structure
>pdb|1R6D|A Chain A, Crystal Structure Of Desiv Double Mutant (Dtdp-Glucose 4,6- Dehydratase) From Streptomyces Venezuelae With Nad And Dau Bound Length = 337 Back     alignment and structure
>pdb|1R66|A Chain A, Crystal Structure Of Desiv (Dtdp-Glucose 4,6-Dehydratase) From Streptomyces Venezuelae With Nad And Tyd Bound Length = 337 Back     alignment and structure
>pdb|1SB8|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa Udp-N-Acetylglucosamine 4- Epimerase Complexed With Udp-N-Acetylgalactosamine Length = 352 Back     alignment and structure
>pdb|3VPS|A Chain A, Structure Of A Novel Nad Dependent-Ndp-Hexosamine 5,6-Dehydratase, Tuna, Involved In Tunicamycin Biosynthesis Length = 321 Back     alignment and structure
>pdb|2P5U|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8 Udp-Glucose 4- Epimerase Complex With Nad Length = 311 Back     alignment and structure
>pdb|2PZJ|A Chain A, Crystal Structure Of The Bordetella Bronchiseptica Enzyme Wbmf In Complex With Nad+ Length = 377 Back     alignment and structure
>pdb|3M2P|A Chain A, The Crystal Structure Of Udp-N-Acetylglucosamine 4-Epimerase From Bacillus Cereus Length = 311 Back     alignment and structure
>pdb|2C20|A Chain A, Crystal Structure Of Udp-Glucose 4-Epimerase Length = 330 Back     alignment and structure
>pdb|2HUN|A Chain A, Crystal Structure Of Hypothetical Protein Ph0414 From Pyrococcus Horikoshii Ot3 Length = 336 Back     alignment and structure
>pdb|3SXP|A Chain A, Crystal Structure Of Helicobacter Pylori Adp-L-Glycero-D-Manno- Heptose-6-Epimerase (Rfad, Hp0859) Length = 362 Back     alignment and structure
>pdb|1KEP|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase (Rmlb) From Streptococcus Suis With Dtdp-Xylose Bound Length = 348 Back     alignment and structure
>pdb|4ID9|A Chain A, Crystal Structure Of A Short-Chain DehydrogenaseREDUCTASE SUPERFAMILY Protein From Agrobacterium Tumefaciens (Target Efi-506441) With Bound Nad, Monoclinic Form 1 Length = 347 Back     alignment and structure
>pdb|3RFT|A Chain A, Crystal Structure Of Uronate Dehydrogenase From Agrobacterium Tumefaciens Length = 267 Back     alignment and structure
>pdb|3AY3|A Chain A, Crystal Structure Of Glucuronic Acid Dehydrogeanse From Chromohalobacter Salexigens Length = 267 Back     alignment and structure
>pdb|1LRJ|A Chain A, Crystal Structure Of E. Coli Udp-Galactose 4-Epimerase Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|1LRK|A Chain A, Crystal Structure Of Escherichia Coli Udp-Galactose 4-Epimerase Mutant Y299c Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|1KVS|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVQ|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1EQ2|A Chain A, The Crystal Structure Of Adp-L-Glycero-D-Mannoheptose 6- Epimerase Length = 310 Back     alignment and structure
>pdb|3RFX|A Chain A, Crystal Structure Of Uronate Dehydrogenase From Agrobacterium Tumefaciens, Y136a Mutant Complexed With Nad Length = 267 Back     alignment and structure
>pdb|2UDP|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|4EGB|A Chain A, 3.0 Angstrom Resolution Crystal Structure Of Dtdp-Glucose 4,6- Dehydratase (Rfbb) From Bacillus Anthracis Str. Ames In Complex With Nad Length = 346 Back     alignment and structure
>pdb|1KVT|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVR|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1A9Z|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Galactose Length = 338 Back     alignment and structure
>pdb|1KVU|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|2X6T|A Chain A, Agme Bound To Adp-B-Mannose Length = 357 Back     alignment and structure
>pdb|1A9Y|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Glucose Length = 338 Back     alignment and structure
>pdb|1G1A|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase (Rmlb)from Salmonella Enterica Serovar Typhimurium Length = 361 Back     alignment and structure
>pdb|1ORR|A Chain A, Crystal Structure Of Cdp-tyvelose 2-epimerase Complexed With Nad And Cdp Length = 347 Back     alignment and structure
>pdb|3A1N|A Chain A, Crystal Structure Of L-Threonine Dehydrogenase From Hyperthermophilic Archaeon Thermoplasma Volcanium Length = 317 Back     alignment and structure
>pdb|4B8W|A Chain A, Crystal Structure Of Human Gdp-L-Fucose Synthase With Bound Nadp And Gdp, Tetragonal Crystal Form Length = 319 Back     alignment and structure
>pdb|4B8Z|A Chain A, Crystal Structure Of Human Gdp-l-fucose Synthase With Bound Nadp And Gdp, Rhombohedral Crystal Form Length = 320 Back     alignment and structure
>pdb|2PK3|A Chain A, Crystal Structure Of A Gdp-4-Keto-6-Deoxy-D-Mannose Reductase Length = 321 Back     alignment and structure
>pdb|1Z45|A Chain A, Crystal Structure Of The Gal10 Fusion Protein Galactose MutarotaseUDP-Galactose 4-Epimerase From Saccharomyces Cerevisiae Complexed With Nad, Udp-Glucose, And Galactose Length = 699 Back     alignment and structure
>pdb|1Z73|A Chain A, Crystal Structure Of E. Coli Arna Dehydrogenase (decarboxylase) Domain, S433a Mutant Length = 358 Back     alignment and structure
>pdb|3A9W|A Chain A, Crystal Structure Of L-Threonine Bound L-Threonine Dehydrogenase (Y137f) From Hyperthermophilic Archaeon Thermoplasma Volcanium Length = 317 Back     alignment and structure
>pdb|2Q1W|A Chain A, Crystal Structure Of The Bordetella Bronchiseptica Enzyme Wbmh In Complex With Nad+ Length = 333 Back     alignment and structure
>pdb|2BLL|A Chain A, Apo-Structure Of The C-Terminal Decarboxylase Domain Of Arna Length = 345 Back     alignment and structure
>pdb|1Z74|A Chain A, Crystal Structure Of E.Coli Arna Dehydrogenase (Decarboxylase) Domain, R619y Mutant Length = 358 Back     alignment and structure
>pdb|1Z7E|A Chain A, Crystal Structure Of Full Length Arna Length = 660 Back     alignment and structure
>pdb|1Z7B|A Chain A, Crystal Structure Of E.Coli Arna Dehydrogenase (Decarboxylase) Domain, R619e Mutant Length = 358 Back     alignment and structure
>pdb|1Z75|A Chain A, Crystal Structure Of Arna Dehydrogenase (decarboxylase) Domain, R619m Mutant Length = 358 Back     alignment and structure
>pdb|1U9J|A Chain A, Crystal Structure Of E. Coli Arna (Pmri) Decarboxylase Domain Length = 358 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 0.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 9e-70
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 9e-64
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 4e-62
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 1e-60
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 7e-59
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 9e-58
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 1e-57
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 7e-55
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 1e-54
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 3e-54
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 8e-54
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 5e-49
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 4e-48
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 9e-46
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 9e-44
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 9e-43
3slg_A372 PBGP3 protein; structural genomics, seattle struct 1e-42
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 2e-41
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 1e-37
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 6e-37
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 7e-35
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 1e-33
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 1e-30
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 3e-30
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 3e-25
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 4e-19
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 5e-19
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 4e-14
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 9e-13
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 4e-12
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 2e-11
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 7e-11
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 2e-10
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 1e-09
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 3e-09
3ius_A286 Uncharacterized conserved protein; APC63810, silic 6e-09
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 6e-09
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 9e-09
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 9e-09
1xq6_A253 Unknown protein; structural genomics, protein stru 1e-08
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 2e-08
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 2e-08
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 3e-08
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 3e-08
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 6e-08
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 7e-08
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 9e-08
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 1e-07
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 3e-07
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 4e-07
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 4e-07
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 1e-06
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 2e-06
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 5e-06
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 9e-06
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 2e-05
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 3e-05
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 5e-05
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 7e-05
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 1e-04
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 1e-04
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 1e-04
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 2e-04
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 4e-04
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 Back     alignment and structure
 Score =  548 bits (1414), Expect = 0.0
 Identities = 340/377 (90%), Positives = 363/377 (96%), Gaps = 3/377 (0%)

Query: 1   MGSTEGT-YGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWK 59
           MG+T GT YGAYTY+ELERE YWPSE L+IS+TGAGGFIASHIARRLK EGHY+IASDWK
Sbjct: 3   MGTTNGTDYGAYTYKELEREQYWPSENLKISITGAGGFIASHIARRLKHEGHYVIASDWK 62

Query: 60  KNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNT 119
           KNEHMTEDMFC EFHLVDLRVM+NCLKVT+GVDHVFNLAADMGGMGFIQSNHSVIMYNNT
Sbjct: 63  KNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNT 122

Query: 120 MISFNMLEASRISGVKRFFYASSACIYPEFKQLE-TNVSLKESDAWPAEPQDAYGLEKLA 178
           MISFNM+EA+RI+G+KRFFYASSACIYPEFKQLE TNVSLKESDAWPAEPQDA+GLEKLA
Sbjct: 123 MISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAFGLEKLA 182

Query: 179 SEELCKHYTKDFGIECRVGRFHNIYGPFGTWK-GMEKAPAAFCRKALTSTDKFEMWGDGL 237
           +EELCKHY KDFGIECR+GRFHNIYGPFGTWK G EKAPAAFCRKA TSTD+FEMWGDGL
Sbjct: 183 TEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDGL 242

Query: 238 QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGP 297
           QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAE+VLSFE+KKLPIHHIPGP
Sbjct: 243 QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGP 302

Query: 298 EGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVG 357
           EGVRGRNSDN LIKEKLGWAP+M+LK+GLRITYFWIKEQIEKEK +G D+S+YGSSKVVG
Sbjct: 303 EGVRGRNSDNNLIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGSDVSLYGSSKVVG 362

Query: 358 TQAPVQLGSLRAADGKE 374
           TQAPVQLGSLRAADGKE
Sbjct: 363 TQAPVQLGSLRAADGKE 379
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A* 3aw9_A* Length = 312 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Length = 343 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Length = 310 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Length = 345 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Length = 372 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Length = 321 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Length = 347 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Length = 321 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Length = 337 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Length = 286 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Length = 397 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Length = 346 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Length = 699 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Length = 336 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} Length = 341 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Length = 348 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Length = 348 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Length = 338 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Length = 516 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 100.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 100.0
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 100.0
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 100.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 100.0
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 100.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 100.0
3slg_A372 PBGP3 protein; structural genomics, seattle struct 100.0
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 100.0
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 100.0
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 100.0
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 100.0
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 100.0
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 100.0
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 100.0
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 100.0
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 100.0
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 100.0
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 100.0
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 100.0
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 100.0
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 100.0
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 100.0
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 100.0
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 100.0
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 100.0
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 100.0
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 100.0
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 100.0
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 100.0
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 100.0
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 100.0
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 100.0
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 100.0
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 100.0
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 100.0
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 100.0
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 100.0
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 100.0
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 100.0
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 100.0
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 100.0
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 100.0
3ius_A286 Uncharacterized conserved protein; APC63810, silic 100.0
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 100.0
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 100.0
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 100.0
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 100.0
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 100.0
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 100.0
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 100.0
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 100.0
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 100.0
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 100.0
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 100.0
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 100.0
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 100.0
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 100.0
4f6c_A427 AUSA reductase domain protein; thioester reductase 100.0
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 100.0
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 100.0
4f6l_B508 AUSA reductase domain protein; thioester reductase 100.0
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 100.0
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 100.0
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 100.0
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 100.0
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 100.0
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.98
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.97
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.97
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.97
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.97
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.97
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.96
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.96
1xq6_A253 Unknown protein; structural genomics, protein stru 99.96
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.96
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.96
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.96
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.96
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.96
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.95
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.95
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.95
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.95
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.93
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.93
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.93
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.93
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.92
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.91
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.91
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.9
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.9
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.9
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.9
1spx_A278 Short-chain reductase family member (5L265); paral 99.9
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.89
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.89
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.89
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.89
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.89
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.89
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.89
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.89
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.89
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.89
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.89
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.89
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.88
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.88
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.88
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.88
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.88
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.88
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.88
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.88
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.88
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.88
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.87
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.87
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.87
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.87
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.87
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.87
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.87
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.87
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.87
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.87
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.87
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.87
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.87
3rih_A293 Short chain dehydrogenase or reductase; structural 99.87
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.87
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.87
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.87
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.87
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.87
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.87
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.86
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.86
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.86
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.86
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.86
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.86
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.86
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.86
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.86
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.86
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.86
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.86
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.86
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.86
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.86
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.86
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.86
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.86
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.86
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.86
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.85
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.85
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.85
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.85
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.85
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.85
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.85
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.85
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.85
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.85
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.85
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.85
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.85
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.85
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.85
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.85
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.85
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.85
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.85
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.85
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.85
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.85
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.85
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.85
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.85
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.85
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.85
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.85
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.85
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.85
4e4y_A244 Short chain dehydrogenase family protein; structur 99.84
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.84
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.84
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.84
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.84
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.84
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.84
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.84
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.84
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.84
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.84
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.84
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.84
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.84
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.84
1xkq_A280 Short-chain reductase family member (5D234); parra 99.84
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.84
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.84
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.84
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.84
3cxt_A291 Dehydrogenase with different specificities; rossma 99.84
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.84
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.84
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.84
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.83
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.83
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.83
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.83
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.83
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.83
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.83
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.83
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.83
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.83
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.83
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.83
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.83
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.83
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.83
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.83
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.82
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.82
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.82
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.82
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.82
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.82
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.82
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.82
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.82
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.82
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.81
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.81
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.81
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.81
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.81
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.81
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.81
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.81
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.81
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.81
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.81
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.81
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.81
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.81
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.81
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.81
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.81
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.81
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.8
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.8
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.8
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.8
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.8
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.8
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.8
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.79
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.79
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.79
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.79
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.79
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.78
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.78
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.78
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.78
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.77
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.77
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.77
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.77
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.76
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.75
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.75
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.74
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.74
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.73
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.73
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.73
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.72
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.72
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.72
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.71
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.71
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.7
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.69
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.69
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.69
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.69
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.68
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.61
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.59
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.55
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.52
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.51
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.51
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.33
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.32
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 99.31
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.3
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.29
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.27
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.25
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 99.21
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.2
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.19
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.16
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 99.01
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.94
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.94
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.86
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.83
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 98.83
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 98.79
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.75
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 98.67
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.63
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.63
1id1_A153 Putative potassium channel protein; RCK domain, E. 98.61
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 98.58
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.49
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 98.48
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 98.43
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 98.42
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.41
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 98.41
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.4
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 98.34
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.33
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 98.26
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 98.25
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 98.22
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 98.06
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.05
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 98.01
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 97.98
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.97
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 97.94
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.87
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 97.86
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.86
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.83
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 97.78
1lnq_A336 MTHK channels, potassium channel related protein; 97.78
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.76
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 97.75
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 97.72
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.7
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 97.7
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 97.65
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.61
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.6
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.6
4g65_A 461 TRK system potassium uptake protein TRKA; structur 97.58
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 97.55
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.54
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.54
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.52
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.51
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 97.51
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.5
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 97.49
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 97.47
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 97.47
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.47
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 97.43
3tl2_A315 Malate dehydrogenase; center for structural genomi 97.42
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 97.42
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.4
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.39
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 97.38
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.38
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.37
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 97.36
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 97.36
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 97.35
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.34
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 97.33
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.31
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.31
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.31
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.3
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.3
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.29
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 97.27
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 97.27
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.26
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.26
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.25
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 97.25
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 97.25
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 97.24
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 97.24
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.23
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 97.23
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 97.22
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 97.22
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.21
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.2
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.2
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 97.2
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 97.18
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 97.18
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 97.17
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.17
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 97.16
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.15
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.15
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.15
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 97.14
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.14
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 97.13
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.12
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 97.12
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 97.11
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 97.11
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.11
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 97.11
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.11
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.08
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.07
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.07
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.06
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 97.05
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.05
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 97.03
3l6d_A306 Putative oxidoreductase; structural genomics, prot 97.03
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.02
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.02
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 97.0
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 96.99
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.99
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 96.99
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.98
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.97
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.96
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 96.96
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 96.95
2duw_A145 Putative COA-binding protein; ligand binding prote 96.94
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 96.93
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 96.92
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 96.92
4gx0_A565 TRKA domain protein; membrane protein, ION channel 96.91
3fbg_A346 Putative arginate lyase; structural genomics, unkn 96.9
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.9
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 96.9
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 96.88
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.86
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 96.85
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.85
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.84
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.83
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 96.82
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 96.81
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 96.81
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.8
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.79
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.79
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.79
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 96.79
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.78
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 96.77
4eye_A342 Probable oxidoreductase; structural genomics, niai 96.74
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 96.74
1vpd_A299 Tartronate semialdehyde reductase; structural geno 96.74
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.73
4ezb_A317 Uncharacterized conserved protein; structural geno 96.7
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.69
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 96.69
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 96.69
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.69
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 96.67
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 96.64
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.64
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 96.64
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 96.63
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 96.63
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 96.62
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.62
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 96.62
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 96.61
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.61
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 96.6
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 96.6
3krt_A456 Crotonyl COA reductase; structural genomics, prote 96.59
1yb4_A295 Tartronic semialdehyde reductase; structural genom 96.58
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 96.58
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 96.58
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 96.58
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 96.57
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 96.57
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.56
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-53  Score=398.61  Aligned_cols=374  Identities=90%  Similarity=1.465  Sum_probs=301.8

Q ss_pred             CCCcc-cccccchhhhhccCCCCCCCCCeEEEEcCcchhHHHHHHHHHhCCCEEEEEeCCCCcccccccccceeEEeccc
Q 017290            1 MGSTE-GTYGAYTYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLR   79 (374)
Q Consensus         1 ~~~~~-~~~~~~~~~~~~~~~~~~~~~~~ilItGatG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~i~~~~~dl~   79 (374)
                      ||++. ....++.+.+......|+.+||+||||||+||||++++++|+++|++|++++|++.........+++++.+|+.
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vlVtGatG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~v~~~~~Dl~   82 (379)
T 2c5a_A            3 MGTTNGTDYGAYTYKELEREQYWPSENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLR   82 (379)
T ss_dssp             ------------CCTTCCCCCSCTTSCCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESSCCSSSCGGGTCSEEEECCTT
T ss_pred             CCccCCcchhhhhHHHHhccccccccCCeEEEECCccHHHHHHHHHHHHCCCeEEEEECCCccchhhccCCceEEECCCC
Confidence            55554 35566777777777778878899999999999999999999999999999999876544333346789999999


Q ss_pred             chhhHhhhccCCCEEEEcccccCCcccccCCcceehhhhHHHHHHHHHHHHhCCCCeEEEeecccccCCCccccc-ccCC
Q 017290           80 VMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLET-NVSL  158 (374)
Q Consensus        80 ~~~~~~~~~~~~d~vi~~a~~~~~~~~~~~~~~~~~~~n~~~~~~ll~a~~~~~~~~~i~~Ss~~vy~~~~~~~~-~~~~  158 (374)
                      |.+.+.++++++|+|||+|+......+...+....+++|+.++.+++++|++.++++|||+||.++|+.....+. ..++
T Consensus        83 d~~~~~~~~~~~d~Vih~A~~~~~~~~~~~~~~~~~~~Nv~g~~~ll~a~~~~~~~~~V~~SS~~v~~~~~~~~~~~~~~  162 (379)
T 2c5a_A           83 VMENCLKVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSL  162 (379)
T ss_dssp             SHHHHHHHHTTCSEEEECCCCCCCHHHHTTCHHHHHHHHHHHHHHHHHHHHHTTCSEEEEEEEGGGSCGGGSSSSSSCEE
T ss_pred             CHHHHHHHhCCCCEEEECceecCcccccccCHHHHHHHHHHHHHHHHHHHHHcCCCEEEEEeehheeCCCCCCCccCCCc
Confidence            999999999999999999997542222245667788999999999999999999999999999999986432111 1246


Q ss_pred             CCCCCCCCCCCCchHHhHHHHHHHHHHHHhhhCCcEEEEeeCcccCCCCCCCC-CCCcHHHHHHHHhccCCceEeeCCCc
Q 017290          159 KESDAWPAEPQDAYGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKG-MEKAPAAFCRKALTSTDKFEMWGDGL  237 (374)
Q Consensus       159 ~e~~~~~~~~~~~y~~sK~~~E~~~~~~~~~~~~~~~ilR~~~v~g~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~  237 (374)
                      +|+++.+..|.+.|+.+|..+|.+++.++.+.+++++++||+.+||+...... ....+..++.....+...+.+++++.
T Consensus       163 ~E~~~~~~~~~~~Y~~sK~~~E~~~~~~~~~~gi~~~ilrp~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~g~  242 (379)
T 2c5a_A          163 KESDAWPAEPQDAFGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDGL  242 (379)
T ss_dssp             CGGGGSSBCCSSHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCEECTTSCCSSSCCCHHHHHHHHHHHCSSCEEEESCSC
T ss_pred             CcccCCCCCCCChhHHHHHHHHHHHHHHHHHHCCCEEEEEeCceeCcCCCcccccccHHHHHHHHHHhCCCceEEeCCCC
Confidence            77664455678899999999999999998888999999999999999754221 12356666666655443477788888


Q ss_pred             ccccceeHHHHHHHHHhhhccCCCCcEEecCCCccCHHHHHHHHHHhcCCCCCcccCCCCCCCcccccchHHHHHhcCCC
Q 017290          238 QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWA  317 (374)
Q Consensus       238 ~~~~~i~~~Dva~~i~~~~~~~~~~~~~i~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~d~~k~~~~lg~~  317 (374)
                      +.++++|++|+|++++.+++++.+++||+++++.+++.|+++.+.+.+|.+.++..+|.+.......+|++|++++|||+
T Consensus       243 ~~~~~i~v~Dva~ai~~~l~~~~~~~~ni~~~~~~s~~e~~~~i~~~~g~~~~~~~~p~~~~~~~~~~d~~k~~~~lG~~  322 (379)
T 2c5a_A          243 QTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGPEGVRGRNSDNNLIKEKLGWA  322 (379)
T ss_dssp             CEECCEEHHHHHHHHHHHHHSSCCSCEEECCCCCEEHHHHHHHHHHTTTCCCCEEEECCCCCCSBCEECCHHHHHHHSCC
T ss_pred             eeEEEEEHHHHHHHHHHHhhccCCCeEEeCCCCccCHHHHHHHHHHHhCCCCceeeCCCCCCcccccCCHHHHHHHhCCC
Confidence            99999999999999999999888899999999999999999999999998877766666554556778999999999999


Q ss_pred             cCCCHHHHHHHHHHHHHHhhhhhhhcCceEEEecCCcccCCCCCcccCccccccCCC
Q 017290          318 PSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKE  374 (374)
Q Consensus       318 p~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  374 (374)
                      |+++++++|+++++|++++...........-.|..+++.+.+.||..++||++||||
T Consensus       323 p~~~l~e~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  379 (379)
T 2c5a_A          323 PNMRLKEGLRITYFWIKEQIEKEKAKGSDVSLYGSSKVVGTQAPVQLGSLRAADGKE  379 (379)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHHHHHHHTCCGGGGGSCCCCCCCCCCCTTCCCCSCC--
T ss_pred             CCCCHHHHHHHHHHHHHHhHhhhhhccCchhhcchhhhhhccCceeccccccccCCC
Confidence            999999999999999999887765555455579999999999999999999999997
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 374
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 1e-108
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 1e-70
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 6e-56
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-55
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 8e-53
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 8e-48
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 5e-41
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 5e-40
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 1e-39
d1z45a2347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 3e-39
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 5e-38
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-35
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 6e-35
d1n7ha_339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 3e-32
d1ek6a_346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-30
d1gy8a_383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 1e-28
d2blla1342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 2e-20
d1eq2a_307 c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimer 6e-17
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 5e-16
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 1e-15
d1rkxa_356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 3e-15
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 2e-14
d1vl0a_281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 3e-14
d1qyca_307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 5e-13
d1i24a_393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 5e-11
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 8e-11
d1xgka_350 c.2.1.2 (A:) Negative transcriptional regulator Nm 6e-09
d1n2sa_298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 2e-07
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 8e-06
d5mdha1154 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus s 1e-05
d2a35a1212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 5e-05
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 1e-04
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-04
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 5e-04
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-04
d1y7ta1154 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus th 0.001
d7mdha1175 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum ( 0.001
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 0.002
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 0.003
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 0.004
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.004
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 0.004
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 0.004
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 0.004
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: GDP-mannose-3', 5'-epimerase
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  319 bits (817), Expect = e-108
 Identities = 326/363 (89%), Positives = 349/363 (96%), Gaps = 2/363 (0%)

Query: 12  TYEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCH 71
           TY+ELERE YWPSE L+IS+TGAGGFIASHIARRLK EGHY+IASDWKKNEHMTEDMFC 
Sbjct: 1   TYKELEREQYWPSENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCD 60

Query: 72  EFHLVDLRVMDNCLKVTKGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRI 131
           EFHLVDLRVM+NCLKVT+GVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNM+EA+RI
Sbjct: 61  EFHLVDLRVMENCLKVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARI 120

Query: 132 SGVKRFFYASSACIYPEFKQLE-TNVSLKESDAWPAEPQDAYGLEKLASEELCKHYTKDF 190
           +G+KRFFYASSACIYPEFKQLE TNVSLKESDAWPAEPQDA+GLEKLA+EELCKHY KDF
Sbjct: 121 NGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAFGLEKLATEELCKHYNKDF 180

Query: 191 GIECRVGRFHNIYGPFGTWKGMEKA-PAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECV 249
           GIECR+GRFHNIYGPFGTWKG  +  PAAFCRKA TSTD+FEMWGDGLQTRSFTFIDECV
Sbjct: 181 GIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDGLQTRSFTFIDECV 240

Query: 250 EGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTL 309
           EGVLRLTKSDFREPVNIGSDEMVSMNEMAE+VLSFE+KKLPIHHIPGPEGVRGRNSDN L
Sbjct: 241 EGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGPEGVRGRNSDNNL 300

Query: 310 IKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRA 369
           IKEKLGWAP+M+LK+GLRITYFWIKEQIEKEK +G D+S+YGSSKVVGTQAPVQLGSLRA
Sbjct: 301 IKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGSDVSLYGSSKVVGTQAPVQLGSLRA 360

Query: 370 ADG 372
           ADG
Sbjct: 361 ADG 363
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Length = 307 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 154 Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 175 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 100.0
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 100.0
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 100.0
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 100.0
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 100.0
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 100.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 100.0
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 100.0
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 100.0
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 100.0
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 100.0
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.97
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.96
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.96
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.95
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.93
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.92
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.91
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.8
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.78
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.77
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.76
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.76
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.76
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.76
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.75
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.75
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.75
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.75
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.74
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.73
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.73
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.73
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.73
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.72
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.72
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.72
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.72
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.72
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.71
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.71
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.71
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.7
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.7
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.7
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.69
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.69
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.69
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.69
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.68
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.68
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.68
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.68
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.67
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.67
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.66
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.66
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.66
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.66
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.65
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.65
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.64
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.64
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.63
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.63
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.63
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.6
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.6
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.59
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.57
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.55
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.54
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.53
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.53
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.5
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.46
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.46
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.45
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.44
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.33
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.31
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.28
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.27
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.2
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.99
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.73
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 98.42
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.32
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.25
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 98.16
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.15
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 98.14
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 98.09
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.09
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.08
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.97
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.94
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.93
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.87
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.87
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.81
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.77
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.76
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.75
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.71
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.7
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.69
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.69
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.68
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.67
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 97.65
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.65
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.65
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.61
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.58
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.56
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.53
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.5
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.47
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.45
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.45
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.41
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.4
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.39
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.38
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.37
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.37
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.36
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 97.36
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.36
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 97.34
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 97.33
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 97.32
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.3
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.28
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.27
d1id1a_153 Rck domain from putative potassium channel Kch {Es 97.26
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.24
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.22
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.19
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.19
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.17
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.14
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 97.11
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.11
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.08
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.04
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 97.01
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.95
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.95
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.9
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.86
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 96.85
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 96.85
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.84
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 96.83
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 96.78
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.78
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.78
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 96.77
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.72
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.72
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.65
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.59
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.46
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.41
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.37
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.31
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.31
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.29
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.24
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.2
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 96.14
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.06
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.04
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.0
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 95.96
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.91
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.87
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.81
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.76
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.76
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.76
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 95.75
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.74
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.73
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.71
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.67
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 95.66
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 95.64
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.63
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.62
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.56
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.51
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 95.51
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.51
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.5
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 95.5
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.5
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.47
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.34
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.32
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 95.31
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 95.29
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.28
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.26
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.25
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.22
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.2
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.08
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.07
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.02
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 95.01
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.0
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.98
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.95
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.92
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.9
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.84
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 94.82
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 94.74
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.72
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 94.71
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 94.65
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.58
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.57
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 94.47
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.46
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 94.39
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 94.31
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.16
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.16
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.93
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 93.86
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.86
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 93.79
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 93.72
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 93.69
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 93.66
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 93.59
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.5
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.2
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 93.18
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 93.02
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.78
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 92.76
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.73
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.3
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.18
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.07
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 92.03
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 91.91
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.69
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.44
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 91.38
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 91.38
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.13
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 91.02
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 90.9
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 90.88
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 90.65
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 90.55
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 90.09
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 89.86
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 89.73
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 89.59
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 89.32
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.15
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.97
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 88.8
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 88.76
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.55
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.35
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 88.34
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 88.26
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 88.15
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 88.09
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 88.06
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 87.98
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 87.56
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 87.43
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 87.31
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 87.23
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.2
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 87.19
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 86.98
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.96
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 86.61
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 86.61
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 85.78
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 85.43
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 84.83
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 84.58
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.32
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 83.98
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 83.77
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 83.59
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 83.45
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 83.43
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 82.89
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 82.88
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 82.66
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.33
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 82.32
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 82.13
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 82.07
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 80.4
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 80.05
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: GDP-mannose-3', 5'-epimerase
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=4.7e-54  Score=399.95  Aligned_cols=360  Identities=91%  Similarity=1.467  Sum_probs=309.5

Q ss_pred             hhhhccCCCCCCCCCeEEEEcCcchhHHHHHHHHHhCCCEEEEEeCCCCcccccccccceeEEecccchhhHhhhccCCC
Q 017290           13 YEELEREPYWPSEKLRISVTGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTKGVD   92 (374)
Q Consensus        13 ~~~~~~~~~~~~~~~~ilItGatG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~i~~~~~dl~~~~~~~~~~~~~d   92 (374)
                      +.++.++..||.+.||||||||+||||++|+++|+++||+|+++++.+...........++..+|+.+.+.+..+++++|
T Consensus         2 ~~~~~~~~~~~~~nMKILVTGgsGfIGs~lv~~L~~~g~~V~~~d~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~d   81 (363)
T d2c5aa1           2 YKELEREQYWPSENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVD   81 (363)
T ss_dssp             CTTCCCCCSCTTSCCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESSCCSSSCGGGTCSEEEECCTTSHHHHHHHHTTCS
T ss_pred             hhhccccCcCCCCCCEEEEECCCCHHHHHHHHHHHHCcCEEEEEeCCCccchhhhcccCcEEEeechhHHHHHHHhhcCC
Confidence            34678899999899999999999999999999999999999999987665544444456888999999999999999999


Q ss_pred             EEEEcccccCCcccccCCcceehhhhHHHHHHHHHHHHhCCCCeEEEeecccccCCCccccccc-CCCCCCCCCCCCCCc
Q 017290           93 HVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMLEASRISGVKRFFYASSACIYPEFKQLETNV-SLKESDAWPAEPQDA  171 (374)
Q Consensus        93 ~vi~~a~~~~~~~~~~~~~~~~~~~n~~~~~~ll~a~~~~~~~~~i~~Ss~~vy~~~~~~~~~~-~~~e~~~~~~~~~~~  171 (374)
                      +|||+|+...........+...+..|+.++.+++++|++.++++|||+||..+|+.....+... .....+..+..|.+.
T Consensus        82 ~Vih~a~~~~~~~~~~~~~~~~~~~n~~gt~~ll~~~~~~~vk~~i~~SS~~~~~~~~~~~~~~~~~~~~e~~~~~p~~~  161 (363)
T d2c5aa1          82 HVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDA  161 (363)
T ss_dssp             EEEECCCCCCCHHHHTTCHHHHHHHHHHHHHHHHHHHHHTTCSEEEEEEEGGGSCGGGSSSSSSCEECGGGGSSBCCSSH
T ss_pred             eEeecccccccccccccccccccccccchhhHHHHhHHhhCccccccccccccccccccccccccccccccCCcCCCCCH
Confidence            9999998765433334566778889999999999999999999999999999999765433221 122222236788999


Q ss_pred             hHHhHHHHHHHHHHHHhhhCCcEEEEeeCcccCCCCCCCCC-CCcHHHHHHHHhccCCceEeeCCCcccccceeHHHHHH
Q 017290          172 YGLEKLASEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGM-EKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVE  250 (374)
Q Consensus       172 y~~sK~~~E~~~~~~~~~~~~~~~ilR~~~v~g~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Dva~  250 (374)
                      |+.+|.++|.+++.|.+.++++++++||+.+||+.+..... ....................+++|.+.++|+|+.|++.
T Consensus       162 Yg~sK~~~E~~~~~~~~~~gl~~~ilR~~~vyG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~g~~~rd~i~v~D~~~  241 (363)
T d2c5aa1         162 FGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDGLQTRSFTFIDECVE  241 (363)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCCEEEEEEECCEECTTSCCSSSCCCHHHHHHHHHHHCSSCEEEESCSCCEECCEEHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCEEEEEeeeEeccCCcccccccccccccccccccccccccccCCCCeEEEEeehhHHHH
Confidence            99999999999999999999999999999999997654432 23333344444444667778899999999999999999


Q ss_pred             HHHhhhccCCCCcEEecCCCccCHHHHHHHHHHhcCCCCCcccCCCCCCCcccccchHHHHHhcCCCcCCCHHHHHHHHH
Q 017290          251 GVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITY  330 (374)
Q Consensus       251 ~i~~~~~~~~~~~~~i~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~d~~k~~~~lg~~p~~~~~~~l~~~~  330 (374)
                      ++..+++++.+++||++++..+++.|+++++.+.+|.+.++..++.+........|++|++++|||+|+++++++|++++
T Consensus       242 ~~~~~~~~~~~~~~ni~~~~~~s~~~l~~~i~~~~g~~~~i~~~~~~~~~~~~~~d~ska~~~LGw~p~~sleegi~~ti  321 (363)
T d2c5aa1         242 GVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGPEGVRGRNSDNNLIKEKLGWAPNMRLKEGLRITY  321 (363)
T ss_dssp             HHHHHHHSSCCSCEEECCCCCEEHHHHHHHHHHTTTCCCCEEEECCCCCCSBCEECCHHHHHHHSCCCCCCHHHHHHHHH
T ss_pred             HHHHHHhCCCCCeEEEecCCcccHHHHHHHHHHHhCCCCceEeCCCCCCccccccCHHHHHHHhCCCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999988888888888888899999999999999999999999999


Q ss_pred             HHHHHhhhhhhhcCceEEEecCCcccCCCCCcccCccccccC
Q 017290          331 FWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADG  372 (374)
Q Consensus       331 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  372 (374)
                      +||++++.+.+.++.....|.++.....+.|+-+++.|++||
T Consensus       322 ~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  363 (363)
T d2c5aa1         322 FWIKEQIEKEKAKGSDVSLYGSSKVVGTQAPVQLGSLRAADG  363 (363)
T ss_dssp             HHHHHHHHHHHHHTCCGGGGGSCCCCCCCCCCCTTCCCCSCC
T ss_pred             HHHHHHHHhhhcccccccccccccccccccccccCceecCCC
Confidence            999999998888888899999999999999999999999997
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure