Citrus Sinensis ID: 017471
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 371 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FL12 | 592 | Protease Do-like 9 OS=Ara | yes | no | 0.706 | 0.442 | 0.839 | 1e-134 | |
| O82261 | 607 | Protease Do-like 2, chlor | no | no | 0.727 | 0.444 | 0.549 | 8e-86 | |
| Q9FIV6 | 586 | Protease Do-like 10, mito | no | no | 0.695 | 0.440 | 0.528 | 1e-73 | |
| Q9SHZ0 | 518 | Protease Do-like 4, mitoc | no | no | 0.695 | 0.498 | 0.459 | 2e-63 | |
| Q9SHZ1 | 559 | Putative protease Do-like | no | no | 0.695 | 0.461 | 0.467 | 2e-63 | |
| Q9FM41 | 486 | Putative protease Do-like | no | no | 0.692 | 0.528 | 0.459 | 2e-59 | |
| Q9LK71 | 560 | Putative protease Do-like | no | no | 0.665 | 0.441 | 0.398 | 5e-50 | |
| Q9LK70 | 499 | Putative protease Do-like | no | no | 0.684 | 0.509 | 0.375 | 4e-43 | |
| O34358 | 449 | Serine protease Do-like H | yes | no | 0.625 | 0.516 | 0.316 | 1e-17 | |
| Q9R9I1 | 458 | Serine protease Do-like H | no | no | 0.557 | 0.451 | 0.296 | 7e-15 |
| >sp|Q9FL12|DEGP9_ARATH Protease Do-like 9 OS=Arabidopsis thaliana GN=DEGP9 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 478 bits (1230), Expect = e-134, Method: Compositional matrix adjust.
Identities = 220/262 (83%), Positives = 244/262 (93%)
Query: 41 CIYTMLTVEDDEFWEGVLPVEFGELPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYV 100
C +LTV DDEFWEGV PVEFG+LPALQDAVTVVGYPIGGDTISVTSGVVSR+EILSYV
Sbjct: 199 CDIALLTVTDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYV 258
Query: 101 HGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFI 160
HGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHED ENIGYVIPTPVI+HFI
Sbjct: 259 HGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAENIGYVIPTPVIVHFI 318
Query: 161 QDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKADQKGVRIRRVDPTAPESEVLKPSDI 220
QDYEK+ YTGFP+LG+EWQKMENPDLR +M M++ QKGVRIRR++PTAPES+VLKPSDI
Sbjct: 319 QDYEKHDKYTGFPVLGIEWQKMENPDLRKSMGMESHQKGVRIRRIEPTAPESQVLKPSDI 378
Query: 221 ILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDSKILNFNITLATHRR 280
ILSFDG++IANDGTVPFRHGERIGFSYL+SQKYTGDSA VKVLR+ +IL FNI LA H+R
Sbjct: 379 ILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNKEILEFNIKLAIHKR 438
Query: 281 LIPSHNKGRPPSYYIIAGFVFS 302
LIP+H G+PPSY+I+AGFVF+
Sbjct: 439 LIPAHISGKPPSYFIVAGFVFT 460
|
Probable serine protease. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|O82261|DEGP2_ARATH Protease Do-like 2, chloroplastic OS=Arabidopsis thaliana GN=DEGP2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9FIV6|DGP10_ARATH Protease Do-like 10, mitochondrial OS=Arabidopsis thaliana GN=DEGP10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SHZ0|DEGP4_ARATH Protease Do-like 4, mitochondrial OS=Arabidopsis thaliana GN=DEGP4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SHZ1|DEGP3_ARATH Putative protease Do-like 3, mitochondrial OS=Arabidopsis thaliana GN=DEGP3 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FM41|DGP13_ARATH Putative protease Do-like 13 OS=Arabidopsis thaliana GN=DEGP13 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LK71|DGP11_ARATH Putative protease Do-like 11, mitochondrial OS=Arabidopsis thaliana GN=DEGP11 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9LK70|DGP12_ARATH Putative protease Do-like 12, mitochondrial OS=Arabidopsis thaliana GN=DEGP12 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O34358|HTRA_BACSU Serine protease Do-like HtrA OS=Bacillus subtilis (strain 168) GN=htrA PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9R9I1|HTRB_BACSU Serine protease Do-like HtrB OS=Bacillus subtilis (strain 168) GN=htrB PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 371 | ||||||
| 255540747 | 569 | serine endopeptidase degp2, putative [Ri | 0.706 | 0.460 | 0.893 | 1e-139 | |
| 225457105 | 575 | PREDICTED: protease Do-like 9-like [Viti | 0.706 | 0.455 | 0.881 | 1e-138 | |
| 147770917 | 576 | hypothetical protein VITISV_013882 [Viti | 0.706 | 0.454 | 0.881 | 1e-138 | |
| 297733823 | 464 | unnamed protein product [Vitis vinifera] | 0.706 | 0.564 | 0.881 | 1e-137 | |
| 224119270 | 464 | predicted protein [Populus trichocarpa] | 0.706 | 0.564 | 0.874 | 1e-137 | |
| 356513127 | 584 | PREDICTED: protease Do-like 9-like [Glyc | 0.706 | 0.448 | 0.870 | 1e-137 | |
| 449469505 | 586 | PREDICTED: protease Do-like 9-like [Cucu | 0.706 | 0.447 | 0.877 | 1e-137 | |
| 356565028 | 576 | PREDICTED: protease Do-like 9-like [Glyc | 0.706 | 0.454 | 0.870 | 1e-137 | |
| 224133476 | 483 | predicted protein [Populus trichocarpa] | 0.706 | 0.542 | 0.885 | 1e-137 | |
| 357477329 | 590 | hypothetical protein MTR_4g106730 [Medic | 0.706 | 0.444 | 0.870 | 1e-136 |
| >gi|255540747|ref|XP_002511438.1| serine endopeptidase degp2, putative [Ricinus communis] gi|223550553|gb|EEF52040.1| serine endopeptidase degp2, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 501 bits (1291), Expect = e-139, Method: Compositional matrix adjust.
Identities = 234/262 (89%), Positives = 247/262 (94%)
Query: 41 CIYTMLTVEDDEFWEGVLPVEFGELPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYV 100
C MLTV DDEFWEGV PVEFG+LPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYV
Sbjct: 180 CDIAMLTVNDDEFWEGVSPVEFGQLPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYV 239
Query: 101 HGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFI 160
HGSTELLGLQIDAAINSGNSGGPAFNDKG+CVGIAFQSLKHEDVENIGYVIPTPVI HFI
Sbjct: 240 HGSTELLGLQIDAAINSGNSGGPAFNDKGQCVGIAFQSLKHEDVENIGYVIPTPVITHFI 299
Query: 161 QDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKADQKGVRIRRVDPTAPESEVLKPSDI 220
QDYEKNGAYTGFP LG+EWQKMENPDLR AM MK DQKGVRIRR+DPTAPESEVL+PSDI
Sbjct: 300 QDYEKNGAYTGFPYLGIEWQKMENPDLRTAMGMKHDQKGVRIRRIDPTAPESEVLRPSDI 359
Query: 221 ILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDSKILNFNITLATHRR 280
ILSFDG+DIANDGTVPFRHGERIGFSYL+SQKYTGD+AA+KVLR+S LNF+I L+THR+
Sbjct: 360 ILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIKVLRNSAALNFDIKLSTHRK 419
Query: 281 LIPSHNKGRPPSYYIIAGFVFS 302
LIPSH KGRPPSYYIIAG VFS
Sbjct: 420 LIPSHVKGRPPSYYIIAGLVFS 441
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225457105|ref|XP_002280249.1| PREDICTED: protease Do-like 9-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147770917|emb|CAN74170.1| hypothetical protein VITISV_013882 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297733823|emb|CBI15070.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224119270|ref|XP_002318029.1| predicted protein [Populus trichocarpa] gi|222858702|gb|EEE96249.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356513127|ref|XP_003525265.1| PREDICTED: protease Do-like 9-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449469505|ref|XP_004152460.1| PREDICTED: protease Do-like 9-like [Cucumis sativus] gi|449487776|ref|XP_004157795.1| PREDICTED: protease Do-like 9-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356565028|ref|XP_003550747.1| PREDICTED: protease Do-like 9-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224133476|ref|XP_002321577.1| predicted protein [Populus trichocarpa] gi|222868573|gb|EEF05704.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357477329|ref|XP_003608950.1| hypothetical protein MTR_4g106730 [Medicago truncatula] gi|355510005|gb|AES91147.1| hypothetical protein MTR_4g106730 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 371 | ||||||
| TAIR|locus:2173727 | 592 | DEG9 "degradation of periplasm | 0.706 | 0.442 | 0.839 | 3.2e-120 | |
| TAIR|locus:2043403 | 607 | DEG2 "degradation of periplasm | 0.719 | 0.439 | 0.555 | 4.7e-80 | |
| TAIR|locus:2167468 | 586 | DEG10 "degradation of periplas | 0.695 | 0.440 | 0.528 | 1.3e-68 | |
| TAIR|locus:2018476 | 559 | DEG3 "degradation of periplasm | 0.695 | 0.461 | 0.467 | 1.3e-59 | |
| DICTYBASE|DDB_G0281081 | 647 | DDB_G0281081 "Protease degS" [ | 0.773 | 0.443 | 0.427 | 1.5e-58 | |
| TIGR_CMR|SPO_1625 | 478 | SPO_1625 "periplasmic serine p | 0.622 | 0.483 | 0.300 | 2e-15 | |
| UNIPROTKB|Q3AG05 | 370 | CHY_0057 "Putative serine prot | 0.514 | 0.516 | 0.311 | 2.6e-15 | |
| TIGR_CMR|CHY_0057 | 370 | CHY_0057 "putative serine prot | 0.514 | 0.516 | 0.311 | 2.6e-15 | |
| UNIPROTKB|Q81Y95 | 413 | htrA "Serine protease HtrA" [B | 0.514 | 0.462 | 0.306 | 1.6e-14 | |
| TIGR_CMR|BA_3660 | 413 | BA_3660 "serine protease" [Bac | 0.514 | 0.462 | 0.306 | 1.6e-14 |
| TAIR|locus:2173727 DEG9 "degradation of periplasmic proteins 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1183 (421.5 bits), Expect = 3.2e-120, P = 3.2e-120
Identities = 220/262 (83%), Positives = 244/262 (93%)
Query: 41 CIYTMLTVEDDEFWEGVLPVEFGELPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYV 100
C +LTV DDEFWEGV PVEFG+LPALQDAVTVVGYPIGGDTISVTSGVVSR+EILSYV
Sbjct: 199 CDIALLTVTDDEFWEGVSPVEFGDLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYV 258
Query: 101 HGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFI 160
HGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHED ENIGYVIPTPVI+HFI
Sbjct: 259 HGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDAENIGYVIPTPVIVHFI 318
Query: 161 QDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKADQKGVRIRRVDPTAPESEVLKPSDI 220
QDYEK+ YTGFP+LG+EWQKMENPDLR +M M++ QKGVRIRR++PTAPES+VLKPSDI
Sbjct: 319 QDYEKHDKYTGFPVLGIEWQKMENPDLRKSMGMESHQKGVRIRRIEPTAPESQVLKPSDI 378
Query: 221 ILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDSKILNFNITLATHRR 280
ILSFDG++IANDGTVPFRHGERIGFSYL+SQKYTGDSA VKVLR+ +IL FNI LA H+R
Sbjct: 379 ILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVKVLRNKEILEFNIKLAIHKR 438
Query: 281 LIPSHNKGRPPSYYIIAGFVFS 302
LIP+H G+PPSY+I+AGFVF+
Sbjct: 439 LIPAHISGKPPSYFIVAGFVFT 460
|
|
| TAIR|locus:2043403 DEG2 "degradation of periplasmic proteins 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167468 DEG10 "degradation of periplasmic proteins 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018476 DEG3 "degradation of periplasmic proteins 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281081 DDB_G0281081 "Protease degS" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1625 SPO_1625 "periplasmic serine protease, DO/DeqQ family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3AG05 CHY_0057 "Putative serine protease Do" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0057 CHY_0057 "putative serine protease" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q81Y95 htrA "Serine protease HtrA" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3660 BA_3660 "serine protease" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9FL12 | DEGP9_ARATH | 3, ., 4, ., 2, 1, ., - | 0.8396 | 0.7061 | 0.4425 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.21 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | GSVIVG00016141001 | SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (572 aa) | |||||||||
(Vitis vinifera) | |||||||||||
 | GSVIVG00031804001 | • | • | 0.471 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 371 | |||
| COG0265 | 347 | COG0265, DegQ, Trypsin-like serine proteases, typi | 4e-25 | |
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 8e-25 | |
| TIGR02038 | 351 | TIGR02038, protease_degS, periplasmic serine pepet | 4e-11 | |
| cd00987 | 90 | cd00987, PDZ_serine_protease, PDZ domain of tryspi | 2e-10 | |
| PRK10942 | 473 | PRK10942, PRK10942, serine endoprotease; Provision | 3e-10 | |
| PRK10898 | 353 | PRK10898, PRK10898, serine endoprotease; Provision | 2e-09 | |
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 4e-08 | |
| pfam13180 | 81 | pfam13180, PDZ_2, PDZ domain | 1e-07 | |
| pfam00089 | 218 | pfam00089, Trypsin, Trypsin | 1e-07 | |
| PRK10139 | 455 | PRK10139, PRK10139, serine endoprotease; Provision | 3e-07 | |
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 0.002 |
| >gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 104 bits (260), Expect = 4e-25
Identities = 63/251 (25%), Positives = 96/251 (38%), Gaps = 20/251 (7%)
Query: 32 SATLVTADICIYTMLTVEDDEFWEGVLPVEFGELPALQDAVTVVGYPIGGDTISVTSGVV 91
A LV D + D V+ + + + D V +G P G +VTSG+V
Sbjct: 109 PAKLVGKDPISDLAVLKIDGAGGLPVIALGDSDKLRVGDVVVAIGNP-FGLGQTVTSGIV 167
Query: 92 SRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSL-KHEDVENIGYV 150
S + + +Q DAAIN GNSGGP N G+ VGI + IG+
Sbjct: 168 SALGRTGVGSAGGYVNFIQTDAAINPGNSGGPLVNIDGEVVGINTAIIAPSGGSSGIGFA 227
Query: 151 IPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMK-ADQKGVRIRRVDPTA 209
IP ++ + + G LGV + L +++ G + V P +
Sbjct: 228 IPVNLVAPVLDELISKGKVVR-GYLGVIGE-----PLTADIALGLPVAAGAVVLGVLPGS 281
Query: 210 P-ESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDSKI 268
P +K DII + +G +A+ V+ GD A+K+LR K
Sbjct: 282 PAAKAGIKAGDIITAVNGKPVASLS----------DLVAAVASNRPGDEVALKLLRGGKE 331
Query: 269 LNFNITLATHR 279
+TL
Sbjct: 332 RELAVTLGDRS 342
|
Length = 347 |
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
| >gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain | Back alignment and domain information |
|---|
| >gnl|CDD|215708 pfam00089, Trypsin, Trypsin | Back alignment and domain information |
|---|
| >gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 371 | |||
| PRK10139 | 455 | serine endoprotease; Provisional | 100.0 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 100.0 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 100.0 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 100.0 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 100.0 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 100.0 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.93 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 99.91 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.88 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 99.8 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 99.6 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 99.52 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 99.43 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 99.3 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 99.29 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 99.26 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 99.22 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.11 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 99.11 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 99.08 | |
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 99.05 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 98.83 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.82 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 98.71 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 98.68 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 98.63 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 98.59 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 98.57 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 98.5 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 98.47 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 98.46 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 98.39 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 98.36 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 98.35 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 98.34 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 98.33 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 98.2 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 98.05 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 97.96 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 97.91 | |
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 97.82 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 97.81 | |
| KOG3129 | 231 | consensus 26S proteasome regulatory complex, subun | 97.72 | |
| KOG3553 | 124 | consensus Tax interaction protein TIP1 [Cell wall/ | 97.37 | |
| PF12812 | 78 | PDZ_1: PDZ-like domain | 97.32 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 97.3 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 96.98 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 96.88 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 96.33 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 96.25 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 96.04 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 96.01 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 95.86 | |
| KOG3550 | 207 | consensus Receptor targeting protein Lin-7 [Extrac | 95.52 | |
| KOG3532 | 1051 | consensus Predicted protein kinase [General functi | 95.43 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 95.33 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 95.14 | |
| PF00947 | 127 | Pico_P2A: Picornavirus core protein 2A; InterPro: | 94.86 | |
| KOG3834 | 462 | consensus Golgi reassembly stacking protein GRASP6 | 94.82 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 94.7 | |
| PF00548 | 172 | Peptidase_C3: 3C cysteine protease (picornain 3C); | 94.28 | |
| KOG3605 | 829 | consensus Beta amyloid precursor-binding protein [ | 94.03 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 93.91 | |
| KOG3651 | 429 | consensus Protein kinase C, alpha binding protein | 93.78 | |
| KOG1892 | 1629 | consensus Actin filament-binding protein Afadin [C | 93.76 | |
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 93.71 | |
| KOG2921 | 484 | consensus Intramembrane metalloprotease (sterol-re | 93.55 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 93.44 | |
| KOG3552 | 1298 | consensus FERM domain protein FRM-8 [General funct | 92.5 | |
| PF00944 | 158 | Peptidase_S3: Alphavirus core protein ; InterPro: | 91.44 | |
| KOG3606 | 358 | consensus Cell polarity protein PAR6 [Signal trans | 91.09 | |
| KOG3571 | 626 | consensus Dishevelled 3 and related proteins [Gene | 90.91 | |
| KOG3551 | 506 | consensus Syntrophins (type beta) [Extracellular s | 88.86 | |
| KOG3549 | 505 | consensus Syntrophins (type gamma) [Extracellular | 88.32 | |
| PF05579 | 297 | Peptidase_S32: Equine arteritis virus serine endop | 86.42 | |
| KOG0609 | 542 | consensus Calcium/calmodulin-dependent serine prot | 86.02 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 84.26 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 83.66 | |
| KOG3605 | 829 | consensus Beta amyloid precursor-binding protein [ | 80.46 |
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.5e-48 Score=390.08 Aligned_cols=309 Identities=21% Similarity=0.272 Sum_probs=252.1
Q ss_pred eccCCeeeeeccEEEEE---EEecCCCe-----------------EeEEEEEecCCCCEEEEEEecCCCcCCccceecCC
Q 017471 5 WSTTRRLNSRNEALILS---TWLLCSPS-----------------APSATLVTADICIYTMLTVEDDEFWEGVLPVEFGE 64 (371)
Q Consensus 5 ~~~~~~~~~~gsg~vi~---~~~~~~~~-----------------~~A~vv~~d~~~DlAlLkv~~~~~~~~l~~~~l~~ 64 (371)
|...+...+.||||+++ ++++++.| ++|++++.|+++||||||++... ++++++|++
T Consensus 82 ~~~~~~~~~~GSG~ii~~~~g~IlTn~HVv~~a~~i~V~~~dg~~~~a~vvg~D~~~DlAvlkv~~~~---~l~~~~lg~ 158 (455)
T PRK10139 82 DQPAQPFEGLGSGVIIDAAKGYVLTNNHVINQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPS---KLTQIAIAD 158 (455)
T ss_pred ccccccccceEEEEEEECCCCEEEeChHHhCCCCEEEEEECCCCEEEEEEEEEcCCCCEEEEEecCCC---CCceeEecC
Confidence 44444556789999996 57766665 79999999999999999998653 789999998
Q ss_pred CCC--CCCeEEEEEeCCCCCCceeeeeEEeeeeeeeccCCCeEEeEEEEEeeccCCCCCCceecCCCcEEEEEeeecccC
Q 017471 65 LPA--LQDAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHE 142 (371)
Q Consensus 65 s~~--lgd~V~~iG~p~g~~~~s~t~G~Vs~~~~~~~~~~~~~~~~i~~da~i~~G~SGGPlvn~~G~VIGI~~~~~~~~ 142 (371)
+.. +||+|+++|||++... +++.|+||+.++..... .....+||+|++||+|||||||+|.+||||||+++.+..+
T Consensus 159 s~~~~~G~~V~aiG~P~g~~~-tvt~GivS~~~r~~~~~-~~~~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~ 236 (455)
T PRK10139 159 SDKLRVGDFAVAVGNPFGLGQ-TATSGIISALGRSGLNL-EGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPG 236 (455)
T ss_pred ccccCCCCEEEEEecCCCCCC-ceEEEEEccccccccCC-CCcceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCC
Confidence 764 6899999999999776 89999999998743222 1234689999999999999999999999999999987543
Q ss_pred -CccceeccccCcchhHhHhhhhhCCeeecccccceeeeEcCCHHHHHhccCCCCCCceEEEEECCCCcccc-CCCCCCE
Q 017471 143 -DVENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKADQKGVRIRRVDPTAPESE-VLKPSDI 220 (371)
Q Consensus 143 -~~~~~~~aiP~~~i~~~l~~L~~~g~~~g~~~lGi~~~~~~~~~~~~~~gl~~~~~gv~V~~V~~~spA~~-GL~~GDv 220 (371)
+..+++||||++.+++++++|.++|++. ++|||+.++++ +++.++.+|++ ...|++|.+|.++|||++ |||+||+
T Consensus 237 ~~~~gigfaIP~~~~~~v~~~l~~~g~v~-r~~LGv~~~~l-~~~~~~~lgl~-~~~Gv~V~~V~~~SpA~~AGL~~GDv 313 (455)
T PRK10139 237 GGSVGIGFAIPSNMARTLAQQLIDFGEIK-RGLLGIKGTEM-SADIAKAFNLD-VQRGAFVSEVLPNSGSAKAGVKAGDI 313 (455)
T ss_pred CCccceEEEEEhHHHHHHHHHHhhcCccc-ccceeEEEEEC-CHHHHHhcCCC-CCCceEEEEECCCChHHHCCCCCCCE
Confidence 4578999999999999999999999999 99999999999 89999999997 467999999999999999 9999999
Q ss_pred EEEECCEEecCCCCccccccccchhhhhhhccCCCCEEEEEEEECCEEEEEEEEeccccccCCCCCCCCCCCceeeccEE
Q 017471 221 ILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFV 300 (371)
Q Consensus 221 Il~vnG~~V~~~~~l~~~~~~~~~~~~~~~~~~~g~~v~l~v~R~g~~~~~~v~l~~~~~~~~~~~~~~~~~~~~~~Gl~ 300 (371)
|++|||++|.++.++. ..+....+|++++++|.|+|+.+++++++...+......... .+ .+.|+.
T Consensus 314 Il~InG~~V~s~~dl~----------~~l~~~~~g~~v~l~V~R~G~~~~l~v~~~~~~~~~~~~~~~-~~---~~~g~~ 379 (455)
T PRK10139 314 ITSLNGKPLNSFAELR----------SRIATTEPGTKVKLGLLRNGKPLEVEVTLDTSTSSSASAEMI-TP---ALQGAT 379 (455)
T ss_pred EEEECCEECCCHHHHH----------HHHHhcCCCCEEEEEEEECCEEEEEEEEECCCCCcccccccc-cc---cccccE
Confidence 9999999999999875 567666789999999999999999999985433221111100 01 134655
Q ss_pred EechHHHHHHcCcccccCceEEEEEecCChHhHHhhhhhhhH
Q 017471 301 FSRCLYLISVLSMERIMNMKLRSSFWTSSCIQCHNCQMSSLL 342 (371)
Q Consensus 301 ~~~l~~~~~~~~~~~~~~~~~v~~~~~~Sp~~~~~~~~~~~~ 342 (371)
+++. + ......|+++..+.++|||+.--.+.+|+|
T Consensus 380 l~~~-----~--~~~~~~Gv~V~~V~~~spA~~aGL~~GD~I 414 (455)
T PRK10139 380 LSDG-----Q--LKDGTKGIKIDEVVKGSPAAQAGLQKDDVI 414 (455)
T ss_pred eccc-----c--cccCCCceEEEEeCCCChHHHcCCCCCCEE
Confidence 5431 1 122346899999999999998888888775
|
|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3532 consensus Predicted protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] | Back alignment and domain information |
|---|
| >PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3551 consensus Syntrophins (type beta) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 371 | ||||
| 4fln_A | 539 | Crystal Structure Of Plant Protease Deg2 Length = 5 | 7e-87 | ||
| 3pv2_A | 451 | Structure Of Legionella Fallonii Degq (Wt) Length = | 4e-10 | ||
| 3pv3_A | 451 | Structure Of Legionella Fallonii Degq (S193a Varian | 9e-10 | ||
| 3pv5_A | 451 | Structure Of Legionella Fallonii Degq (N189gP190G V | 2e-09 | ||
| 3pv4_A | 354 | Structure Of Legionella Fallonii Degq (Delta-Pdz2 V | 2e-09 | ||
| 2zle_A | 448 | Cryo-Em Structure Of Degp12OMP Length = 448 | 7e-09 | ||
| 3mh5_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 8e-09 | ||
| 3mh4_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 2e-08 | ||
| 4a8d_A | 448 | Degp Dodecamer With Bound Omp Length = 448 | 2e-08 | ||
| 3otp_A | 459 | Crystal Structure Of The Degp Dodecamer With A Mode | 2e-08 | ||
| 3cs0_A | 448 | Crystal Structure Of Degp24 Length = 448 | 1e-07 | ||
| 3qo6_A | 348 | Crystal Structure Analysis Of The Plant Protease De | 1e-07 | ||
| 3mh7_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 3e-07 | ||
| 1ky9_A | 448 | Crystal Structure Of Degp (Htra) Length = 448 | 3e-07 | ||
| 1l1j_A | 239 | Crystal Structure Of The Protease Domain Of An Atp- | 2e-06 | ||
| 1soz_A | 314 | Crystal Structure Of Degs Protease In Complex With | 5e-06 | ||
| 1te0_A | 318 | Structural Analysis Of Degs, A Stress Sensor Of The | 6e-06 | ||
| 3gcn_A | 340 | Crystal Structure Of Degs H198pD320A MUTANT MODIFIE | 1e-05 | ||
| 1sot_A | 320 | Crystal Structure Of The Degs Stress Sensor Length | 2e-05 | ||
| 2w7s_A | 200 | Spla Serine Protease Of Staphylococcus Aureus (1.8a | 2e-05 | ||
| 3stj_A | 345 | Crystal Structure Of The Protease + Pdz1 Domain Of | 3e-05 | ||
| 1lcy_A | 325 | Crystal Structure Of The Mitochondrial Serine Prote | 3e-05 | ||
| 3nzi_A | 334 | Substrate Induced Remodeling Of The Active Site Reg | 7e-05 | ||
| 3lgy_A | 241 | R178a Mutant Of The Degs-Deltapdz Protease Length = | 1e-04 | ||
| 4a8a_A | 436 | Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 1 | 1e-04 | ||
| 2qgr_A | 243 | Structure Of The R178a Mutant Of Delta Pdz Degs Pro | 1e-04 | ||
| 3lgu_A | 241 | Y162a Mutant Of The Degs-Deltapdz Protease Length = | 1e-04 | ||
| 3num_A | 332 | Substrate Induced Remodeling Of The Active Site Reg | 1e-04 | ||
| 3lgt_A | 241 | Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease | 2e-04 | ||
| 3lgi_A | 237 | Structure Of The Protease Domain Of Degs (Degs-Delt | 2e-04 | ||
| 3lgv_A | 241 | H198p Mutant Of The Degs-Deltapdz Protease Length = | 2e-04 | ||
| 2qf3_A | 243 | Structure Of The Delta Pdz Truncation Of The Degs P | 2e-04 | ||
| 2r3u_A | 211 | Crystal Structure Of The Pdz Deletion Mutant Of Deg | 2e-04 | ||
| 2as9_A | 210 | Functional And Structural Characterization Of Spl P | 3e-04 | ||
| 3lgw_A | 241 | H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease | 4e-04 | ||
| 2qf0_A | 243 | Structure Of The Delta Pdz Truncation Of The Degs P | 5e-04 | ||
| 3lh3_A | 241 | Dfp Modified Degs Delta Pdz Length = 241 | 6e-04 | ||
| 2rce_A | 243 | Dfp Modified Degs Delta Pdz Length = 243 | 7e-04 |
| >pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 Length = 539 | Back alignment and structure |
|
| >pdb|3PV2|A Chain A, Structure Of Legionella Fallonii Degq (Wt) Length = 451 | Back alignment and structure |
| >pdb|3PV3|A Chain A, Structure Of Legionella Fallonii Degq (S193a Variant) Length = 451 | Back alignment and structure |
| >pdb|3PV5|A Chain A, Structure Of Legionella Fallonii Degq (N189gP190G VARIANT) Length = 451 | Back alignment and structure |
| >pdb|3PV4|A Chain A, Structure Of Legionella Fallonii Degq (Delta-Pdz2 Variant) Length = 354 | Back alignment and structure |
| >pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 | Back alignment and structure |
| >pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|4A8D|A Chain A, Degp Dodecamer With Bound Omp Length = 448 | Back alignment and structure |
| >pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 | Back alignment and structure |
| >pdb|3CS0|A Chain A, Crystal Structure Of Degp24 Length = 448 | Back alignment and structure |
| >pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1 Length = 348 | Back alignment and structure |
| >pdb|3MH7|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|1KY9|A Chain A, Crystal Structure Of Degp (Htra) Length = 448 | Back alignment and structure |
| >pdb|1L1J|A Chain A, Crystal Structure Of The Protease Domain Of An Atp- Independent Heat Shock Protease Htra Length = 239 | Back alignment and structure |
| >pdb|1SOZ|A Chain A, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314 | Back alignment and structure |
| >pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318 | Back alignment and structure |
| >pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY DFP IN Complex With Omp Peptide (Yqf) Length = 340 | Back alignment and structure |
| >pdb|1SOT|A Chain A, Crystal Structure Of The Degs Stress Sensor Length = 320 | Back alignment and structure |
| >pdb|2W7S|A Chain A, Spla Serine Protease Of Staphylococcus Aureus (1.8a) Length = 200 | Back alignment and structure |
| >pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 | Back alignment and structure |
| >pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 | Back alignment and structure |
| >pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 | Back alignment and structure |
| >pdb|3LGY|A Chain A, R178a Mutant Of The Degs-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|4A8A|A Chain A, Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 12-Mer In Complex With Lysozyme Length = 436 | Back alignment and structure |
| >pdb|2QGR|A Chain A, Structure Of The R178a Mutant Of Delta Pdz Degs Protease Length = 243 | Back alignment and structure |
| >pdb|3LGU|A Chain A, Y162a Mutant Of The Degs-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 | Back alignment and structure |
| >pdb|3LGT|A Chain A, Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|3LGI|A Chain A, Structure Of The Protease Domain Of Degs (Degs-Deltapdz) At 1.65 A Length = 237 | Back alignment and structure |
| >pdb|3LGV|A Chain A, H198p Mutant Of The Degs-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|2QF3|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 | Back alignment and structure |
| >pdb|2R3U|A Chain A, Crystal Structure Of The Pdz Deletion Mutant Of Degs Length = 211 | Back alignment and structure |
| >pdb|2AS9|A Chain A, Functional And Structural Characterization Of Spl Proteases From Staphylococcus Aureus Length = 210 | Back alignment and structure |
| >pdb|3LGW|A Chain A, H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|2QF0|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 | Back alignment and structure |
| >pdb|3LH3|A Chain A, Dfp Modified Degs Delta Pdz Length = 241 | Back alignment and structure |
| >pdb|2RCE|A Chain A, Dfp Modified Degs Delta Pdz Length = 243 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 | Back alignment and structure |
|---|
Score = 165 bits (419), Expect = 9e-50
Identities = 33/140 (23%), Positives = 54/140 (38%), Gaps = 22/140 (15%)
Query: 45 MLTVEDD---------EFWEGVLPVEFGELPALQDAVTVVGYPIGGD---TISVTSGVVS 92
++ +E+ F E V F + + D + V+GYP+ ++G +
Sbjct: 81 VMNIEEQAVERGPKGFNFNENVQAFNFAKDAKVDDKIKVIGYPLPAQNSFKQFESTGTIK 140
Query: 93 RIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIP 152
RI+ L DA I GNSG P N + +G+ + + E G V
Sbjct: 141 RIKDNI----------LNFDAYIEPGNSGSPVLNSNNEVIGVVYGGIGKIGSEYNGAVYF 190
Query: 153 TPVIMHFIQDYEKNGAYTGF 172
TP I FIQ + + +
Sbjct: 191 TPQIKDFIQKHIEQHHHHHH 210
|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Length = 191 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 371 | |||
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 100.0 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 100.0 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 100.0 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 100.0 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 100.0 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 100.0 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 100.0 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 100.0 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 100.0 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 100.0 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 99.93 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 99.93 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 99.9 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 99.86 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 99.86 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.82 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.7 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.64 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 99.58 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 99.56 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.55 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.43 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 99.42 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.41 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 99.41 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 99.39 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 99.39 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.38 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 99.35 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 99.33 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 99.33 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 99.32 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 99.31 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 99.29 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 99.27 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 99.26 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 99.2 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 99.19 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 99.18 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 99.14 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 99.13 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 99.13 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 99.13 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 99.13 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 99.1 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 99.1 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 99.1 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 99.09 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 99.08 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 99.08 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 99.07 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 99.06 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 99.06 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 99.05 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 99.04 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 99.04 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 99.03 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 99.03 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.01 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 99.0 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 99.0 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 99.0 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 98.99 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 98.99 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.98 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 98.98 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.96 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 98.96 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 98.95 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 98.95 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 98.95 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 98.95 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 98.94 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 98.94 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 98.94 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 98.94 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 98.94 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 98.93 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 98.93 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 98.93 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 98.91 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 98.9 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 98.9 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 98.9 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 98.9 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 98.9 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 98.89 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 98.88 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 98.88 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 98.88 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 98.87 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 98.86 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 98.86 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 98.85 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 98.85 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 98.85 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 98.84 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 98.83 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 98.82 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 98.82 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 98.82 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 98.82 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 98.82 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.82 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.82 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 98.81 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 98.81 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 98.81 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 98.81 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 98.81 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 98.8 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 98.8 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 98.8 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 98.8 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 98.8 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 98.79 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 98.79 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 98.78 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 98.78 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.78 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 98.78 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 98.78 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 98.77 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 98.77 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 98.77 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 98.76 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 98.76 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 98.76 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.76 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 98.76 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 98.74 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 98.74 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.74 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 98.73 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 98.73 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 98.73 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 98.73 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.72 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 98.72 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 98.71 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 98.7 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.7 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 98.7 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 98.7 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 98.69 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 98.68 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 98.67 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 98.66 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 98.66 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 98.65 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 98.65 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 98.64 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 98.63 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.63 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 98.63 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 98.63 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 98.62 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 98.62 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 98.61 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 98.61 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 98.61 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 98.6 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 98.6 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 98.6 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 98.58 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 98.58 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.58 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 98.58 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 98.58 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 98.57 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 98.57 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 98.57 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 98.56 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 98.56 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 98.55 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 98.55 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 98.55 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 98.55 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 98.54 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 98.54 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 98.54 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 98.53 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 98.53 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 98.52 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.51 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 98.51 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 98.51 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.5 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 98.5 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.5 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 98.49 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 98.49 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.48 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 98.48 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 98.47 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 98.46 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 98.44 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 98.44 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 98.43 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 98.43 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 98.42 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 98.4 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 98.38 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 98.38 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 98.38 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 98.35 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.35 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 98.35 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 98.33 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 98.33 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 98.31 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 98.29 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 98.28 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 98.23 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 98.22 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 98.2 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 97.51 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 98.11 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 98.06 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 97.95 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 97.9 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 97.86 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 97.83 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 97.5 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 97.35 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 97.31 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 97.09 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 97.08 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 97.06 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 96.98 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 96.97 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 96.89 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 96.85 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 96.81 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 96.79 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 96.78 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 96.77 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 96.77 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 96.76 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 96.75 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 96.73 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 96.72 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 96.71 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 96.7 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 96.68 | |
| 3qzr_A | 187 | 3C protein; chymotrypsin-fold, beta-ribbon, hydrol | 96.66 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 96.64 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 96.59 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 96.58 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 96.58 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 96.57 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 96.54 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 96.51 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 96.5 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 96.49 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 96.47 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 96.45 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 96.44 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 96.38 | |
| 2b0f_A | 182 | Picornain 3C (protease 3C) (P3C); beta barrel, hyd | 96.33 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 96.33 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 96.31 | |
| 3q3y_A | 191 | HEVB EV93 3C protease; cysteine trypsin-like prote | 96.23 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 96.2 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 96.09 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 96.07 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 96.01 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 96.0 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 95.99 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 95.99 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 95.97 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 95.9 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 95.86 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 95.86 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 95.85 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 95.79 | |
| 4dcd_A | 190 | Protease 3C, genome polyprotein; antiviral inhibit | 95.79 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 95.68 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 95.63 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 95.53 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 95.5 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 95.47 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 95.46 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 95.4 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 95.34 | |
| 1cqq_A | 180 | Type 2 rhinovirus 3C protease; viral protein, hydr | 95.33 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 95.25 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 95.21 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 95.18 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 95.16 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 94.99 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 94.94 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 94.92 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 94.89 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 94.88 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 94.87 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 94.8 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 94.63 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 94.61 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 94.59 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 94.44 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 94.41 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 94.34 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 94.33 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 94.32 | |
| 2hal_A | 212 | Hepatitis A protease 3C; 3C protease, inhibitor de | 94.26 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 94.05 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 93.95 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 93.85 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 93.8 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 93.75 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 93.62 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 93.58 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 93.33 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 92.92 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 92.55 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 92.3 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 92.2 | |
| 2fp7_B | 172 | Serine protease NS3; flavivirus, NS3 protease, NS2 | 91.76 | |
| 2fom_B | 185 | Polyprotein; flavivirus, NS3 protease, NS2B cofact | 91.7 | |
| 2ggv_B | 185 | NS3, non-structural protein 3; beta barrel, serine | 91.63 | |
| 3u1j_B | 191 | Serine protease NS3; serine protease, ER MEM hydro | 91.6 | |
| 2ijd_1 | 644 | Picornain 3C, RNA-directed RNA polymerase; RNA-dep | 91.48 | |
| 3e90_B | 198 | NS3 protease; trypsin-like serine protease, protea | 91.39 | |
| 3lkw_A | 236 | Fusion protein of nonstructural protein 2B and non | 90.67 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 90.56 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 90.37 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 88.41 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 88.36 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 88.0 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 87.95 | |
| 1vcp_A | 149 | Semliki forest virus capsid protein; virus coat pr | 87.57 | |
| 4agk_A | 158 | Capsid protein, coat protein, C; hydrolase, viral | 87.45 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 87.35 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 87.27 | |
| 1svp_A | 161 | Sindbis virus capsid protein; chymotrypsin-like se | 87.16 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 87.05 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 87.01 | |
| 1ep5_B | 157 | Capsid protein C, coat protein C; beta barrel, hyd | 86.91 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 85.92 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 85.81 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 85.26 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 85.09 | |
| 3su6_A | 203 | NS3 protease, NS4A protein; drug resistance, drug | 82.8 |
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-57 Score=461.60 Aligned_cols=339 Identities=47% Similarity=0.816 Sum_probs=299.2
Q ss_pred eeeccCCeeeeeccEEEEE-EEecCCCe------------------EeEEEEEecCCCCEEEEEEecCCCcCCccceecC
Q 017471 3 ILWSTTRRLNSRNEALILS-TWLLCSPS------------------APSATLVTADICIYTMLTVEDDEFWEGVLPVEFG 63 (371)
Q Consensus 3 ~~~~~~~~~~~~gsg~vi~-~~~~~~~~------------------~~A~vv~~d~~~DlAlLkv~~~~~~~~l~~~~l~ 63 (371)
.||+++++..+.||||+++ ++++++.| ++|++++.|+.+||||||++...++..++++.++
T Consensus 64 ~Pw~~~~~~~s~GSGfiI~dG~IlTN~HVV~~a~~i~V~~~~dg~~~~A~vv~~D~~~DLAvLkv~~~~~~~~~~pl~~g 143 (539)
T 4fln_A 64 LPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIALLSVESEDFWKGAEPLRLG 143 (539)
T ss_dssp STTSBCCCEEEEEEEEEEETTEEEECGGGGTTEEEEEEECTTCCCCEEEEEEEEETTTTEEEEEECCSSSSTTCCCCCBC
T ss_pred CccccCCccceEEEEEEEECCEEEEChHHcCCCCeEEEEEccCCEEEEEEEEEECCCCCEEEEEEeCCcCCcCCceeecC
Confidence 5899999999999999998 55555444 7999999999999999999988776678889999
Q ss_pred CCCCCCCeEEEEEeCCCCCCceeeeeEEeeeeeeeccCCCeEEeEEEEEeeccCCCCCCceecCCCcEEEEEeeecccCC
Q 017471 64 ELPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHED 143 (371)
Q Consensus 64 ~s~~lgd~V~~iG~p~g~~~~s~t~G~Vs~~~~~~~~~~~~~~~~i~~da~i~~G~SGGPlvn~~G~VIGI~~~~~~~~~ 143 (371)
+++++||+|+++|||+++...++|.|+||++++..+..+.....+||+|++||||||||||+|.+|+||||+++.+...+
T Consensus 144 ~~~~vGd~V~aiG~P~g~~~~tvT~GIVSa~~r~~~~~~~~~~~~IQtDAaInpGnSGGPLvn~~GeVIGIntai~~~~~ 223 (539)
T 4fln_A 144 HLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEE 223 (539)
T ss_dssp CCCCTTCEEEEEECCSSSCCCEEEEEEEEEEEEEECTTSCCEEEEEEESSCCCTTTTTSEEECSSSCEEEEECCCC----
T ss_pred CcCcCCCeEEEEEcCCCCCCCcEEeEEECcccccccCCCCcceeEEEEEeEecCCCccchhccCCCcEEEEEEEEecCCC
Confidence 99999999999999999876799999999999887777777777899999999999999999999999999999876556
Q ss_pred ccceeccccCcchhHhHhhhhhCCeeecccccceeeeEcCCHHHHHhccCCCCCCceEEEEECCCCccccCCCCCCEEEE
Q 017471 144 VENIGYVIPTPVIMHFIQDYEKNGAYTGFPLLGVEWQKMENPDLRVAMSMKADQKGVRIRRVDPTAPESEVLKPSDIILS 223 (371)
Q Consensus 144 ~~~~~~aiP~~~i~~~l~~L~~~g~~~g~~~lGi~~~~~~~~~~~~~~gl~~~~~gv~V~~V~~~spA~~GL~~GDvIl~ 223 (371)
..+++||||++.+++++++|.++|++.+|+|||+.++++.++++++.+|++ ...|++|.+|.++|||+++||+||+|++
T Consensus 224 ~~gigfAIP~~~v~~vl~~l~~~G~~~~r~~LGv~~~~~~~~~~~~~~~l~-~~~Gv~V~~V~~~spA~~al~~GDvI~~ 302 (539)
T 4fln_A 224 TENIGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLENPALRECLKVP-TNEGVLVRRVEPTSDASKVLKEGDVIVS 302 (539)
T ss_dssp -CCCEEEEEHHHHHHHHHHHHTTTSCCCCCBCCEEEEECCCHHHHHHHTCS-SSBCEEEEEECTTSGGGGTCCTTCEEEE
T ss_pred CCcceecccHHHHHHHHHHHHHcCeEEeeeecceEEEecCCHHHHHhcCCC-CcCceeeecccCCChHHhCccCCCEEEE
Confidence 789999999999999999999999998899999999998899999999998 4689999999999999889999999999
Q ss_pred ECCEEecCCCCccccccccchhhhhhhccCCCCEEEEEEEECCEEEEEEEEeccccccCCCCCCCCCCCceeeccEEEec
Q 017471 224 FDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVKVLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSR 303 (371)
Q Consensus 224 vnG~~V~~~~~l~~~~~~~~~~~~~~~~~~~g~~v~l~v~R~g~~~~~~v~l~~~~~~~~~~~~~~~~~~~~~~Gl~~~~ 303 (371)
+||++|.+.+++.++..+++.|.+++...++|++++++|+|+|+++++++++.+++...+.......|+|++++|++|++
T Consensus 303 idg~~V~~~g~~~~~~~~~~~l~~~v~~~~~Gd~v~l~v~R~Gk~~~v~Vtl~~~~~~~~~~~~~~~p~~~~~~Gl~f~~ 382 (539)
T 4fln_A 303 FDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAEIGIIRAGEHKKVQVVLRPRVHLVPYHIDGGQPSYIIVAGLVFTP 382 (539)
T ss_dssp ETTEECBSSSEEECSTTCEEETHHHHHTSCTTCEEEEEEEETTEEEEEEEECBCCCCSSCSCTTSSCCCCCCSTTEEEEE
T ss_pred ECCEEeCcCCeeccccchhHHHHHHHHcCCCCCEEEEEEEECCEEEEEEEEEccCccccccccccCCCccccccceEEee
Confidence 99999999999988888899999999999999999999999999999999999999988888888899999999999999
Q ss_pred h-HHHHHHcCcc-----------------cccCceEEEEEecCChHhHHhhhhhhhH
Q 017471 304 C-LYLISVLSME-----------------RIMNMKLRSSFWTSSCIQCHNCQMSSLL 342 (371)
Q Consensus 304 l-~~~~~~~~~~-----------------~~~~~~~v~~~~~~Sp~~~~~~~~~~~~ 342 (371)
+ +.+.++++.. +...+++++.+.++|+++-...+-+|+|
T Consensus 383 Lt~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~gVvvs~V~~~s~a~~~g~~~gdiI 439 (539)
T 4fln_A 383 LSEPLIEEECEDTIGLKLLTKARYSVARFRGEQIVILSQVLANEVNIGYEDMNNQQV 439 (539)
T ss_dssp CCHHHHTTSCSSSSCHHHHHHHHHCCCSSTTCCCEEEEEECCCGGGTTCSSCCSEEE
T ss_pred CCHHHHHhhcccccCceeeehhhhhhhccCCceEEEEEEecCCchhhhcCCCCCCEE
Confidence 9 5444343321 2346899999999999987655555543
|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >2fp7_B Serine protease NS3; flavivirus, NS3 protease, NS2B cofactor; HET: OAR; 1.68A {West nile virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >2fom_B Polyprotein; flavivirus, NS3 protease, NS2B cofactor, viral protein-prote complex; 1.50A {Dengue virus 2} SCOP: b.47.1.3 PDB: 1df9_A 2qid_A 1bef_A | Back alignment and structure |
|---|
| >2ggv_B NS3, non-structural protein 3; beta barrel, serine protease, viral protease, flavivirus, hydrolase; 1.80A {West nile virus} PDB: 2ijo_B | Back alignment and structure |
|---|
| >3u1j_B Serine protease NS3; serine protease, ER MEM hydrolase-hydrolase inhibitor complex; 1.80A {Dengue virus 3} SCOP: b.47.1.3 PDB: 3u1i_B | Back alignment and structure |
|---|
| >2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 | Back alignment and structure |
|---|
| >3e90_B NS3 protease; trypsin-like serine protease, protease inhibitor, catalytic histidine, induced FIT, ATP-binding, capsid protein, helicase; HET: NKK; 2.45A {West nile virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >3lkw_A Fusion protein of nonstructural protein 2B and nonstructural protein 3; viral protease, serine protease, NS3 protease, NS2B cofactor; 2.00A {Dengue virus 1} PDB: 3l6p_A | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A | Back alignment and structure |
|---|
| >4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1svp_A Sindbis virus capsid protein; chymotrypsin-like serine, mutant, coat protein, viral protein; 2.00A {Sindbis virus} SCOP: b.47.1.3 PDB: 1kxb_A 1kxa_A 2snw_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} | Back alignment and structure |
|---|
| >1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A | Back alignment and structure |
|---|
| >3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 371 | ||||
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 3e-18 | |
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 3e-16 | |
| d1lcya2 | 205 | b.47.1.1 (A:6-210) Mitochondrial serine protease H | 2e-15 | |
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 4e-11 | |
| d1agja_ | 242 | b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A | 3e-10 | |
| d1qtfa_ | 246 | b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus | 5e-10 | |
| d2sgaa_ | 181 | b.47.1.1 (A:) Protease A {Streptomyces griseus, st | 4e-09 | |
| d2qaaa1 | 185 | b.47.1.1 (A:16-242) Protease B {Streptomyces grise | 2e-08 | |
| d2qf3a1 | 210 | b.47.1.1 (A:43-252) Stress sensor protease DegS, c | 4e-08 | |
| d2o8la1 | 216 | b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur | 1e-07 | |
| d1sota1 | 99 | b.36.1.4 (A:255-353) Stress sensor protease DegS, | 1e-06 | |
| d2z9ia1 | 88 | b.36.1.4 (A:227-314) Protease PepD {Mycobacterium | 2e-06 | |
| d2bhga1 | 199 | b.47.1.4 (A:7-205) 3C cysteine protease (picornain | 3e-06 | |
| d2i6va1 | 87 | b.36.1.5 (A:219-305) General secretion pathway pro | 7e-05 | |
| d2hgaa1 | 103 | b.36.1.6 (A:23-125) Uncharacterized protein MTH136 | 9e-05 | |
| d1lcya1 | 100 | b.36.1.4 (A:226-325) Mitochondrial serine protease | 1e-04 | |
| d1lvmb_ | 219 | b.47.1.3 (B:) TEV protease (nucleat inclusion prot | 5e-04 | |
| d1ky9b2 | 88 | b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t | 0.002 |
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Thermotoga maritima [TaxId: 2336]
Score = 80.8 bits (198), Expect = 3e-18
Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 3/107 (2%)
Query: 59 PVEFGELPALQ--DAVTVVGYPIGGD-TISVTSGVVSRIEILSYVHGSTELLGLQIDAAI 115
+EFG+ ++ + +G P+G T++V + I + +Q DAAI
Sbjct: 119 YLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQTDAAI 178
Query: 116 NSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQD 162
N GNSGGP N G+ +GI + ++ N+G+ IP + F+
Sbjct: 179 NPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDT 225
|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Length = 219 | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 371 | |||
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 99.94 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 99.91 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.88 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.87 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.84 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 99.74 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.73 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 99.7 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.62 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.6 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.55 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.48 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.48 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 99.37 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 99.31 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.27 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 99.25 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 99.25 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 99.22 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 99.18 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 99.14 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 99.1 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 98.86 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 98.85 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.85 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.78 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 98.77 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 98.76 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 98.64 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 98.63 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 98.63 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 98.63 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 98.57 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 98.53 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.53 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 98.51 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 98.48 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.48 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 98.48 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.47 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.47 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 98.46 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 98.46 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 98.46 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.45 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 98.45 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 98.45 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.44 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 98.43 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.43 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.41 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 98.41 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 98.41 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 98.4 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 98.4 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.4 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 98.4 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 98.39 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 98.38 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 98.38 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.38 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.35 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 98.33 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.31 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.3 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.28 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 98.28 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 98.27 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 98.27 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 98.26 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 98.25 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 98.24 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 98.24 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 98.24 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 98.22 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 98.22 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 98.15 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 98.07 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.03 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 98.01 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 97.95 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 97.94 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 97.93 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.86 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 97.81 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 97.62 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 96.64 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 96.59 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 96.53 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 95.62 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 95.28 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 95.23 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 95.0 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 94.75 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 94.75 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 94.49 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 94.32 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 94.32 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 94.32 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 94.28 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 94.15 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 94.07 | |
| d2fomb1 | 150 | NS3 protease {Dengue virus type 2 [TaxId: 11060]} | 94.07 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 94.02 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 93.94 | |
| d2fp7b1 | 152 | NS3 protease {West nile virus [TaxId: 11082]} | 93.88 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 93.85 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 93.76 | |
| d2h6ma1 | 212 | 3C cysteine protease (picornain 3C) {Human hepatit | 93.74 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 93.68 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 93.66 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 93.47 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 93.24 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 92.98 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 92.8 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 92.77 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 92.76 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 92.64 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 92.62 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 92.5 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 92.29 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 92.18 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 92.06 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 92.04 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 91.94 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 91.8 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 91.79 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 91.55 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 91.54 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 91.33 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 90.15 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 90.15 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 89.88 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 89.66 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 89.56 | |
| d1ep5a_ | 156 | Viral capsid protein {Venezuelan equine encephalit | 89.35 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 89.3 | |
| d1wyka_ | 152 | Viral capsid protein {Sindbis virus [TaxId: 11034] | 89.29 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 89.16 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 89.1 | |
| d1vcpa_ | 149 | Viral capsid protein {Semliki forest virus [TaxId: | 88.26 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 87.91 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 87.85 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 87.55 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 85.46 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 85.26 | |
| d1mbma_ | 198 | NSP4 proteinase {Equine arteritis virus, EAV [TaxI | 84.06 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 83.62 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Probab=99.94 E-value=8e-28 Score=221.04 Aligned_cols=157 Identities=20% Similarity=0.347 Sum_probs=129.9
Q ss_pred cCCeeeeeccEEEEE---EEecCCCe-----------------EeEEEEEecCCCCEEEEEEecCCCcCCccceecCCCC
Q 017471 7 TTRRLNSRNEALILS---TWLLCSPS-----------------APSATLVTADICIYTMLTVEDDEFWEGVLPVEFGELP 66 (371)
Q Consensus 7 ~~~~~~~~gsg~vi~---~~~~~~~~-----------------~~A~vv~~d~~~DlAlLkv~~~~~~~~l~~~~l~~s~ 66 (371)
.++...+.||||+++ ++++++.| ++|+++..|+.+|+|+|+++... ++++++|+++.
T Consensus 70 ~~~~~~~~GSG~iI~~~~g~IlTn~HVv~~~~~~~v~~~~~~~~~a~~~~~d~~~dlavl~i~~~~---~~~~~~l~~~~ 146 (249)
T d1ky9a2 70 QQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPK---NLTAIKMADSD 146 (249)
T ss_dssp EEEEEEEEEEEEEEETTTTEEEEEHHHHTTEEEEEEEETTSCEEEEEEEEEETTTTEEEEEESSCC---SCCCCCBCCGG
T ss_pred ccccccccccEEEEeccCceEEeeccccccceeeeeeecccccccceeeEeccchhhceeeecccc---cceEEEcCCcC
Confidence 345566789999996 46665555 79999999999999999999764 78999999865
Q ss_pred --CCCCeEEEEEeCCCCCCceeeeeEEeeeeeeeccCCCeEEeEEEEEeeccCCCCCCceecCCCcEEEEEeeecccC-C
Q 017471 67 --ALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHE-D 143 (371)
Q Consensus 67 --~lgd~V~~iG~p~g~~~~s~t~G~Vs~~~~~~~~~~~~~~~~i~~da~i~~G~SGGPlvn~~G~VIGI~~~~~~~~-~ 143 (371)
++||+|+++|||++... +++.|+++...+... .......+||+|+++++|||||||+|.+||||||+++.+..+ +
T Consensus 147 ~~~~G~~v~aiG~P~g~~~-tvt~~~~~~~~~~~~-~~~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~ 224 (249)
T d1ky9a2 147 ALRVGDYTVAIGNPFGLGE-TVTSGIVSALGRSGL-NAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGG 224 (249)
T ss_dssp GCCTTCEEEEEECTTSSSC-EEEEEEEEEESSCC------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCC
T ss_pred cCCcCCEEEEEecccccCC-ceeecceeecccccc-cCccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCC
Confidence 56899999999999877 999999998875422 222334579999999999999999999999999999887654 4
Q ss_pred ccceeccccCcchhHhHhhhhhCCe
Q 017471 144 VENIGYVIPTPVIMHFIQDYEKNGA 168 (371)
Q Consensus 144 ~~~~~~aiP~~~i~~~l~~L~~~g~ 168 (371)
..+++||||++.+++++++|.++|+
T Consensus 225 ~~gi~faIP~~~~~~~~~~l~~~G~ 249 (249)
T d1ky9a2 225 NIGIGFAIPSNMVKNLTSQMVEYGQ 249 (249)
T ss_dssp CSSSEEEEEHHHHHHHHHHHHHHSS
T ss_pred cccEEEEEEHHHHHHHHHHHHHhCc
Confidence 5689999999999999999988664
|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} | Back information, alignment and structure |
|---|
| >d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} | Back information, alignment and structure |
|---|