Citrus Sinensis ID: 017525


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370
MTNHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLFEISKVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYECAALPQARDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEISGFHSLKNVYISRSKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLERLILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLPLDCNRGLERKIVIKGQRRWWNELQWDDEATQNAFLPCFKPF
ccccccccccccccccccEEEEcccccccccHHHHHccccccEEEccccccccccccccccccEEEccccccccccHHHHHcccccEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEEEEEcccccHHHHHccccccccccccEEEEccccccccccccccccccccEEEEEccccccccccccccEEEEEcccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccEEEccccccccEEcccccccccccEEEEEcccccccccccccccccccEEEEccHHHHHHccccccccccccccccccc
cccccHcccccccccccEEEEEEccccccccHHHHHccccEEEEEccccccccHHHHHHHHHEEEEcccccHHHccHHHHHHHHHHEEEccccccHHHccHHHHHcHHHcEEEEEcccccccccccccccccHHHHHHHHHHHHHHcEcEEEcccHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccHHHHHHccEEEEEcccccEEEEEccccccccccccccccccEEEEEccccccccHHHEcccccEEEEcccHHHHHHccccccccccccccccccccHHHHEEEEcccHHHHHHccccccccccEEEEEEcccHHcccccccccccccEEEEEccHHHHHHcccccHHHHHHcccccccc
mtnhienlvespvcprlrtlFLSSNIFHRVNSDFFQSMASLRVLKwsysnpllfEISKVVSlqhldlshsrieslPIEFKCLVnlkclnleytygisrippkvisnlKILETLRMYECAalpqardsilfGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLgscmpqyvstpslclshfnnskslgvFSLASLRHLQTLQLTYndldeikidnggeVKRVLEISGfhslknvyisrskfrhatwlflapnlkrveidNCQDMKEIidsekfgevpAEVMANLIPFARLERLILEELKNLktvhskalpfphlkemsvdrcpllkklpldcnrglerkIVIKGQRRWWNElqwddeatqnaflpcfkpf
mtnhienlvespvcpRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLFEISKVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYtygisrippkvISNLKILETLRMYECAALPQARDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEISGFHSLKNVYISRSKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLERLILEELKNLKTvhskalpfphlkemsvdrcpllkklpldcnrglerkivikgQRRWWNELQwddeatqnaflpcfkPF
MTNHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLFEISKVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYECAALPQARDSILFGDCRvlveellglehlsvFTITLNNFHAFQRLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEISGFHSLKNVYISRSKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLERLILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLPLDCNRGLERKIVIKGQRRWWNELQWDDEATQNAFLPCFKPF
*******LVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLFEISKVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYECAALPQARDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEISGFHSLKNVYISRSKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLERLILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLPLDCNRGLERKIVIKGQRRWWNELQWDDEATQNAFLPCF***
*TNHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLFEISKVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYECAALPQARDSILFGD*RVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGG****VLEISGFHSLKNVYISRSKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKF************PFARLERLILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKL**************KGQRRWWNELQWDDEATQNAFLPCFKPF
MTNHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLFEISKVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYECAALPQARDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEISGFHSLKNVYISRSKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLERLILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLPLDCNRGLERKIVIKGQRRWWNELQWDDEATQNAFLPCFKPF
****IENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLFEISKVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYECAALPQARDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEISGFHSLKNVYISRSKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEK********MANLIPFARLERLILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLPLDCNRGLERKIVIKGQRRWWNELQWDDEATQNAFLPCFKP*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLFEISKVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYECAALPQARDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEISGFHSLKNVYISRSKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLERLILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLPLDCNRGLERKIVIKGQRRWWNELQWDDEATQNAFLPCFKPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query370 2.2.26 [Sep-21-2011]
O64973889 Disease resistance protei yes no 0.937 0.390 0.344 7e-40
Q8RXS5888 Probable disease resistan no no 0.945 0.394 0.342 3e-36
Q9FLB4874 Putative disease resistan no no 0.937 0.397 0.330 1e-33
Q9SH22884 Probable disease resistan no no 0.905 0.378 0.325 3e-31
P60838894 Probable disease resistan no no 0.932 0.385 0.341 5e-30
Q9SI85893 Probable disease resistan no no 0.905 0.375 0.310 6e-30
Q940K0889 Probable disease resistan no no 0.935 0.389 0.319 2e-29
Q9C8T9898 Putative disease resistan no no 0.932 0.384 0.321 5e-29
Q8L3R3885 Disease resistance protei no no 0.918 0.384 0.324 6e-29
O82484892 Putative disease resistan no no 0.929 0.385 0.331 7e-29
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function desciption
 Score =  164 bits (416), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 129/374 (34%), Positives = 200/374 (53%), Gaps = 27/374 (7%)

Query: 1   MTNHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYS---NPLLFEIS 57
           M N IE + +S  C  L TLFL  N   +++++FF+ M  L VL  S +   N L  EIS
Sbjct: 525 MNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEIS 584

Query: 58  KVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYE 117
           ++ SL++ +LS++ I  LP+    L  L  LNLE+   +  I    ISNL  L TL +  
Sbjct: 585 ELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILG--ISNLWNLRTLGL-- 640

Query: 118 CAALPQARDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPSLC 177
                  RDS L  D   LV+EL  LEHL V T+ +++    + LL  C  + V      
Sbjct: 641 -------RDSRLLLDMS-LVKELQLLEHLEVITLDISSSLVAEPLL--CSQRLVECIKEV 690

Query: 178 LSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKID---NGGEVKRVLEISGFHSLKNV 234
              +   +S+ V +L ++ +L+ L +    + EIKI+   +     +      F +L  V
Sbjct: 691 DFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRV 750

Query: 235 YISRS-KFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLERL 293
           +I++    +  TWL  APNL  +E+   +++++II  EK      E  A ++PF +LE L
Sbjct: 751 FIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEK----AEEHSATIVPFRKLETL 806

Query: 294 ILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLPLDCNRGL--ERKIVIKGQRRWWNE 351
            L EL+ LK +++KAL FP LK + V++C  L+KLPLD   G+  E  ++  G+R W   
Sbjct: 807 HLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIER 866

Query: 352 LQWDDEATQNAFLP 365
           ++W+D+ATQ  FLP
Sbjct: 867 VEWEDQATQLRFLP 880




Disease resistance (R) protein that specifically recognizes the avrPphB type III effector avirulence protein from Pseudomonas syringae. Also confers resistance against Hyaloperonospora parasitica (downy mildew). Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Requires PBS1 to trigger the defense reaction against avrPphB. Probably triggers the defense mechanism when PBS1 is cleaved by avrPphB, suggesting that it detects indirectly the protease activity of avrPphB, and possibly binds to the cleaved RPS5.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query370
24461866 890 NBS-LRR type disease resistance protein 0.975 0.405 0.505 4e-83
24461865 892 NBS-LRR type disease resistance protein 0.978 0.405 0.482 4e-75
24461861 890 NBS-LRR type disease resistance protein 0.967 0.402 0.472 9e-70
24461863 889 NBS-LRR type disease resistance protein 0.972 0.404 0.432 1e-66
359482672 905 PREDICTED: probable disease resistance p 0.991 0.405 0.420 4e-64
225442867 893 PREDICTED: probable disease resistance p 0.967 0.400 0.421 3e-63
24461864 899 NBS-LRR type disease resistance protein 0.962 0.395 0.424 2e-61
225443158 903 PREDICTED: probable disease resistance p 0.991 0.406 0.411 2e-60
147852651 882 hypothetical protein VITISV_017542 [Viti 0.913 0.383 0.406 3e-60
359482674 991 PREDICTED: probable disease resistance p 0.956 0.357 0.414 3e-60
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  314 bits (805), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 189/374 (50%), Positives = 243/374 (64%), Gaps = 13/374 (3%)

Query: 1   MTNHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSN--PLLFEISK 58
           M N I NL E   CP L TLFL+ N    +++DFF+ M SL+VL  + S+   L   ISK
Sbjct: 521 MHNQITNLSEVATCPHLLTLFLNENELQMIHNDFFRFMPSLKVLNLADSSLTNLPEGISK 580

Query: 59  VVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYEC 118
           +VSLQHLDLS S IE LP+E K LVNLKCLNLEYT+ ++ IP ++ISNL  L  LRM+  
Sbjct: 581 LVSLQHLDLSKSSIEELPLELKALVNLKCLNLEYTWSLTTIPRQLISNLSRLHVLRMFAA 640

Query: 119 A--ALPQA-RDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPS 175
           +  A  +A  DSILFG   ++VEELLGL++L V + TL + H  Q  L S   +   T +
Sbjct: 641 SHSAFDRASEDSILFGGGELIVEELLGLKYLEVISFTLRSSHGLQSFLSSHKLRSC-TRA 699

Query: 176 LCLSHFNNSKSLGVFSLASLRHLQTLQLTY-NDLDEIKIDNGGEVKRVLEISGFHSLKNV 234
           L L  FN+S SL V +LA L+ L  L +T    L+E+K+D   EV++ +    FHSLK V
Sbjct: 700 LLLQCFNDSTSLEVSALADLKQLNRLWITECKKLEELKMDYTREVQQFV----FHSLKKV 755

Query: 235 YI-SRSKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLERL 293
            I + SK +  T+L  APNL+ +E+  C  M+E++   KF EVP EV+ANL PFA+L+ L
Sbjct: 756 EILACSKLKDLTFLVFAPNLESIELMGCPAMEEMVSMGKFAEVP-EVVANLNPFAKLQNL 814

Query: 294 ILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLPLDCNRGLERKIVIKGQRRWWNELQ 353
            L    NLK+++ K LPFPHLK MS   C  LKKLPLD N   ER IVI G RRWW +L+
Sbjct: 815 KLFGATNLKSIYWKPLPFPHLKSMSFSHCYKLKKLPLDSNSARERNIVISGTRRWWEQLE 874

Query: 354 WDDEATQNAFLPCF 367
           W DEAT+NAFLPCF
Sbjct: 875 WVDEATRNAFLPCF 888




Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147852651|emb|CAN80649.1| hypothetical protein VITISV_017542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query370
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.943 0.393 0.346 1.7e-38
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.937 0.390 0.320 5.2e-36
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.945 0.391 0.317 1.3e-34
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.937 0.397 0.32 6.5e-33
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.940 0.393 0.320 6.7e-33
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.956 0.396 0.324 2.6e-30
TAIR|locus:2031356884 AT1G63360 [Arabidopsis thalian 0.556 0.233 0.331 4.7e-30
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.456 0.221 0.326 3.3e-28
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.470 0.179 0.336 2.9e-27
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.935 0.384 0.289 3.1e-23
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 421 (153.3 bits), Expect = 1.7e-38, P = 1.7e-38
 Identities = 131/378 (34%), Positives = 193/378 (51%)

Query:     1 MTNHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLF---EIS 57
             M N+IE++ ++P  P+L TL L  N    ++S FF+ M  L VL  S +  L     EIS
Sbjct:   519 MFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEIS 578

Query:    58 KVVSLQHLDLSHSRIESLPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYE 117
             + VSLQ+L LS +RI   P     L  L  LNLEYT  +  I    IS L  L+ LR++ 
Sbjct:   579 ECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICG--ISGLTSLKVLRLF- 635

Query:   118 CAALPQARDSILFGDCRXXXXXXXXXXXXXXFTITLNNFHAFQRLLGSCMPQYVSTPSLC 177
              +  P+  D  +  + +               +I L  F + QRL  SC      T +L 
Sbjct:   636 VSGFPE--DPCVLNELQLLENLQTLTITLGLASI-LEQFLSNQRL-ASC------TRALR 685

Query:   178 LSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEI----SGFHSLKN 233
             + + N   S+  F +A++  LQ L    +D+ EIK+    E    L I    + F +L  
Sbjct:   686 IENLNPQSSVISF-VATMDSLQELHFADSDIWEIKVKRN-ETVLPLHIPTTTTFFPNLSQ 743

Query:   234 VYISR-SKFRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLER 292
             V +   ++ R  TWL  APNL  + + +  D+KE+I+ EK     AE   NLIPF  L+ 
Sbjct:   744 VSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEK-----AE-QQNLIPFQELKE 797

Query:   293 LILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLPLDCNRGLERKIVIKGQRRWWNEL 352
             L LE ++ LK +H   LPFP L+++ V+ C  L+KLPL+        +VI+  ++W   L
Sbjct:   798 LRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEIL 857

Query:   353 QWDDEATQNAFLPCFKPF 370
             +W+DEAT+  FLP  K F
Sbjct:   858 EWEDEATKARFLPTLKAF 875




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034579001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (884 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query370
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 36.4 bits (85), Expect = 0.001
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 61  SLQHLDLSHSRIESLPIE-FKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRM 115
           +L+ LDLS++R+  +P   FK L NLK L+L     ++ I P+  S L  L +L +
Sbjct: 1   NLKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGNN-LTSISPEAFSGLPSLRSLDL 55


Length = 60

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 370
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.77
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.68
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.62
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.61
KOG4237498 consensus Extracellular matrix protein slit, conta 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
KOG4237498 consensus Extracellular matrix protein slit, conta 99.58
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.4
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.34
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.28
KOG4341483 consensus F-box protein containing LRR [General fu 99.25
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
KOG4341483 consensus F-box protein containing LRR [General fu 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.91
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.88
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.88
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.79
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.7
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.7
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.54
PLN03150623 hypothetical protein; Provisional 98.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.52
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.31
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.28
PLN03150623 hypothetical protein; Provisional 98.25
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.08
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.01
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.96
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.82
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.8
PRK15386426 type III secretion protein GogB; Provisional 97.76
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.63
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.56
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.55
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.5
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.39
PRK15386426 type III secretion protein GogB; Provisional 97.33
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.23
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.12
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.05
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.99
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.8
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.65
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.24
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.09
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.69
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.34
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.95
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.97
smart0037026 LRR Leucine-rich repeats, outliers. 92.97
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.71
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.31
smart0037026 LRR Leucine-rich repeats, outliers. 90.31
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.86
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.01
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 83.74
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 82.2
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.88  E-value=2.9e-22  Score=207.12  Aligned_cols=301  Identities=19%  Similarity=0.182  Sum_probs=135.8

Q ss_pred             cccc-cccCC--CCCCCCCEEecCCCcCCC-CChHHHhcCCCCcEEEccCCC---cchhhhhccccCCEEeccCCccc-c
Q 017525            3 NHIE-NLVES--PVCPRLRTLFLSSNIFHR-VNSDFFQSMASLRVLKWSYSN---PLLFEISKVVSLQHLDLSHSRIE-S   74 (370)
Q Consensus         3 n~l~-~l~~~--~~l~~L~~L~l~~~~i~~-~~~~~~~~l~~L~~L~l~~~~---~~~~~~~~l~~L~~L~l~~~~l~-~   74 (370)
                      |.+. .+|..  ..+++|++|++++|.+.. +|.   ..+++|++|++++|.   .+|..++++++|++|++++|.+. .
T Consensus       103 n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~---~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~  179 (968)
T PLN00113        103 NQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR---GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGK  179 (968)
T ss_pred             CccCCcCChHHhccCCCCCEEECcCCccccccCc---cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCccccc
Confidence            3443 44443  256666666666665542 222   345555555555554   34555555555555555555543 4


Q ss_pred             cCcccccCCcccEEeccCcccccccCcccccCCCCCcEEEccccCCCc-ccccccc------------cCCcchhhhhcc
Q 017525           75 LPIEFKCLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYECAALP-QARDSIL------------FGDCRVLVEELL  141 (370)
Q Consensus        75 lp~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~-~~~~~~~------------~~~~~~~~~~l~  141 (370)
                      +|..++++++|++|++++|...+.+|.. ++++++|++|++++| .+. .+|..+.            .......+..+.
T Consensus       180 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n-~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~  257 (968)
T PLN00113        180 IPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYN-NLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG  257 (968)
T ss_pred             CChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCC-ccCCcCChhHhcCCCCCEEECcCceeccccChhHh
Confidence            4445555555555555555433444443 555555555555555 332 1110000            000001223344


Q ss_pred             cCCCccEEEEEecchhh-hH-hhhcCCCCCccccCcEEecCcCCCCccccccccccCCCcEEEEecCCcccceeccCCCc
Q 017525          142 GLEHLSVFTITLNNFHA-FQ-RLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEV  219 (370)
Q Consensus       142 ~l~~L~~l~l~~~~~~~-~~-~~~~~~~~~~l~L~~l~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~~  219 (370)
                      .+++|+.|++..+.... .+ .+....     +|+.+++.++.-.... ...+..+++|+.|++++|.+.......+   
T Consensus       258 ~l~~L~~L~L~~n~l~~~~p~~l~~l~-----~L~~L~Ls~n~l~~~~-p~~~~~l~~L~~L~l~~n~~~~~~~~~~---  328 (968)
T PLN00113        258 NLKNLQYLFLYQNKLSGPIPPSIFSLQ-----KLISLDLSDNSLSGEI-PELVIQLQNLEILHLFSNNFTGKIPVAL---  328 (968)
T ss_pred             CCCCCCEEECcCCeeeccCchhHhhcc-----CcCEEECcCCeeccCC-ChhHcCCCCCcEEECCCCccCCcCChhH---
Confidence            44555555554443321 11 111111     2444444433211111 1133445555666655555443222111   


Q ss_pred             cccccccccccCcEEEEecccccc-c-CcccCCCCccEEeeccCcchHHhhhcc-cc----------CCCcccccCCccc
Q 017525          220 KRVLEISGFHSLKNVYISRSKFRH-A-TWLFLAPNLKRVEIDNCQDMKEIIDSE-KF----------GEVPAEVMANLIP  286 (370)
Q Consensus       220 ~~~~~~~~~~~L~~L~l~~~~l~~-~-~~l~~l~~L~~L~L~~~~~~~~~~~~~-~~----------~~~~~~~~~~~~~  286 (370)
                            ..+++|+.|++++|++++ + ..++.+++|+.|++++|.....+...- ..          .......+..+..
T Consensus       329 ------~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~  402 (968)
T PLN00113        329 ------TSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGA  402 (968)
T ss_pred             ------hcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhC
Confidence                  345666666666665543 2 235556666666666665332211100 00          0000012234455


Q ss_pred             cccccccccccccccccccCCCccCCCcceEeecCCC
Q 017525          287 FARLERLILEELKNLKTVHSKALPFPHLKEMSVDRCP  323 (370)
Q Consensus       287 ~p~L~~L~l~~~~~l~~i~~~~~~~~~L~~L~l~~c~  323 (370)
                      +++|+.|++++|.--..++.....++.|+.|+++++.
T Consensus       403 ~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~  439 (968)
T PLN00113        403 CRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNN  439 (968)
T ss_pred             CCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCc
Confidence            6666666666664323333334456677777776653



>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query370
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
 Score = 76.1 bits (187), Expect = 3e-15
 Identities = 37/243 (15%), Positives = 82/243 (33%), Gaps = 38/243 (15%)

Query: 3   NHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSY----SNPLLFEISK 58
           N + +L       +L  L L  N    +  DF      +  L +S+      P +F    
Sbjct: 583 NKVRHLEAFGTNVKLTDLKLDYNQIEEIPEDFCAFTDQVEGLGFSHNKLKYIPNIFNAKS 642

Query: 59  VVSLQHLDLSHSRIESLPIE-FKCLVNLKCLNLEYTY----GISRIPPKVISNLKILETL 113
           V  +  +D S+++I S        + + K +N          I + P ++ +    + T+
Sbjct: 643 VYVMGSVDFSYNKIGSEGRNISCSMDDYKGINASTVTLSYNEIQKFPTELFATGSPISTI 702

Query: 114 RMYEC--AALPQARDSIL---FGDCRVLVE---------------ELLGLEHLSVFTITL 153
            +      ++P+         + +  +L                     L +LS   ++ 
Sbjct: 703 ILSNNLMTSIPENSLKPKDGNYKNTYLLTTIDLRFNKLTSLSDDFRATTLPYLSNMDVSY 762

Query: 154 NNFHAFQRLLGSCMPQYVSTPSLCLSH---FNNSKSLGVF--SLASLRHLQTLQLTYNDL 208
           N F +F     +         +  + H      ++ L  +   + +   L  LQ+  ND+
Sbjct: 763 NCFSSFPTQPLNS----SQLKAFGIRHQRDAEGNRILRQWPTGITTCPSLIQLQIGSNDI 818

Query: 209 DEI 211
            ++
Sbjct: 819 RKV 821


>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query370
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.85
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.57
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.56
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.48
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.45
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.36
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.36
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.34
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.33
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.27
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.09
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.92
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.91
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.9
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.85
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.83
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.79
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.72
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.65
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.61
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.5
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.3
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.92
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.82
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.43
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.19
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.96
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.79
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.95  E-value=1.3e-26  Score=211.18  Aligned_cols=273  Identities=15%  Similarity=0.207  Sum_probs=178.9

Q ss_pred             CcccccccCCCCCCCCCEEecCCCcCCCCChHHHhcCCCCcEEEccCCC-cchhhhhccccCCEEeccCCcccccCcccc
Q 017525            2 TNHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSN-PLLFEISKVVSLQHLDLSHSRIESLPIEFK   80 (370)
Q Consensus         2 ~n~l~~l~~~~~l~~L~~L~l~~~~i~~~~~~~~~~l~~L~~L~l~~~~-~~~~~~~~l~~L~~L~l~~~~l~~lp~~~~   80 (370)
                      ++.++.++....+++|++|++++|.++.++.  +..+++|++|++++|. .....+..+++|++|++++|.++.++. +.
T Consensus        53 ~~~i~~~~~~~~~~~L~~L~l~~n~i~~~~~--~~~l~~L~~L~L~~n~i~~~~~~~~l~~L~~L~l~~n~i~~~~~-~~  129 (347)
T 4fmz_A           53 GEKVASIQGIEYLTNLEYLNLNGNQITDISP--LSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNEDNISDISP-LA  129 (347)
T ss_dssp             SSCCCCCTTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCCGGGTTCTTCSEEECTTSCCCCCGG-GT
T ss_pred             CCccccchhhhhcCCccEEEccCCccccchh--hhcCCcCCEEEccCCcccCchHHcCCCcCCEEECcCCcccCchh-hc
Confidence            3455666655667777777777777776665  6777777777777776 223356777777777777777766655 66


Q ss_pred             cCCcccEEeccCcccccccCcccccCCCCCcEEEccccCCCcccccccccCCcchhhhhcccCCCccEEEEEecchhhhH
Q 017525           81 CLVNLKCLNLEYTYGISRIPPKVISNLKILETLRMYECAALPQARDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQ  160 (370)
Q Consensus        81 ~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~l~l~~~~~~~~~  160 (370)
                      .+++|+.|++++|......+.  +..+++|++|++++| .+..++             .+..+++|+.++++++....+.
T Consensus       130 ~l~~L~~L~l~~n~~~~~~~~--~~~l~~L~~L~l~~~-~~~~~~-------------~~~~l~~L~~L~l~~n~l~~~~  193 (347)
T 4fmz_A          130 NLTKMYSLNLGANHNLSDLSP--LSNMTGLNYLTVTES-KVKDVT-------------PIANLTDLYSLSLNYNQIEDIS  193 (347)
T ss_dssp             TCTTCCEEECTTCTTCCCCGG--GTTCTTCCEEECCSS-CCCCCG-------------GGGGCTTCSEEECTTSCCCCCG
T ss_pred             cCCceeEEECCCCCCcccccc--hhhCCCCcEEEecCC-CcCCch-------------hhccCCCCCEEEccCCcccccc
Confidence            777777777777755544433  677777777777777 554221             2566777777777777666555


Q ss_pred             hhhcCCCCCccccCcEEecCcCCCCccccccccccCCCcEEEEecCCcccceeccCCCccccccccccccCcEEEEeccc
Q 017525          161 RLLGSCMPQYVSTPSLCLSHFNNSKSLGVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEISGFHSLKNVYISRSK  240 (370)
Q Consensus       161 ~~~~~~~~~~l~L~~l~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  240 (370)
                      .+....     .++.+.+.++.-....   .+..+++|++|++++|.++.++. +          ..+++|++|++++|+
T Consensus       194 ~~~~l~-----~L~~L~l~~n~l~~~~---~~~~~~~L~~L~l~~n~l~~~~~-~----------~~l~~L~~L~l~~n~  254 (347)
T 4fmz_A          194 PLASLT-----SLHYFTAYVNQITDIT---PVANMTRLNSLKIGNNKITDLSP-L----------ANLSQLTWLEIGTNQ  254 (347)
T ss_dssp             GGGGCT-----TCCEEECCSSCCCCCG---GGGGCTTCCEEECCSSCCCCCGG-G----------TTCTTCCEEECCSSC
T ss_pred             cccCCC-----ccceeecccCCCCCCc---hhhcCCcCCEEEccCCccCCCcc-h----------hcCCCCCEEECCCCc
Confidence            433333     2555666554332222   36677788888888877776643 1          567788888888887


Q ss_pred             ccccCcccCCCCccEEeeccCcchHHhhhccccCCCcccccCCccccccccccccccccccccccC-CCccCCCcceEee
Q 017525          241 FRHATWLFLAPNLKRVEIDNCQDMKEIIDSEKFGEVPAEVMANLIPFARLERLILEELKNLKTVHS-KALPFPHLKEMSV  319 (370)
Q Consensus       241 l~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~L~~L~l~~~~~l~~i~~-~~~~~~~L~~L~l  319 (370)
                      ++.++.+..+++|+.|++++|.. +++              ..+..+++|+.|++++| .+..... ....+++|+.|++
T Consensus       255 l~~~~~~~~l~~L~~L~l~~n~l-~~~--------------~~~~~l~~L~~L~L~~n-~l~~~~~~~l~~l~~L~~L~L  318 (347)
T 4fmz_A          255 ISDINAVKDLTKLKMLNVGSNQI-SDI--------------SVLNNLSQLNSLFLNNN-QLGNEDMEVIGGLTNLTTLFL  318 (347)
T ss_dssp             CCCCGGGTTCTTCCEEECCSSCC-CCC--------------GGGGGCTTCSEEECCSS-CCCGGGHHHHHTCTTCSEEEC
T ss_pred             cCCChhHhcCCCcCEEEccCCcc-CCC--------------hhhcCCCCCCEEECcCC-cCCCcChhHhhccccCCEEEc
Confidence            77777777788888888888753 222              14567788888888887 3444332 2345788888888


Q ss_pred             cCCCCCCCCC
Q 017525          320 DRCPLLKKLP  329 (370)
Q Consensus       320 ~~c~~L~~l~  329 (370)
                      ++|+ ++.++
T Consensus       319 ~~n~-l~~~~  327 (347)
T 4fmz_A          319 SQNH-ITDIR  327 (347)
T ss_dssp             CSSS-CCCCG
T ss_pred             cCCc-ccccc
Confidence            8875 55443



>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 370
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 43.2 bits (101), Expect = 5e-06
 Identities = 16/115 (13%), Positives = 35/115 (30%), Gaps = 4/115 (3%)

Query: 3   NHIENLVESPVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSNPLLFEISKVVSL 62
             +  L        +  L LS N    +            +     +   +  ++ +  L
Sbjct: 8   KDLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGVANLPRL 67

Query: 63  QHLDLSHSRIESLPI--EFKCLVNLKCLNLEYTY--GISRIPPKVISNLKILETL 113
           Q L L ++R++             L  LNL+         I  ++   L  + ++
Sbjct: 68  QELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSSI 122


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query370
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.0
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.98
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.83
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.93
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.74
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.51
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.14
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.02
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.87  E-value=4.4e-21  Score=174.50  Aligned_cols=263  Identities=16%  Similarity=0.200  Sum_probs=165.6

Q ss_pred             CCCCCCCEEecCCCcCCCCChHHHhcCCCCcEEEccCCC--cchhhhhccccCCEEeccCCcccccCcccccCCcccEEe
Q 017525           12 PVCPRLRTLFLSSNIFHRVNSDFFQSMASLRVLKWSYSN--PLLFEISKVVSLQHLDLSHSRIESLPIEFKCLVNLKCLN   89 (370)
Q Consensus        12 ~~l~~L~~L~l~~~~i~~~~~~~~~~l~~L~~L~l~~~~--~~~~~~~~l~~L~~L~l~~~~l~~lp~~~~~l~~L~~L~   89 (370)
                      .++.+|++|+++++.|+.+..  +..+++|++|++++|.  .++ .++++++|++|++++|.++.++ .++.+++|+.|+
T Consensus        41 ~~l~~l~~L~l~~~~I~~l~g--l~~L~nL~~L~Ls~N~l~~l~-~l~~L~~L~~L~L~~n~i~~i~-~l~~l~~L~~L~  116 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSIDG--VEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQIADIT-PLANLTNLTGLT  116 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCCTT--GGGCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSSCCCCCG-GGTTCTTCCEEE
T ss_pred             HHhCCCCEEECCCCCCCCccc--cccCCCCCEEeCcCCcCCCCc-cccCCccccccccccccccccc-cccccccccccc
Confidence            456677777777777776642  5677777777777777  443 4777777777777777776665 366777777777


Q ss_pred             ccCcccccc--------------------------------------------------------------cCcccccCC
Q 017525           90 LEYTYGISR--------------------------------------------------------------IPPKVISNL  107 (370)
Q Consensus        90 l~~~~~~~~--------------------------------------------------------------~~~~~~~~l  107 (370)
                      ++++...+.                                                              ........+
T Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  196 (384)
T d2omza2         117 LFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKL  196 (384)
T ss_dssp             CCSSCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGC
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccccccc
Confidence            765422110                                                              000124566


Q ss_pred             CCCcEEEccccCCCcccccccccCCcchhhhhcccCCCccEEEEEecchhhhHhhhcCCCCCccccCcEEecCcCCCCcc
Q 017525          108 KILETLRMYECAALPQARDSILFGDCRVLVEELLGLEHLSVFTITLNNFHAFQRLLGSCMPQYVSTPSLCLSHFNNSKSL  187 (370)
Q Consensus       108 ~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~l~l~~~~~~~~~~~~~~~~~~~l~L~~l~l~~~~~~~~~  187 (370)
                      ++++.+++++| .+..+             ......++|+.+++.++....++.+....+     ++.+.+.++.-..  
T Consensus       197 ~~~~~l~l~~n-~i~~~-------------~~~~~~~~L~~L~l~~n~l~~~~~l~~l~~-----L~~L~l~~n~l~~--  255 (384)
T d2omza2         197 TNLESLIATNN-QISDI-------------TPLGILTNLDELSLNGNQLKDIGTLASLTN-----LTDLDLANNQISN--  255 (384)
T ss_dssp             TTCSEEECCSS-CCCCC-------------GGGGGCTTCCEEECCSSCCCCCGGGGGCTT-----CSEEECCSSCCCC--
T ss_pred             cccceeeccCC-ccCCC-------------CcccccCCCCEEECCCCCCCCcchhhcccc-----cchhccccCccCC--
Confidence            78888888887 55522             224556788888888887776655544443     6667766654322  


Q ss_pred             ccccccccCCCcEEEEecCCcccceeccCCCccccccccccccCcEEEEecccccccCcccCCCCccEEeeccCcchHHh
Q 017525          188 GVFSLASLRHLQTLQLTYNDLDEIKIDNGGEVKRVLEISGFHSLKNVYISRSKFRHATWLFLAPNLKRVEIDNCQDMKEI  267 (370)
Q Consensus       188 ~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~l~~l~~L~~L~L~~~~~~~~~  267 (370)
                       ...+..+++|++|+++++.+..++. +          ..++.++.+.+..|+++++..+..+++++.|++++|.. +++
T Consensus       256 -~~~~~~~~~L~~L~l~~~~l~~~~~-~----------~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~l-~~l  322 (384)
T d2omza2         256 -LAPLSGLTKLTELKLGANQISNISP-L----------AGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNI-SDI  322 (384)
T ss_dssp             -CGGGTTCTTCSEEECCSSCCCCCGG-G----------TTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSSCC-SCC
T ss_pred             -CCcccccccCCEeeccCcccCCCCc-c----------ccccccccccccccccccccccchhcccCeEECCCCCC-CCC
Confidence             2357778889999998887776532 1          34566666666666666665566666777777766642 222


Q ss_pred             hhccccCCCcccccCCccccccccccccccccccccccCCCccCCCcceEeecCCCCCCCCC
Q 017525          268 IDSEKFGEVPAEVMANLIPFARLERLILEELKNLKTVHSKALPFPHLKEMSVDRCPLLKKLP  329 (370)
Q Consensus       268 ~~~~~~~~~~~~~~~~~~~~p~L~~L~l~~~~~l~~i~~~~~~~~~L~~L~l~~c~~L~~l~  329 (370)
                      .              .+..+|+|+.|++++| .+++++ ....+++|+.|+++++ +++.++
T Consensus       323 ~--------------~l~~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~  367 (384)
T d2omza2         323 S--------------PVSSLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHN-QISDLT  367 (384)
T ss_dssp             G--------------GGGGCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSS-CCCBCG
T ss_pred             c--------------ccccCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCC-cCCCCh
Confidence            1              3456667777777666 455554 2445666777777655 455543



>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure