Citrus Sinensis ID: 017349

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370---
MEVSQSSTSSSSSQETEISGRNTQPLIPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKKSLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVYA
cccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHccHHHHHcccccccccccccccccccEEEEEEEEcccccEEEEEEEcccccEEcccccccccccccccccEEEEEEccEEEEEccccccccccccEEEEEEcccccEEcccccccccccEEEEEEccEEEEEccccccccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEEcccccccccccEEEEEcccccEEEccccccccccEEEEEEccEEEEEEEccccEEEEEEcccccEEEEcccccccccccccEEEEEEccEEEEEEccccccEEEEEEEEEccccccEEEEEcccccccEEEEEEEEEEc
cccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccccccEEEEEccccccEEEcccccccccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccccEEEccccccccccEEEEEEccEEEEEEcccccccccccEEEEEccccccEEEEccccccccccEEEEEccEEEEEEcccccccccccEEEEccccccEEEccccccccccEEEEEEccEEEEEEcccccEEEEEccccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEccccccEEEEEEcccccccEEEEEcEEEEc
mevsqsstsssssqeteisgrntqplipglpdeIGELcllhvpypyQALVRSVSYSWnkaitdpgFALCKKslslslpylfifsfhkptariqwqaldprsgrwfvlppmpcpkavcpqafactslprqgklfvlggmrsdtetpmqSTIMYRATTNqwqlaspmltprsffasgnvngkimavggtganiNETMTAvecydpesdtwTTAAKLRMGLARydsavmgskmyvtegwtwpfmfsprggvydinkdTWNLMSDGMKEGWTGISIVLEGKLFVisehgdcpmkqynpdddtwryvggdkfpcevmhrpfavngvEGKIYVVSSGLNVAIGRVyeeqnggisaEWKVmtaprafkdlapsscqvvya
mevsqsstsssssqeteisgrntqpliPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKKSLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPrafkdlapsscqvvya
MEVsqsstsssssqeteISGRNTQPLIPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKKSLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVYA
**************************IPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKKSLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMR********STIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDL**********
*****************************LPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKKSLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKF**EVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVYA
********************RNTQPLIPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKKSLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAP********
***********************QPLIPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKKSLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVYA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVSQSSTSSSSSQETEISGRNTQPLIPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKKSLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query373 2.2.26 [Sep-21-2011]
Q8LAW2372 F-box protein AFR OS=Arab yes no 0.978 0.981 0.572 1e-124
Q9C6Z0398 F-box/kelch-repeat protei no no 0.981 0.919 0.398 2e-80
Q93W93434 F-box/kelch-repeat protei no no 0.713 0.612 0.285 8e-29
Q9M2C9358 F-box/kelch-repeat protei no no 0.935 0.974 0.243 5e-23
Q9CAG8376 F-box/kelch-repeat protei no no 0.788 0.781 0.271 1e-22
Q9LM55475 F-box/kelch-repeat protei no no 0.860 0.675 0.258 2e-21
Q0WW40383 F-box/kelch-repeat protei no no 0.782 0.762 0.239 2e-18
Q9M1W7352 F-box/kelch-repeat protei no no 0.664 0.704 0.279 2e-17
O80582409 F-box/kelch-repeat protei no no 0.624 0.569 0.242 1e-14
Q9SJ04372 F-box/kelch-repeat protei no no 0.769 0.771 0.249 3e-14
>sp|Q8LAW2|AFR_ARATH F-box protein AFR OS=Arabidopsis thaliana GN=AFR PE=1 SV=2 Back     alignment and function desciption
 Score =  446 bits (1146), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 213/372 (57%), Positives = 270/372 (72%), Gaps = 7/372 (1%)

Query: 4   SQSSTSSSSSQETEISGRNTQPLIPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITD 63
           + S+ ++ + Q  E +   +QPLI GLP++I ELCLL +PYPY AL RSVS SWNK IT+
Sbjct: 6   TTSNINTINDQAEEETRTKSQPLISGLPNDIAELCLLRLPYPYHALYRSVSSSWNKTITN 65

Query: 64  PGFALCKKSLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMP--CPKAVCPQAF 121
           P F   K+SLS+S PYLF+F+F+K TARIQWQ+LD  SGRWFVLPPMP    K   P A 
Sbjct: 66  PRFLFSKQSLSISSPYLFVFAFNKSTARIQWQSLDLASGRWFVLPPMPNSFTKISSPHAL 125

Query: 122 ACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKI 181
           +C S+PRQGKLFVLGG   +     +S ++Y A TN+W   SPM++PR++F SGNVNGKI
Sbjct: 126 SCASMPRQGKLFVLGGGDVN-----RSAVVYTALTNRWSCISPMMSPRTYFVSGNVNGKI 180

Query: 182 MAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFM 241
           MAVGG+     E  T VE YDP++DTWT   KL M LA+YDSAV+G +M VTEGW WPFM
Sbjct: 181 MAVGGSVGGNGEATTEVESYDPDNDTWTVVKKLPMVLAKYDSAVIGKEMCVTEGWAWPFM 240

Query: 242 FSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRY 301
           F P G VYD ++ TW  MS GMKEGWTG+S+V+  +LFVISEHGD PMK Y  DDDTWRY
Sbjct: 241 FPPMGQVYDSDEGTWREMSGGMKEGWTGVSVVIRDRLFVISEHGDFPMKVYCSDDDTWRY 300

Query: 302 VGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFK 361
           V G+K   E M RPFAV G + +++VV+SG+NVA GRV E QNG  S EW+++++P++  
Sbjct: 301 VSGEKLQGEKMRRPFAVTGADDRVFVVASGINVAEGRVSEGQNGDFSVEWRMVSSPKSSI 360

Query: 362 DLAPSSCQVVYA 373
             +P+SC V+Y 
Sbjct: 361 QFSPASCHVLYV 372
Component of SCF (ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Part of the phyA-mediated signaling transduction pathway leading to the regulation of gene expression and hypocotyls elongation in response to red and far-red light exposure.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9C6Z0|FBK17_ARATH F-box/kelch-repeat protein At1g30090 OS=Arabidopsis thaliana GN=At1g30090 PE=2 SV=1 Back     alignment and function description
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2C9|SKIP4_ARATH F-box/kelch-repeat protein SKIP4 OS=Arabidopsis thaliana GN=SKIP4 PE=1 SV=1 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM55|FBK8_ARATH F-box/kelch-repeat protein At1g22040 OS=Arabidopsis thaliana GN=At1g22040 PE=2 SV=1 Back     alignment and function description
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1W7|SKI30_ARATH F-box/kelch-repeat protein SKIP30 OS=Arabidopsis thaliana GN=SKIP30 PE=1 SV=2 Back     alignment and function description
>sp|O80582|FBK46_ARATH F-box/kelch-repeat protein At2g44130 OS=Arabidopsis thaliana GN=At2g44130 PE=2 SV=2 Back     alignment and function description
>sp|Q9SJ04|SKIP6_ARATH F-box/kelch-repeat protein SKIP6 OS=Arabidopsis thaliana GN=SKIP6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query373
224142085366 predicted protein [Populus trichocarpa] 0.970 0.989 0.718 1e-161
225429762370 PREDICTED: F-box protein AFR [Vitis vini 0.967 0.975 0.653 1e-140
21593163372 unknown [Arabidopsis thaliana] 0.978 0.981 0.577 1e-123
297821769360 hypothetical protein ARALYDRAFT_481310 [ 0.954 0.988 0.578 1e-123
18400571372 F-box protein AFR [Arabidopsis thaliana] 0.978 0.981 0.572 1e-122
255567118292 Protein AFR, putative [Ricinus communis] 0.753 0.962 0.703 1e-120
147855725414 hypothetical protein VITISV_041844 [Viti 0.796 0.717 0.674 1e-115
356518288349 PREDICTED: F-box protein AFR-like [Glyci 0.898 0.959 0.533 1e-105
296081755322 unnamed protein product [Vitis vinifera] 0.734 0.850 0.637 1e-103
357466507346 F-box protein AFR [Medicago truncatula] 0.884 0.953 0.502 4e-90
>gi|224142085|ref|XP_002324389.1| predicted protein [Populus trichocarpa] gi|222865823|gb|EEF02954.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  574 bits (1480), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 260/362 (71%), Positives = 308/362 (85%)

Query: 12  SSQETEISGRNTQPLIPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKK 71
           S  + +   ++ +PLIPGLPDE+ ELCLL++PYPYQALVRSVS SWN+AITDP F + KK
Sbjct: 5   SENQEKTEEKHVEPLIPGLPDEVAELCLLYLPYPYQALVRSVSSSWNRAITDPAFLVSKK 64

Query: 72  SLSLSLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGK 131
           +LSLSLP++F+ +FHK TARIQWQALDPRSGRWFVLPPMPCPK VCP AFACTSLPRQGK
Sbjct: 65  TLSLSLPHVFVLAFHKSTARIQWQALDPRSGRWFVLPPMPCPKTVCPPAFACTSLPRQGK 124

Query: 132 LFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANI 191
           L VLGGMRSDTET M ST +YR++TNQW + SPMLTPRSFFA+GNV GKI+AVGG+ + I
Sbjct: 125 LLVLGGMRSDTETSMDSTFIYRSSTNQWSIGSPMLTPRSFFATGNVKGKIIAVGGSASGI 184

Query: 192 NETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDI 251
           ++++TAVECY+ ES  W  AAK+RMGLARYDSAV+G++MYVTEGWTWPFMFSPR G+YD 
Sbjct: 185 SDSITAVECYNSESGKWGPAAKMRMGLARYDSAVVGNRMYVTEGWTWPFMFSPRAGIYDA 244

Query: 252 NKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEV 311
           +KDTW  MS+GM+EGWTG+S+VL  +LFVISEHGDCPMK Y PD DTW+YVGGD+FP E 
Sbjct: 245 DKDTWQEMSNGMREGWTGLSVVLGDRLFVISEHGDCPMKVYVPDLDTWQYVGGDRFPREA 304

Query: 312 MHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVV 371
           M RPFAVNGVEGK+YVVS GLNVA+G VYE   G    +W+V+ APRAF D APS+CQV+
Sbjct: 305 MQRPFAVNGVEGKVYVVSCGLNVAVGSVYEADKGEFCVKWQVLVAPRAFHDFAPSNCQVL 364

Query: 372 YA 373
           YA
Sbjct: 365 YA 366

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225429762|ref|XP_002282492.1| PREDICTED: F-box protein AFR [Vitis vinifera] Back     alignment and taxonomy information
>gi|21593163|gb|AAM65112.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297821769|ref|XP_002878767.1| hypothetical protein ARALYDRAFT_481310 [Arabidopsis lyrata subsp. lyrata] gi|297324606|gb|EFH55026.1| hypothetical protein ARALYDRAFT_481310 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18400571|ref|NP_565572.1| F-box protein AFR [Arabidopsis thaliana] gi|67460122|sp|Q8LAW2.2|AFR_ARATH RecName: Full=F-box protein AFR; AltName: Full=Protein ATTENUATED FAR-RED RESPONSE; AltName: Full=SKP1-interacting partner 29 gi|4572676|gb|AAD23891.1| expressed protein [Arabidopsis thaliana] gi|18086559|gb|AAL57704.1| At2g24540/F25P17.16 [Arabidopsis thaliana] gi|23507761|gb|AAN38684.1| At2g24540/F25P17.16 [Arabidopsis thaliana] gi|330252496|gb|AEC07590.1| F-box protein AFR [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255567118|ref|XP_002524541.1| Protein AFR, putative [Ricinus communis] gi|223536215|gb|EEF37868.1| Protein AFR, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147855725|emb|CAN81325.1| hypothetical protein VITISV_041844 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356518288|ref|XP_003527811.1| PREDICTED: F-box protein AFR-like [Glycine max] Back     alignment and taxonomy information
>gi|296081755|emb|CBI20760.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357466507|ref|XP_003603538.1| F-box protein AFR [Medicago truncatula] gi|355492586|gb|AES73789.1| F-box protein AFR [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query373
TAIR|locus:2046683372 AFR "ATTENUATED FAR-RED RESPON 0.924 0.927 0.599 1.9e-115
TAIR|locus:2198304398 AT1G30090 "AT1G30090" [Arabido 0.930 0.871 0.398 9.3e-75
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.715 0.615 0.282 1.3e-29
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.844 0.837 0.269 7.6e-25
TAIR|locus:2098926358 SKIP4 "AT3G61350" [Arabidopsis 0.887 0.924 0.253 1.2e-24
TAIR|locus:2032855383 AT1G16250 "AT1G16250" [Arabido 0.825 0.804 0.246 6e-19
TAIR|locus:2077299352 AT3G63220 "AT3G63220" [Arabido 0.675 0.715 0.305 9.4e-18
TAIR|locus:2030601475 AT1G22040 "AT1G22040" [Arabido 0.372 0.292 0.259 1.6e-15
RGD|1306290302 Ivns1abp "influenza virus NS1A 0.627 0.774 0.256 5.7e-15
TAIR|locus:2175143393 AT5G60570 "AT5G60570" [Arabido 0.715 0.679 0.253 9.9e-15
TAIR|locus:2046683 AFR "ATTENUATED FAR-RED RESPONSE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1138 (405.7 bits), Expect = 1.9e-115, P = 1.9e-115
 Identities = 211/352 (59%), Positives = 261/352 (74%)

Query:    23 TQPLIPGLPDEIGELCLLHVPYPYQALVRSVSYSWNKAITDPGFALCKKSLSLSLPYLFI 82
             +QPLI GLP++I ELCLL +PYPY AL RSVS SWNK IT+P F   K+SLS+S PYLF+
Sbjct:    25 SQPLISGLPNDIAELCLLRLPYPYHALYRSVSSSWNKTITNPRFLFSKQSLSISSPYLFV 84

Query:    83 FSFHKPTARIQWQALDPRSGRWFVLPPMP--CPKAVCPQAFACTSLPRQGKLFVLGGMRS 140
             F+F+K TARIQWQ+LD  SGRWFVLPPMP    K   P A +C S+PRQGKLFVLGG   
Sbjct:    85 FAFNKSTARIQWQSLDLASGRWFVLPPMPNSFTKISSPHALSCASMPRQGKLFVLGG--G 142

Query:   141 DTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVEC 200
             D     +S ++Y A TN+W   SPM++PR++F SGNVNGKIMAVGG+     E  T VE 
Sbjct:   143 DVN---RSAVVYTALTNRWSCISPMMSPRTYFVSGNVNGKIMAVGGSVGGNGEATTEVES 199

Query:   201 YDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMS 260
             YDP++DTWT   KL M LA+YDSAV+G +M VTEGW WPFMF P G VYD ++ TW  MS
Sbjct:   200 YDPDNDTWTVVKKLPMVLAKYDSAVIGKEMCVTEGWAWPFMFPPMGQVYDSDEGTWREMS 259

Query:   261 DGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNG 320
              GMKEGWTG+S+V+  +LFVISEHGD PMK Y  DDDTWRYV G+K   E M RPFAV G
Sbjct:   260 GGMKEGWTGVSVVIRDRLFVISEHGDFPMKVYCSDDDTWRYVSGEKLQGEKMRRPFAVTG 319

Query:   321 VEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVY 372
              + +++VV+SG+NVA GRV E QNG  S EW+++++P++    +P+SC V+Y
Sbjct:   320 ADDRVFVVASGINVAEGRVSEGQNGDFSVEWRMVSSPKSSIQFSPASCHVLY 371
GO:0005737 "cytoplasm" evidence=ISM
GO:0005515 "protein binding" evidence=IPI
GO:0009585 "red, far-red light phototransduction" evidence=IMP
GO:0010017 "red or far-red light signaling pathway" evidence=IMP
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009813 "flavonoid biosynthetic process" evidence=RCA
GO:0010224 "response to UV-B" evidence=RCA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA
TAIR|locus:2198304 AT1G30090 "AT1G30090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098926 SKIP4 "AT3G61350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032855 AT1G16250 "AT1G16250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077299 AT3G63220 "AT3G63220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030601 AT1G22040 "AT1G22040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1306290 Ivns1abp "influenza virus NS1A binding protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2175143 AT5G60570 "AT5G60570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LAW2AFR_ARATHNo assigned EC number0.57250.97850.9811yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query373
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-11
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-08
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-07
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 1e-06
smart0061247 smart00612, Kelch, Kelch domain 6e-06
smart0061247 smart00612, Kelch, Kelch domain 8e-06
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 3e-04
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 0.002
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.004
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 64.8 bits (158), Expect = 2e-11
 Identities = 45/207 (21%), Positives = 77/207 (37%), Gaps = 20/207 (9%)

Query: 132 LFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANI 191
           ++ +GGM  +    + S + Y   T  W     ++ PR        N +I  +GG   +I
Sbjct: 297 IYFIGGMNKNNL-SVNSVVSYDTKTKSWNKVPELIYPRKNPGVTVFNNRIYVIGGIYNSI 355

Query: 192 NETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSK--MYVTEGWTWPFMFSPRGGVY 249
           +  +  VE + P    W     L     RY+  V+     +YV  G +           +
Sbjct: 356 S--LNTVESWKPGESKWREEPPLIF--PRYNPCVVNVNNLIYVIGGISKNDELLKTVECF 411

Query: 250 DINKDTWNLMSDGMKEGWTGISIVLEGKLFVIS-------EHGDCPMKQYNPDDDTWRYV 302
            +N + W+  S      + G +I  +GK++VI              ++ YNP  + W   
Sbjct: 412 SLNTNKWSKGSPLPISHYGGCAIYHDGKIYVIGGISYIDNIKVYNIVESYNPVTNKWT-- 469

Query: 303 GGDKFPCEVMHRPFA-VNGVEGKIYVV 328
              +       R  A +     KIYVV
Sbjct: 470 ---ELSSLNFPRINASLCIFNNKIYVV 493

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 373
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PLN02193470 nitrile-specifier protein 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.98
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.95
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.93
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.93
KOG1230 521 consensus Protein containing repeated kelch motifs 99.92
KOG1230 521 consensus Protein containing repeated kelch motifs 99.89
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.87
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.82
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.64
PF1396450 Kelch_6: Kelch motif 99.27
PF1396450 Kelch_6: Kelch motif 99.13
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.05
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.05
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.04
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.99
PF1341549 Kelch_3: Galactose oxidase, central domain 98.98
PF1341549 Kelch_3: Galactose oxidase, central domain 98.9
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.88
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.82
smart0061247 Kelch Kelch domain. 98.8
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.79
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.71
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.66
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.64
smart0061247 Kelch Kelch domain. 98.62
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.61
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.61
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.6
KOG0281499 consensus Beta-TrCP (transducin repeats containing 98.55
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 98.5
PLN02772 398 guanylate kinase 98.29
PF1385442 Kelch_5: Kelch motif 98.27
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.25
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.25
PF1385442 Kelch_5: Kelch motif 98.18
PLN02772 398 guanylate kinase 98.09
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.08
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.07
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.95
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.91
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.88
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.85
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.72
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.53
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.5
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.43
PF12768281 Rax2: Cortical protein marker for cell polarity 97.29
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.17
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.13
PF12768 281 Rax2: Cortical protein marker for cell polarity 96.98
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 96.86
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.8
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.79
KOG2055514 consensus WD40 repeat protein [General function pr 96.79
KOG2055514 consensus WD40 repeat protein [General function pr 96.76
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.74
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 96.64
PF12217367 End_beta_propel: Catalytic beta propeller domain o 96.6
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 96.57
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 96.55
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.5
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.46
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 96.4
PRK13684334 Ycf48-like protein; Provisional 96.35
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.33
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.33
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.24
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.92
PRK04792448 tolB translocation protein TolB; Provisional 95.81
PLN029191057 haloacid dehalogenase-like hydrolase family protei 95.79
KOG2997366 consensus F-box protein FBX9 [General function pre 95.65
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.5
PRK11028330 6-phosphogluconolactonase; Provisional 95.41
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 95.23
COG1520370 FOG: WD40-like repeat [Function unknown] 94.96
KOG0310 487 consensus Conserved WD40 repeat-containing protein 94.92
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.88
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 94.87
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 94.87
PLN00033398 photosystem II stability/assembly factor; Provisio 94.86
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 94.78
PRK05137435 tolB translocation protein TolB; Provisional 94.77
KOG0310 487 consensus Conserved WD40 repeat-containing protein 94.72
PRK00178430 tolB translocation protein TolB; Provisional 94.68
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 94.59
PRK03629429 tolB translocation protein TolB; Provisional 94.53
KOG0316307 consensus Conserved WD40 repeat-containing protein 94.39
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 94.39
PRK04922433 tolB translocation protein TolB; Provisional 94.3
smart00284255 OLF Olfactomedin-like domains. 94.28
PRK13684334 Ycf48-like protein; Provisional 94.26
PRK00178430 tolB translocation protein TolB; Provisional 94.2
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.19
KOG0289506 consensus mRNA splicing factor [General function p 93.93
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.81
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.76
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.47
PLN00181793 protein SPA1-RELATED; Provisional 93.38
PRK04792448 tolB translocation protein TolB; Provisional 93.26
PRK05137435 tolB translocation protein TolB; Provisional 93.17
PRK04922433 tolB translocation protein TolB; Provisional 92.61
smart00284255 OLF Olfactomedin-like domains. 91.84
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 91.79
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 91.52
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 91.46
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 91.42
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.22
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 91.22
PRK04043419 tolB translocation protein TolB; Provisional 91.22
PRK11028330 6-phosphogluconolactonase; Provisional 90.94
PTZ00421 493 coronin; Provisional 90.86
PLN00033398 photosystem II stability/assembly factor; Provisio 90.83
PLN00181793 protein SPA1-RELATED; Provisional 90.78
PRK04043419 tolB translocation protein TolB; Provisional 90.29
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 90.15
PRK03629429 tolB translocation protein TolB; Provisional 90.05
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 89.82
KOG0296399 consensus Angio-associated migratory cell protein 89.56
KOG0281499 consensus Beta-TrCP (transducin repeats containing 88.74
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 88.73
KOG0316307 consensus Conserved WD40 repeat-containing protein 88.2
PRK02889427 tolB translocation protein TolB; Provisional 87.91
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 87.39
PTZ00420 568 coronin; Provisional 87.26
PTZ00421 493 coronin; Provisional 87.07
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 86.98
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 86.71
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 86.62
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 86.29
KOG0289506 consensus mRNA splicing factor [General function p 85.97
KOG0296 399 consensus Angio-associated migratory cell protein 85.93
PRK01742429 tolB translocation protein TolB; Provisional 85.87
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 85.79
COG1520 370 FOG: WD40-like repeat [Function unknown] 85.1
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 84.67
KOG0266456 consensus WD40 repeat-containing protein [General 84.41
PF12217367 End_beta_propel: Catalytic beta propeller domain o 83.96
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 83.83
KOG0266456 consensus WD40 repeat-containing protein [General 82.72
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 82.5
KOG2111346 consensus Uncharacterized conserved protein, conta 82.48
KOG0278334 consensus Serine/threonine kinase receptor-associa 82.46
KOG0278334 consensus Serine/threonine kinase receptor-associa 82.05
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 81.86
COG3386307 Gluconolactonase [Carbohydrate transport and metab 81.01
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 80.79
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 80.79
KOG0649325 consensus WD40 repeat protein [General function pr 80.67
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=3.5e-45  Score=346.79  Aligned_cols=318  Identities=25%  Similarity=0.400  Sum_probs=257.0

Q ss_pred             CCCCCChHHHHHhhccCCcc----chhhhhhhcHhHHhhccCch---hhHhhhhccCCCCEEEEEEecCC--CCceeEEE
Q 017349           26 LIPGLPDEIGELCLLHVPYP----YQALVRSVSYSWNKAITDPG---FALCKKSLSLSLPYLFIFSFHKP--TARIQWQA   96 (373)
Q Consensus        26 ~~~~LP~dl~~~il~rlp~~----~l~~~~~v~k~W~~l~~~~~---~~~~~~~~~~~~~~l~~~gg~~~--~~~~~~~~   96 (373)
                      -+|-||+..+.++....+..    ....+-.-.|+|+.+.....   ..+.+.+. ...+.||++||...  .....+..
T Consensus       227 r~~ll~~~~l~~~v~~~~~~~~~~~c~~~l~ea~~~~~~~~~~~~~~~~~t~~r~-~~~~~l~~vGG~~~~~~~~~~ve~  305 (571)
T KOG4441|consen  227 RLPLLPPQFLVEIVESEPLIKRDSACRDLLDEAKKYHLLPQRRPVMQSPRTRPRR-SVSGKLVAVGGYNRQGQSLRSVEC  305 (571)
T ss_pred             CccCCCHHHHHHHHhhhhhhccCHHHHHHHHHHHHHhhCcccCccccCCCcccCc-CCCCeEEEECCCCCCCcccceeEE
Confidence            34778888777777666521    11112222335555533221   11111111 45788999999664  55677899


Q ss_pred             eeCCCCCeeeCCCCCCCCCCCCCceEEEEeccCCEEEEEcCccCCCCCCcceeEEEeCCCCceeccCCCCCcceeeeeeE
Q 017349           97 LDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGN  176 (373)
Q Consensus        97 ~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~r~~~~~~~  176 (373)
                      |||.++.|..+++||.++    ..++++++  +++||++||.+. +...++.+++||+.+++|+.+++|+.+|..+++++
T Consensus       306 yd~~~~~w~~~a~m~~~r----~~~~~~~~--~~~lYv~GG~~~-~~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~v~~  378 (571)
T KOG4441|consen  306 YDPKTNEWSSLAPMPSPR----CRVGVAVL--NGKLYVVGGYDS-GSDRLSSVERYDPRTNQWTPVAPMNTKRSDFGVAV  378 (571)
T ss_pred             ecCCcCcEeecCCCCccc----ccccEEEE--CCEEEEEccccC-CCcccceEEEecCCCCceeccCCccCccccceeEE
Confidence            999999999999999554    67888888  999999999963 34678899999999999999999999999999999


Q ss_pred             eCCeEEEEcCCCCCCCCcCceEEEEeCCCCeEEeccCCccccccccEEEECCEEEEEeCccCCCccCCceEEEeCCCCce
Q 017349          177 VNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTW  256 (373)
Q Consensus       177 ~~~~iyv~GG~~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~~~~~~~~~~~~~lyv~gG~~~~~~~~~~i~~yd~~~~~W  256 (373)
                      ++|.||++||.+  +...++++|+|||.+++|..+++|+.+|+++++++++|+||++||.+.....++++++||+.+++|
T Consensus       379 l~g~iYavGG~d--g~~~l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~~~~~l~sve~YDP~t~~W  456 (571)
T KOG4441|consen  379 LDGKLYAVGGFD--GEKSLNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDGSSNCLNSVECYDPETNTW  456 (571)
T ss_pred             ECCEEEEEeccc--cccccccEEEecCCCCcccccCCCCcceeeeEEEEECCEEEEEcCcCCCccccceEEEEcCCCCce
Confidence            999999999998  888899999999999999999999999999999999999999999986666889999999999999


Q ss_pred             eecccCccCCcceEE-EEECCeEEEEeeCC----CcceEEEeCCCCceeeecCCCCCCcccccceEEEEeCCEEEEEeCC
Q 017349          257 NLMSDGMKEGWTGIS-IVLEGKLFVISEHG----DCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSG  331 (373)
Q Consensus       257 ~~~~~~~~~~~~~~~-~~~~~~l~v~gg~~----~~~~~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~l~i~GG~  331 (373)
                      +.+++ +..++.+++ ++++++||++||.+    ..++++||+++++|+.+..|+.+    +...+++..+++||++||.
T Consensus       457 ~~~~~-M~~~R~~~g~a~~~~~iYvvGG~~~~~~~~~VE~ydp~~~~W~~v~~m~~~----rs~~g~~~~~~~ly~vGG~  531 (571)
T KOG4441|consen  457 TLIAP-MNTRRSGFGVAVLNGKIYVVGGFDGTSALSSVERYDPETNQWTMVAPMTSP----RSAVGVVVLGGKLYAVGGF  531 (571)
T ss_pred             eecCC-cccccccceEEEECCEEEEECCccCCCccceEEEEcCCCCceeEcccCccc----cccccEEEECCEEEEEecc
Confidence            99997 655555554 89999999999976    34589999999999999888888    8899999999999999995


Q ss_pred             cee-eeeEEEEeecCCcccceEEecCCCCc
Q 017349          332 LNV-AIGRVYEEQNGGISAEWKVMTAPRAF  360 (373)
Q Consensus       332 ~~~-~~~~~~~~~~d~~~~~W~~~~~p~~~  360 (373)
                      ... ....+..  ||+++++|+....|...
T Consensus       532 ~~~~~l~~ve~--ydp~~d~W~~~~~~~~~  559 (571)
T KOG4441|consen  532 DGNNNLNTVEC--YDPETDTWTEVTEPESG  559 (571)
T ss_pred             cCccccceeEE--cCCCCCceeeCCCcccc
Confidence            432 3344444  99999999998774433

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query373
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-10
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 1e-10
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 1e-10
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 3e-10
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 4e-10
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-09
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-05
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 4e-09
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 2e-07
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 3e-05
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-04
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 100/240 (41%), Gaps = 16/240 (6%)
Query: 69  CKKSLSLSLPYLFIFSFHKPTARIQW-QALDPRSGRWFVLPPMPCPKAVCPQAFACTSLP 127
           C+  +      +F       + R++   + DP   +W  +  M   ++    A       
Sbjct: 53  CRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVL----- 107
Query: 128 RQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGT 187
             G L+ +GG   D  T + S   Y   +N+W   +PM T RS    G V G + AVGG 
Sbjct: 108 -NGLLYAVGGF--DGSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGY 164
Query: 188 GANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGG 247
                + ++ VECY+  ++ WT  A++    +     V+ + +Y   G   P +      
Sbjct: 165 DVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSV-E 223
Query: 248 VYDINKDTWNLMSD-GMKEGWTGISIVLEGKLFVI-SEHGDCPM---KQYNPDDDTWRYV 302
           VYD   + W  ++D  M     G+  V  G L+V+  + G C +   + YNP  D W  V
Sbjct: 224 VYDPTTNAWRQVADMNMCRRNAGVCAV-NGLLYVVGGDDGSCNLASVEYYNPTTDKWTVV 282
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query373
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-38
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 6e-32
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 8e-14
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-38
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-35
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-25
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-23
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-37
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-17
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-37
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-29
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-24
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-24
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-23
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-36
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-29
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 8e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-23
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-18
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-36
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-36
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-19
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 1e-12
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-09
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-24
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 5e-14
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-09
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-12
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 5e-07
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 6e-07
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-06
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-05
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 4e-04
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
 Score =  139 bits (351), Expect = 2e-38
 Identities = 43/248 (17%), Positives = 87/248 (35%), Gaps = 31/248 (12%)

Query: 96  ALDPRSGRWF-VLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTI---- 150
           A DP     +        P+       +  +   Q +++V+GG+  D E   Q       
Sbjct: 28  AYDPMENECYLTALAEQIPRN----HSSIVTQ--QNQVYVVGGLYVDEENKDQPLQSYFF 81

Query: 151 MYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTT 210
                +++W    P+ + R  F  G V+ KI  V G       ++ +V CYDP +  W+ 
Sbjct: 82  QLDNVSSEWVGLPPLPSARCLFGLGEVDDKIYVVAGKDLQTEASLDSVLCYDPVAAKWSE 141

Query: 211 AAKLRMGLARYD--SAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWT 268
                + +  Y          +Y   G T     + R  +Y+  K  W  ++  MK   +
Sbjct: 142 VKN--LPIKVYGHNVISHNGMIYCLGGKTDDKKCTNRVFIYNPKKGDWKDLAP-MKTPRS 198

Query: 269 GISI-VLEGKLFVIS-EHGDCPMKQ---YNPDDDTWRYVGGDKFPCEVMHRP---FAVNG 320
              + + +GK+ +      D        ++   + W  +           +     ++  
Sbjct: 199 MFGVAIHKGKIVIAGGVTEDGLSASVEAFDLKTNKWEVM-------TEFPQERSSISLVS 251

Query: 321 VEGKIYVV 328
           + G +Y +
Sbjct: 252 LAGSLYAI 259
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query373
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.03
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.02
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.01
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.81
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.71
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.59
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.59
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.47
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.42
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.28
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.12
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.1
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.0
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.92
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.9
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.89
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.89
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.8
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.75
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.64
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.56
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.53
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.52
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.51
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.51
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.5
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.48
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.47
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.46
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.46
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.46
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.45
3jrp_A379 Fusion protein of protein transport protein SEC13 97.45
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.43
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.43
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.42
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.42
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.38
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.36
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.35
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.34
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.32
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.29
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.27
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.24
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.23
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.19
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.19
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 97.18
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.16
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.15
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.14
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.13
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.12
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.11
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.11
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.08
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.01
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.0
3jro_A 753 Fusion protein of protein transport protein SEC13 96.99
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.94
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.94
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.93
3v65_B386 Low-density lipoprotein receptor-related protein; 96.93
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.93
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.9
3jro_A 753 Fusion protein of protein transport protein SEC13 96.88
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.87
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.86
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 96.85
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.82
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.81
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.81
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.8
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.79
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.79
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.71
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.68
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.68
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.67
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.67
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.66
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 96.62
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.62
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.6
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.59
2pm7_B297 Protein transport protein SEC13, protein transport 96.56
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.54
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.5
2pm7_B297 Protein transport protein SEC13, protein transport 96.49
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.48
3ott_A758 Two-component system sensor histidine kinase; beta 96.48
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.47
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.47
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 96.42
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 96.41
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.38
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.36
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.32
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.31
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.29
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.28
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.28
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.27
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.26
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.25
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.24
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.24
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.22
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.22
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.21
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.2
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 96.2
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.19
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.18
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.16
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.15
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.06
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.02
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.99
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 95.98
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 95.97
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.96
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.94
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.94
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.94
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.91
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.88
3v65_B386 Low-density lipoprotein receptor-related protein; 95.87
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.87
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 95.85
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.82
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.82
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 95.82
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.81
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.81
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 95.8
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 95.8
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.79
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.78
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 95.78
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.74
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.71
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.7
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.7
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.68
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.6
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.57
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.57
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.56
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.56
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.51
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 95.49
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.43
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 95.43
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 95.43
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.42
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.41
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.41
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.39
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.37
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 95.35
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 95.33
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.32
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.32
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.31
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.28
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.25
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.25
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.23
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.2
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.16
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 95.12
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.08
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.08
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.08
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.07
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.06
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.96
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.93
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 94.91
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 94.9
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.89
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.89
2ymu_A577 WD-40 repeat protein; unknown function, two domain 94.85
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 94.72
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 94.67
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.66
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 94.62
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 94.62
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 94.6
2ymu_A577 WD-40 repeat protein; unknown function, two domain 94.58
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.58
2xyi_A430 Probable histone-binding protein CAF1; transcripti 94.49
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.41
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.36
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 94.33
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.22
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 94.22
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.13
3p5b_L400 Low density lipoprotein receptor variant; B-propel 94.06
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 94.03
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 93.99
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 93.9
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.9
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 93.9
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.85
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 93.83
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 93.57
3ott_A 758 Two-component system sensor histidine kinase; beta 93.55
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 93.52
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 93.48
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 93.46
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 93.34
1itv_A195 MMP9; adaptive molecular recognition, beta propell 93.2
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 93.16
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 93.14
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 93.1
2xyi_A430 Probable histone-binding protein CAF1; transcripti 92.96
2p4o_A306 Hypothetical protein; putative lactonase, structur 92.83
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 92.83
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 92.83
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 92.76
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 92.63
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 92.54
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 92.48
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 92.37
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 92.34
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 92.32
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 92.31
1itv_A195 MMP9; adaptive molecular recognition, beta propell 92.09
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.95
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 91.93
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 91.75
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 91.68
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 91.56
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 91.5
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 91.48
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 91.48
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.06
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 90.99
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 90.95
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 90.74
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 90.24
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 89.79
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 89.77
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 89.62
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 89.58
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 89.46
2qe8_A343 Uncharacterized protein; structural genomics, join 89.28
2ece_A462 462AA long hypothetical selenium-binding protein; 89.23
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 89.22
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 89.22
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 89.07
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 88.93
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 88.52
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 88.38
1k32_A 1045 Tricorn protease; protein degradation, substrate g 87.87
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 87.84
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 87.41
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 87.3
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 86.49
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 86.38
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 85.81
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 85.65
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 84.73
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 84.02
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 83.95
1k32_A 1045 Tricorn protease; protein degradation, substrate g 83.77
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 83.04
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 82.45
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 82.4
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 81.92
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 81.63
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 80.91
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.2e-44  Score=318.80  Aligned_cols=277  Identities=20%  Similarity=0.371  Sum_probs=231.5

Q ss_pred             CCCEEEEEEecCCCCceeEEEeeCCCCCeeeCCCCCCCCCCCCCceEEEEeccCCEEEEEcCccCCCCCCcceeEEEeCC
Q 017349           76 SLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRAT  155 (373)
Q Consensus        76 ~~~~l~~~gg~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~yd~~  155 (373)
                      .++.||++||.......++++||+.+++|..++++|.++    ..++++++  +++||++||....  ...+++++||+.
T Consensus        14 ~~~~i~v~GG~~~~~~~~~~~~d~~~~~W~~~~~~p~~r----~~~~~~~~--~~~lyv~GG~~~~--~~~~~~~~~d~~   85 (302)
T 2xn4_A           14 LPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRR----CRAGMVYM--AGLVFAVGGFNGS--LRVRTVDSYDPV   85 (302)
T ss_dssp             -CEEEEEECCBSSSBCCCEEEEETTTTEEEEECCCSSCC----BSCEEEEE--TTEEEEESCBCSS--SBCCCEEEEETT
T ss_pred             CCCEEEEECCCCCCCCCcEEEEcCcCCcEeEcccCCccc----ccceEEEE--CCEEEEEeCcCCC--ccccceEEECCC
Confidence            467899999976666678999999999999999998544    66777777  9999999998543  456899999999


Q ss_pred             CCceeccCCCCCcceeeeeeEeCCeEEEEcCCCCCCCCcCceEEEEeCCCCeEEeccCCccccccccEEEECCEEEEEeC
Q 017349          156 TNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEG  235 (373)
Q Consensus       156 t~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~~~~~~~~~~~~~lyv~gG  235 (373)
                      +++|+.++++|.+|..|+++.++++||++||.+  ....++++++||+.+++|+.++++|.+|..+++++++++||++||
T Consensus        86 ~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~--~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG  163 (302)
T 2xn4_A           86 KDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFD--GSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGG  163 (302)
T ss_dssp             TTEEEEECCCSSCCBSCEEEEETTEEEEEEEEC--SSCEEEEEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEECC
T ss_pred             CCceeeCCCCCccccceEEEEECCEEEEEcCCC--CCccCceEEEEeCCCCeEeecCCCCCcccCceEEEECCEEEEEeC
Confidence            999999999999999999999999999999987  556678999999999999999999999999999999999999999


Q ss_pred             ccCCC-ccCCceEEEeCCCCceeecccCccCCcceEE-EEECCeEEEEeeCC----CcceEEEeCCCCceeeecCCCCCC
Q 017349          236 WTWPF-MFSPRGGVYDINKDTWNLMSDGMKEGWTGIS-IVLEGKLFVISEHG----DCPMKQYNPDDDTWRYVGGDKFPC  309 (373)
Q Consensus       236 ~~~~~-~~~~~i~~yd~~~~~W~~~~~~~~~~~~~~~-~~~~~~l~v~gg~~----~~~~~~yd~~~~~W~~~~~~~~~~  309 (373)
                      ..... ...+.+++||+.+++|+.++. ++.++..++ ++++++||++||.+    ..++++||+++++|+.++.+|.+ 
T Consensus       164 ~~~~~~~~~~~~~~yd~~~~~W~~~~~-~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~~~~-  241 (302)
T 2xn4_A          164 YDVASRQCLSTVECYNATTNEWTYIAE-MSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMC-  241 (302)
T ss_dssp             EETTTTEECCCEEEEETTTTEEEEECC-CSSCCBSCEEEEETTEEEEECCBSSSSBCCCEEEEETTTTEEEEECCCSSC-
T ss_pred             CCCCCCccccEEEEEeCCCCcEEECCC-CccccccccEEEECCEEEEECCCCCCcccceEEEEeCCCCCEeeCCCCCCc-
Confidence            87543 346889999999999999976 455554444 78899999999975    46899999999999999987777 


Q ss_pred             cccccceEEEEeCCEEEEEeCCcee-eeeEEEEeecCCcccceEEecCCCCcCcceeeeeE
Q 017349          310 EVMHRPFAVNGVEGKIYVVSSGLNV-AIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQ  369 (373)
Q Consensus       310 ~~~~~~~~~~~~~~~l~i~GG~~~~-~~~~~~~~~~d~~~~~W~~~~~p~~~~~~~~~~~~  369 (373)
                         +..++++.++++|||+||.... ...+++.  ||+++++|+.++.+.+..+...+.|.
T Consensus       242 ---r~~~~~~~~~~~i~v~GG~~~~~~~~~v~~--yd~~~~~W~~~~~~~~~~r~~~~~~~  297 (302)
T 2xn4_A          242 ---RRNAGVCAVNGLLYVVGGDDGSCNLASVEY--YNPTTDKWTVVSSCMSTGRSYAGVTV  297 (302)
T ss_dssp             ---CBSCEEEEETTEEEEECCBCSSSBCCCEEE--EETTTTEEEECSSCCSSCCBSCEEEE
T ss_pred             ---cccCeEEEECCEEEEECCcCCCcccccEEE--EcCCCCeEEECCcccCcccccceEEE
Confidence               7788999999999999996432 2344555  99999999998743334444444443
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 373
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-14
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-04
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Galactose oxidase, central domain
family: Galactose oxidase, central domain
domain: Galactose oxidase, central domain
species: Fungi (Fusarium sp.) [TaxId: 29916]

 Score = 71.8 bits (174), Expect = 2e-14
 Identities = 39/220 (17%), Positives = 67/220 (30%), Gaps = 24/220 (10%)

Query: 94  WQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRSDT----ETPMQST 149
           + A  P  GRW     +P          A    P  G++ +    R+D        +  T
Sbjct: 1   YTAPQPGLGRWGPTIDLPIV------PAAAAIEPTSGRVLMWSSYRNDAFGGSPGGITLT 54

Query: 150 IMYRATTNQWQLASPMLTPRSFFASGNV---NGKIMAVGGTGANINETMTAVECYDPESD 206
             +  +T      +  +T    F  G     NG+I+  GG  A           YD  SD
Sbjct: 55  SSWDPSTGIVSDRTVTVTKHDMFCPGISMDGNGQIVVTGGNDAKK------TSLYDSSSD 108

Query: 207 TWTTAAKLRMGLARYDSAVMGS-KMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKE 265
           +W     +++      SA M   +++   G     +F   G VY  +  TW  + +    
Sbjct: 109 SWIPGPDMQVARGYQSSATMSDGRVFTIGGSWSGGVFEKNGEVYSPSSKTWTSLPNAKVN 168

Query: 266 GW----TGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRY 301
                        +   ++         +        W Y
Sbjct: 169 PMLTADKQGLYRSDNHAWLFGWKKGSVFQAGPSTAMNWYY 208
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query373
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.96
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.93
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.95
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.22
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.09
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.65
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.62
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.45
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.42
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.29
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.26
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.15
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.08
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.08
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.94
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.89
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.88
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.86
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.76
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.56
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 96.4
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 96.4
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.29
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.23
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.01
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 95.92
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.89
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 95.78
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.48
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 95.44
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 95.38
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.31
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 95.29
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.18
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.97
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.82
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.79
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.79
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 94.75
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.66
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 94.45
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.3
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.16
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 93.89
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 93.78
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 93.42
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 93.37
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 93.12
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 92.92
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 92.9
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.85
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.67
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 92.24
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.86
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 91.5
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.31
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 89.89
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 89.52
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 89.08
d1tbga_340 beta1-subunit of the signal-transducing G protein 88.89
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 88.68
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 87.94
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 87.91
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 86.81
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 85.28
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 84.42
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 84.06
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 83.98
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 81.38
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 81.28
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 80.73
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.3e-39  Score=281.13  Aligned_cols=266  Identities=21%  Similarity=0.353  Sum_probs=226.3

Q ss_pred             CCCEEEEEEecCCCCceeEEEeeCCCCCeeeCCCCCCCCCCCCCceEEEEeccCCEEEEEcCccC--CCCCCcceeEEEe
Q 017349           76 SLPYLFIFSFHKPTARIQWQALDPRSGRWFVLPPMPCPKAVCPQAFACTSLPRQGKLFVLGGMRS--DTETPMQSTIMYR  153 (373)
Q Consensus        76 ~~~~l~~~gg~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~GG~~~--~~~~~~~~~~~yd  153 (373)
                      .++.||++||.......++++||+.+++|..+++||.++    ..|+++++  +++||++||...  ++....+++++||
T Consensus         3 ~g~~iyv~GG~~~~~~~~~~~yd~~t~~W~~~~~~p~~R----~~~~~~~~--~~~iyv~GG~~~~~~~~~~~~~~~~yd   76 (288)
T d1zgka1           3 VGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVPR----SGLAGCVV--GGLLYAVGGRNNSPDGNTDSSALDCYN   76 (288)
T ss_dssp             CCCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSCC----BSCEEEEE--TTEEEEECCEEEETTEEEECCCEEEEE
T ss_pred             cCCEEEEECCcCCCCCceEEEEECCCCeEEECCCCCCcc----ceeEEEEE--CCEEEEEeCcccCCCCccccchhhhcc
Confidence            467899999987777778999999999999999999554    67777777  999999999752  2234567999999


Q ss_pred             CCCCceeccCCCCCcceeeeeeEeCCeEEEEcCCCCCCCCcCceEEEEeCCCCeEEeccCCccccccccEEEECCEEEEE
Q 017349          154 ATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVT  233 (373)
Q Consensus       154 ~~t~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~~~~~~~~~~~~~lyv~  233 (373)
                      +.+++|++++++|.+|..|+++.+++++|++||..  .....+..+.||+.++.|...+.++.+|..++++..++++|++
T Consensus        77 ~~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~  154 (288)
T d1zgka1          77 PMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSH--GCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAV  154 (288)
T ss_dssp             TTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEE--TTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEE
T ss_pred             cccccccccccccceecceeccccceeeEEeccee--cccccceeeeeccccCccccccccccccccceeeeeeecceEe
Confidence            99999999999999999999999999999999987  6677889999999999999999999999999999999999999


Q ss_pred             eCccCCCccCCceEEEeCCCCceeecccCccCCcceEEEEECCeEEEEeeCC----CcceEEEeCCCCceeeecCCCCCC
Q 017349          234 EGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHG----DCPMKQYNPDDDTWRYVGGDKFPC  309 (373)
Q Consensus       234 gG~~~~~~~~~~i~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~l~v~gg~~----~~~~~~yd~~~~~W~~~~~~~~~~  309 (373)
                      ||... ......++.||+.+++|...+..........+++.+++|+++||..    ....++||..+++|+.++.+|.+ 
T Consensus       155 GG~~~-~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~~~p~~-  232 (288)
T d1zgka1         155 GGFDG-TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHR-  232 (288)
T ss_dssp             CCBCS-SCBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECCCCSSC-
T ss_pred             cCccc-ccccceEEEeeccccccccccccccccccccccceeeeEEEecCccccccccceeeeeecceeeecccCccCc-
Confidence            99863 4455789999999999998876444444445588999999999876    46889999999999999877776 


Q ss_pred             cccccceEEEEeCCEEEEEeCCcee-eeeEEEEeecCCcccceEEecC
Q 017349          310 EVMHRPFAVNGVEGKIYVVSSGLNV-AIGRVYEEQNGGISAEWKVMTA  356 (373)
Q Consensus       310 ~~~~~~~~~~~~~~~l~i~GG~~~~-~~~~~~~~~~d~~~~~W~~~~~  356 (373)
                         +..++++.++++|||+||.... ...+++.  ||+++++|+.+..
T Consensus       233 ---r~~~~~~~~~~~l~v~GG~~~~~~~~~v~~--yd~~~~~W~~~~~  275 (288)
T d1zgka1         233 ---RSALGITVHQGRIYVLGGYDGHTFLDSVEC--YDPDTDTWSEVTR  275 (288)
T ss_dssp             ---CBSCEEEEETTEEEEECCBCSSCBCCEEEE--EETTTTEEEEEEE
T ss_pred             ---ccceEEEEECCEEEEEecCCCCeecceEEE--EECCCCEEEECCC
Confidence               7889999999999999996433 2344544  9999999998853
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure