Citrus Sinensis ID: 017534

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370

MLKPFCNVTDQAQCRFLGLPSPVPRFRRRYAVVPCSRPMNKPTAPVQVQAIVSDQGSPARLESGPCSLADRLRLGTLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLAFPEENSSSSRKISKLEDPAQYSRLGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQDDVVDSLTSAEPFEDAEPVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGDGSEINRGRSVWRKKPAR

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccEEEEEEEEEEEEEccccccEEEEEEEEEEccccEEEEEEEEEEcccccEEEEEEEEEEEEEccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccEEccccccccccHHHHHHHHHHHccccHHccccEEEEEEEEccccccccEEEEEEEEccccccccEEEccccccccEEEcccccccEEEEEEEEcccccEEEEEEEEEEccccc

cccccccccccccccEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccEEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccEEEEEEEEEEEEEccccccEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEEEEEEEcccccEcccccHHHHHHHccccccccccccccccccccccccccccHHHHHcccccEEEccccccccccHHHHHHHHHHcccHHHHHcccccEEEEEEEEEcccccEEEEEEEEcccccccEEEccccEccEEEEccccccccEEEEEEEEcccccEEEEcEEEEcccccc

mlkpfcnvtdqaqcrflglpspvprfrrryavvpcsrpmnkptapvQVQAIVsdqgsparlesgpcsladrlrlgtltedglsykEKFIVRCYEVGINKTATVETIANLLQEVGcnhaqsvgfstdgfattTTMRKLHLIWVTARMHIEiykypawsdVVEIETWCqsegrigtrrdwilkdyatgevigRATSKWVMMNQDTRRLQKVSDDVREEYLVFCprelrlafpeenssssrkiskledpaqysrlgliprradldmnqhvnNVTYIGWLLesmpqdvidtheLQTITLDYRrecqqddvvdsltsaepfedaepvsklqgtngspaitgdkednHQFLHLLRlsgdgseinrgrsvwrkkpar

mlkpfcnvtdqaqcrflglpspvprfRRRYAVVpcsrpmnkptapVQVQAIVSDQGsparlesgpcsladrLRLGtltedglsykeKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQsegrigtrrdwilkdyatgevigratskwvmmnqdTRRLQKVSDDVREEYLVFcprelrlafpeenssssrkiskledpaqySRLGLIprradldmnQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQDDVVDSLTsaepfedaepvsklqgtNGSPAITGDKEDNHQFLHLlrlsgdgseinrgrsvwrkkpar

****FCNVTDQAQCRFLGLPSPVPRFRRRYAVVPC*******************************SLADRLRLGTLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLA***********************LGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQ*****************************************LHLL**********************

**************RFLGLP*******************************************************TLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLAFPEENSSSSRKISKLEDPAQYSRLGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQDDVVDSLTSAEPFEDAEPVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGDGSEINRGRS*WR*****

MLKPFCNVTDQAQCRFLGLPSPVPRFRRRYAVVPCSRPMNKPTAPVQVQAIVSDQGSPARLESGPCSLADRLRLGTLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLAFP*********ISKLEDPAQYSRLGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQDDVVDSLTSAEPFEDAEPVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGDGSEIN************

*******************************VVPCSRPMNKPTAPVQVQAIVSDQGSPARLESGPCSLADRLRLGTLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLAFPEENSSSSRKISKLEDPAQYSRLGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQDDVVDSLTSAEPFEDAEPVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGDGSEINRGRSVWRK****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		370	2.2.26 [Sep-21-2011]
Q42561		362	Oleoyl-acyl carrier prote	yes	no	0.956	0.977	0.734	1e-153
Q42712		369	Oleoyl-acyl carrier prote	N/A	no	0.959	0.962	0.726	1e-146
Q9SV64		367	Oleoyl-acyl carrier prote	no	no	0.978	0.986	0.704	1e-145
Q39513		415	Palmitoyl-acyl carrier pr	N/A	no	0.740	0.660	0.452	4e-70
Q9SJE2		412	Palmitoyl-acyl carrier pr	no	no	0.745	0.669	0.437	6e-67
Q9SQI3		413	Palmitoyl-acyl carrier pr	N/A	no	0.767	0.687	0.435	1e-65
Q39473		382	Myristoyl-acyl carrier pr	N/A	no	0.705	0.683	0.392	1e-54
Q41635		382	Lauroyl-acyl carrier prot	N/A	no	0.697	0.675	0.384	6e-54

>sp\|Q42561\|FATA1_ARATH Oleoyl-acyl carrier protein thioesterase 1, chloroplastic OS=Arabidopsis thaliana GN=FATA PE=1 SV=1	Back alignment and function desciption

 Score =  541 bits (1395), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 276/376 (73%), Positives = 304/376 (80%), Gaps = 22/376 (5%)

Query: 1   MLKPFCNVTDQAQCRFLGLPS------PVPRFRRRYAVVPCSRPMNKPTAPVQVQAIVS- 53
           MLK  CNVTD    R L   S      PV   RRR  +V CS+   K T  V ++A+VS 
Sbjct: 1   MLKLSCNVTDSKLQRSLLFFSHSYRSDPVNFIRRR--IVSCSQ--TKKTGLVPLRAVVSA 56

Query: 54  DQGSPARLESGPCSLADRLRLGTLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEV 113
           DQGS  +   G  +LAD+LRLG+LTEDGLSYKEKF+VR YEVG NKTATVETIANLLQEV
Sbjct: 57  DQGSVVQ---GLATLADQLRLGSLTEDGLSYKEKFVVRSYEVGSNKTATVETIANLLQEV 113

Query: 114 GCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIG 173
           GCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAW DVVEIETWCQSEGRIG
Sbjct: 114 GCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWGDVVEIETWCQSEGRIG 173

Query: 174 TRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLAFPEEN 233
           TRRDWILKD  TGEV GRATSKWVMMNQDTRRLQKVSDDVR+EYLVFCP+E RLAFPEEN
Sbjct: 174 TRRDWILKDSVTGEVTGRATSKWVMMNQDTRRLQKVSDDVRDEYLVFCPQEPRLAFPEEN 233

Query: 234 SSSSRKISKLEDPAQYSRLGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTI 293
           + S +KI KLEDPAQYS +GL PRRADLDMNQHVNNVTYIGW+LES+PQ+++DTHELQ I
Sbjct: 234 NRSLKKIPKLEDPAQYSMIGLKPRRADLDMNQHVNNVTYIGWVLESIPQEIVDTHELQVI 293

Query: 294 TLDYRRECQQDDVVDSLTSAEPFEDAEPVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGD 353
           TLDYRRECQQDDVVDSLT+          S++ GTNGS        ++ QFLHLLRLSGD
Sbjct: 294 TLDYRRECQQDDVVDSLTTT--------TSEIGGTNGSATSGTQGHNDSQFLHLLRLSGD 345

Query: 354 GSEINRGRSVWRKKPA 369
           G EINRG ++WRKKP+
Sbjct: 346 GQEINRGTTLWRKKPS 361

Plays an essential role in chain termination during de novo fatty acid synthesis. Possesses high thioesterase activity for oleoyl-ACP versus other acyl-ACPs. Substrate preference is 18:1 > 18:0 > 16:1.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 1EC: 4

>sp\|Q42712\|FATA_CORSA Oleoyl-acyl carrier protein thioesterase, chloroplastic (Fragment) OS=Coriandrum sativum GN=FATA PE=2 SV=1	Back alignment and function description

>sp\|Q9SV64\|FATA2_ARATH Oleoyl-acyl carrier protein thioesterase 2, chloroplastic OS=Arabidopsis thaliana GN=FATA2 PE=2 SV=1	Back alignment and function description

>sp\|Q39513\|FATB_CUPHO Palmitoyl-acyl carrier protein thioesterase, chloroplastic OS=Cuphea hookeriana GN=FATB1 PE=2 SV=1	Back alignment and function description

>sp\|Q9SJE2\|FATB_ARATH Palmitoyl-acyl carrier protein thioesterase, chloroplastic OS=Arabidopsis thaliana GN=FATB PE=1 SV=1	Back alignment and function description

>sp\|Q9SQI3\|FATB_GOSHI Palmitoyl-acyl carrier protein thioesterase, chloroplastic OS=Gossypium hirsutum GN=FATB1 PE=1 SV=1	Back alignment and function description

>sp\|Q39473\|FATB_CINCA Myristoyl-acyl carrier protein thioesterase, chloroplastic OS=Cinnamomum camphora GN=FATB1 PE=2 SV=1	Back alignment and function description

>sp\|Q41635\|FATB_UMBCA Lauroyl-acyl carrier protein thioesterase, chloroplastic OS=Umbellularia californica GN=FATB1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		370
255583996		371	Oleoyl-acyl carrier protein thioesterase	0.983	0.981	0.766	1e-164
359496041		376	PREDICTED: oleoyl-acyl carrier protein t	0.991	0.976	0.754	1e-162
296933855		369	acyl-ACP thioesterase [Jatropha curcas]	0.981	0.983	0.749	1e-157
449443716		371	PREDICTED: oleoyl-acyl carrier protein t	0.970	0.967	0.752	1e-156
595957		362	Br FatA1 [Brassica rapa]	0.970	0.991	0.748	1e-155
356567848		374	PREDICTED: oleoyl-acyl carrier protein t	0.989	0.978	0.732	1e-152
15230256		362	fatA acyl-ACP thioesterase [Arabidopsis	0.956	0.977	0.734	1e-151
296090531		297	unnamed protein product [Vitis vinifera]	0.802	1.0	0.845	1e-151
297835598		360	fata acyl-acp thioesterase [Arabidopsis	0.954	0.980	0.729	1e-151
404028		389	oleoyl-acyl carrier protein thioesterase	0.821	0.781	0.819	1e-149

>gi\|255583996\|ref\|XP_002532744.1\| Oleoyl-acyl carrier protein thioesterase, putative [Ricinus communis] gi\|152206074\|gb\|ABS30422.1\| acyl-ACP thioesterase FatA [Ricinus communis] gi\|223527521\|gb\|EEF29646.1\| Oleoyl-acyl carrier protein thioesterase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 289/377 (76%), Positives = 317/377 (84%), Gaps = 13/377 (3%)

Query: 1   MLK-PFCNVTD-----QAQCRFLGLPSPVPRFRRRYAVVPCSRPMNKPTAPVQVQAIVSD 54
           MLK P CN TD      +QCRFL   +  P F RR ++       N   +   +QA+VSD
Sbjct: 1   MLKVPCCNATDPIQSLSSQCRFLTHFNNRPYFTRRPSIPTFFSSKN---SSASLQAVVSD 57

Query: 55  QGSPARLESGPC-SLADRLRLGTLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEV 113
             S   +ES  C SLA+RLRLG LTEDG SYKEKFIVR YEVGINKTATVETIANLLQEV
Sbjct: 58  ISS---VESAACDSLANRLRLGKLTEDGFSYKEKFIVRSYEVGINKTATVETIANLLQEV 114

Query: 114 GCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIG 173
           GCNHAQSVGFSTDGFATTT+MRK+HLIWVTARMHIEIYKYPAWSDVVE+ETWCQSEGRIG
Sbjct: 115 GCNHAQSVGFSTDGFATTTSMRKMHLIWVTARMHIEIYKYPAWSDVVEVETWCQSEGRIG 174

Query: 174 TRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLAFPEEN 233
           TRRDWIL DYATG++IGRATSKWVMMNQDTRRLQKV+DDVREEYLVFCPRELRLAFPEEN
Sbjct: 175 TRRDWILTDYATGQIIGRATSKWVMMNQDTRRLQKVTDDVREEYLVFCPRELRLAFPEEN 234

Query: 234 SSSSRKISKLEDPAQYSRLGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTI 293
           + SS+KISKLEDPAQYS+LGL+PRRADLDMNQHVNNVTYIGW+LES+PQ++IDTHELQTI
Sbjct: 235 NRSSKKISKLEDPAQYSKLGLVPRRADLDMNQHVNNVTYIGWVLESIPQEIIDTHELQTI 294

Query: 294 TLDYRRECQQDDVVDSLTSAEPFEDAEPVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGD 353
           TLDYRRECQ DD+VDSLTS EP E+ E VS+L+GTNGS   T   ED   FLHLLRLSGD
Sbjct: 295 TLDYRRECQHDDIVDSLTSVEPSENLEAVSELRGTNGSATTTAGDEDCRNFLHLLRLSGD 354

Query: 354 GSEINRGRSVWRKKPAR 370
           G EINRGR+ WRKK AR
Sbjct: 355 GLEINRGRTEWRKKSAR 371

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359496041\|ref\|XP_002262721.2\| PREDICTED: oleoyl-acyl carrier protein thioesterase, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296933855\|gb\|ABX82799.3\| acyl-ACP thioesterase [Jatropha curcas]	Back alignment and taxonomy information

>gi\|449443716\|ref\|XP_004139623.1\| PREDICTED: oleoyl-acyl carrier protein thioesterase 2, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|595957\|gb\|AAC49002.1\| Br FatA1 [Brassica rapa]	Back alignment and taxonomy information

>gi\|356567848\|ref\|XP_003552127.1\| PREDICTED: oleoyl-acyl carrier protein thioesterase, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi|15230256|ref|NP_189147.1| fatA acyl-ACP thioesterase [Arabidopsis thaliana] gi|75275267|sp|Q42561.1|FATA1_ARATH RecName: Full=Oleoyl-acyl carrier protein thioesterase 1, chloroplastic; AltName: Full=18:0-acyl-carrier protein thioesterase; Short=18:0-ACP thioesterase; AltName: Full=Acyl-[acyl-carrier-protein] hydrolase; Flags: Precursor gi|804946|emb|CAA85389.1| acyl-(acyl carrier protein) thioesterase [Arabidopsis thaliana] gi|9294167|dbj|BAB02069.1| acyl carrier protein thioesterase [Arabidopsis thaliana] gi|51970352|dbj|BAD43868.1| acyl-(acyl carrier protein) thioesterase [Arabidopsis thaliana] gi|332643459|gb|AEE76980.1| fatA acyl-ACP thioesterase [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|296090531\|emb\|CBI40881.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297835598\|ref\|XP_002885681.1\| fata acyl-acp thioesterase [Arabidopsis lyrata subsp. lyrata] gi\|297331521\|gb\|EFH61940.1\| fata acyl-acp thioesterase [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|404028\|gb\|AAA33020.1\| oleoyl-acyl carrier protein thioesterase [Carthamus tinctorius] gi\|445624\|prf\|\|1909371A oleoyl acyl carrier protein thioesterase	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		370
TAIR\|locus:2090285		362	FaTA "AT3G25110" [Arabidopsis	0.954	0.975	0.740	1.5e-138
TAIR\|locus:2123256		367	AT4G13050 "AT4G13050" [Arabido	0.978	0.986	0.706	1e-132
TAIR\|locus:2201786		412	FATB "AT1G08510" [Arabidopsis	0.645	0.580	0.469	4.5e-59
UNIPROTKB\|Q3ADW4		252	CHY_0816 "Acyl carrier protein	0.5	0.734	0.263	2.7e-12
TIGR_CMR\|CHY_0816		252	CHY_0816 "acyl carrier protein	0.5	0.734	0.263	2.7e-12

TAIR\|locus:2090285 FaTA "AT3G25110" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1356 (482.4 bits), Expect = 1.5e-138, P = 1.5e-138
 Identities = 279/377 (74%), Positives = 307/377 (81%)

Query:     1 MLKPFCNVTDQAQCRFLGLPS------PVPRFRRRYAVVPCSRPMNKPTAPVQVQAIVS- 53
             MLK  CNVTD    R L   S      PV   RRR  +V CS+   K T  V ++A+VS 
Sbjct:     1 MLKLSCNVTDSKLQRSLLFFSHSYRSDPVNFIRRR--IVSCSQ--TKKTGLVPLRAVVSA 56

Query:    54 DQGSPARLESGPCSLADRLRLGTLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEV 113
             DQGS  +   G  +LAD+LRLG+LTEDGLSYKEKF+VR YEVG NKTATVETIANLLQEV
Sbjct:    57 DQGSVVQ---GLATLADQLRLGSLTEDGLSYKEKFVVRSYEVGSNKTATVETIANLLQEV 113

Query:   114 GCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIG 173
             GCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAW DVVEIETWCQSEGRIG
Sbjct:   114 GCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWGDVVEIETWCQSEGRIG 173

Query:   174 TRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLAFPEEN 233
             TRRDWILKD  TGEV GRATSKWVMMNQDTRRLQKVSDDVR+EYLVFCP+E RLAFPEEN
Sbjct:   174 TRRDWILKDSVTGEVTGRATSKWVMMNQDTRRLQKVSDDVRDEYLVFCPQEPRLAFPEEN 233

Query:   234 SSSSRKISKLEDPAQYSRLGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTI 293
             + S +KI KLEDPAQYS +GL PRRADLDMNQHVNNVTYIGW+LES+PQ+++DTHELQ I
Sbjct:   234 NRSLKKIPKLEDPAQYSMIGLKPRRADLDMNQHVNNVTYIGWVLESIPQEIVDTHELQVI 293

Query:   294 TLDYRRECQQDDVVDSLTSAEPFEDAEPVSKLQGTNGSPAITGDKEDNH-QFLHLLRLSG 352
             TLDYRRECQQDDVVDSLT+          S++ GTNGS A +G +  N  QFLHLLRLSG
Sbjct:   294 TLDYRRECQQDDVVDSLTTT--------TSEIGGTNGS-ATSGTQGHNDSQFLHLLRLSG 344

Query:   353 DGSEINRGRSVWRKKPA 369
             DG EINRG ++WRKKP+
Sbjct:   345 DGQEINRGTTLWRKKPS 361

GO:0000036 "ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process" evidence=ISS

GO:0006633 "fatty acid biosynthetic process" evidence=IGI;ISS

GO:0009507 "chloroplast" evidence=ISM

GO:0016790 "thiolester hydrolase activity" evidence=IEA

GO:0016297 "acyl-[acyl-carrier-protein

TAIR\|locus:2123256 AT4G13050 "AT4G13050" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201786 FATB "AT1G08510" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3ADW4 CHY_0816 "Acyl carrier protein thioesterase, homolog" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_0816 CHY_0816 "acyl carrier protein thioesterase, homolog" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q42712	FATA_CORSA	3, ., 1, ., 2, ., 1, 4	0.7265	0.9594	0.9620	N/A	no
Q42561	FATA1_ARATH	3, ., 1, ., 2, ., 1, 4	0.7340	0.9567	0.9779	yes	no
Q9SV64	FATA2_ARATH	3, ., 1, ., 2, ., 1, 4	0.704	0.9783	0.9863	no	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.2	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00010638001	SubName- Full=Chromosome undetermined scaffold_274, whole genome shotgun sequence; (372 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00024709001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (393 aa)	•	•	0.901
	GSVIVG00025373001	SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (369 aa)	•	•	0.900
	GSVIVG00034687001	RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (392 aa)	•		0.899
	GSVIVG00034686001	SubName- Full=Chromosome chr5 scaffold_72, whole genome shotgun sequence; (262 aa)	•		0.899
	GSVIVG00034670001	RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (362 aa)	•		0.899
	GSVIVG00014296001	RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (389 aa)	•		0.899
	GSVIVG00012872001	RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (393 aa)	•		0.899
	GSVIVG00005265001	RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (393 aa)	•		0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		370
pfam01643		249	pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase	1e-138
PLN02370		419	PLN02370, PLN02370, acyl-ACP thioesterase	8e-89
COG3884		250	COG3884, FatA, Acyl-ACP thioesterase [Lipid metabo	1e-22
cd00586		110	cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase (	2e-16
COG0824		137	COG0824, FcbC, Predicted thioesterase [General fun	2e-08

>gnl\|CDD\|216622 pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase	Back alignment and domain information

 Score =  392 bits (1008), Expect = e-138
 Identities = 144/286 (50%), Positives = 185/286 (64%), Gaps = 37/286 (12%)

Query: 81  GLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLI 140
           GL ++E F +R YE+ +N TA++ET+ N LQEV  NH++S+G S DGF     M+K +LI
Sbjct: 1   GLVFRENFSIRSYEIDVNGTASIETLMNHLQEVSLNHSKSLGLSGDGF-----MKKRNLI 55

Query: 141 WVTARMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKWVMMN 200
           WV  R  IEI +YPAW DVVEIETW  S G+ G  RDW++ D  TGE++ RATS WVMMN
Sbjct: 56  WVVTRYQIEIDRYPAWGDVVEIETWASSYGKNGCYRDWLVYDCETGEILIRATSVWVMMN 115

Query: 201 QDTRRLQKVSDDVREEYLVFCPRELRLAFPEENSSSSRKISKLEDPAQYSRLGLIPRRAD 260
           Q+TRRL K+ D+VR EY             EE+     K+ K E  A+  R GL  R +D
Sbjct: 116 QETRRLSKIPDEVRAEYG-----------QEESVKKLPKLPKDESTAESIRKGLTVRWSD 164

Query: 261 LDMNQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQDDVVDSLTSAEPFEDAE 320
           LDMNQHVNNV YIGW+LES+PQ++++THEL++ITL+YR+E Q  DVV+SLT+ EP     
Sbjct: 165 LDMNQHVNNVKYIGWILESLPQEILETHELKSITLEYRKEVQYGDVVESLTAVEP----- 219

Query: 321 PVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGDGSEINRGRSVWRK 366
                           + ED  Q LHL+RL  DG EI RGR+ WRK
Sbjct: 220 ---------------AESEDGLQCLHLIRLD-DGEEIARGRTEWRK 249

This family consists of various acyl-acyl carrier protein (ACP) thioesterases (TE) these terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid. Length = 249

>gnl\|CDD\|215210 PLN02370, PLN02370, acyl-ACP thioesterase	Back alignment and domain information

>gnl\|CDD\|226401 COG3884, FatA, Acyl-ACP thioesterase [Lipid metabolism]	Back alignment and domain information

>gnl\|CDD\|238329 cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase (4HBT)	Back alignment and domain information

>gnl\|CDD\|223894 COG0824, FcbC, Predicted thioesterase [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		370
PLN02370		419	acyl-ACP thioesterase	100.0
PF01643		261	Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0	100.0
COG3884		250	FatA Acyl-ACP thioesterase [Lipid metabolism]	100.0
PRK10800		130	acyl-CoA thioesterase YbgC; Provisional	99.95
TIGR02799		126	thio_ybgC tol-pal system-associated acyl-CoA thioe	99.94
COG0824		137	FcbC Predicted thioesterase [General function pred	99.93
TIGR00051		117	acyl-CoA thioester hydrolase, YbgC/YbaW family. Th	99.93
PF13279		121	4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E	99.87
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	99.87
cd00586		110	4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat	99.77
COG0824		137	FcbC Predicted thioesterase [General function pred	99.67
PRK10800		130	acyl-CoA thioesterase YbgC; Provisional	99.64
TIGR00051		117	acyl-CoA thioester hydrolase, YbgC/YbaW family. Th	99.59
PF13279		121	4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E	99.57
TIGR02799		126	thio_ybgC tol-pal system-associated acyl-CoA thioe	99.57
cd03442		123	BFIT_BACH Brown fat-inducible thioesterase (BFIT).	99.36
cd00586		110	4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat	99.36
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	99.29
cd03440		100	hot_dog The hotdog fold was initially identified i	98.99
PF03061		79	4HBT: Thioesterase superfamily; InterPro: IPR00668	98.94
cd03443		113	PaaI_thioesterase PaaI_thioesterase is a tetrameri	98.71
PF01643		261	Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0	98.71
cd03442		123	BFIT_BACH Brown fat-inducible thioesterase (BFIT).	98.69
cd03440		100	hot_dog The hotdog fold was initially identified i	98.64
PF03061		79	4HBT: Thioesterase superfamily; InterPro: IPR00668	98.46
PLN02370		419	acyl-ACP thioesterase	98.44
PRK10694		133	acyl-CoA esterase; Provisional	98.29
PLN02647		437	acyl-CoA thioesterase	98.22
cd03443		113	PaaI_thioesterase PaaI_thioesterase is a tetrameri	98.11
COG3884		250	FatA Acyl-ACP thioesterase [Lipid metabolism]	98.04
COG1607		157	Acyl-CoA hydrolase [Lipid metabolism]	97.95
TIGR00369		117	unchar_dom_1 uncharacterized domain 1. Most protei	97.78
TIGR02286		114	PaaD phenylacetic acid degradation protein PaaD. S	97.71
PRK10293		136	acyl-CoA esterase; Provisional	97.27
PRK11688		154	hypothetical protein; Provisional	97.12
PRK10254		137	thioesterase; Provisional	97.09
COG5496		130	Predicted thioesterase [General function predictio	96.83
COG2050		141	PaaI HGG motif-containing thioesterase, possibly i	96.42
KOG3328		148	consensus HGG motif-containing thioesterase [Gener	96.35
cd03449		128	R_hydratase (R)-hydratase [(R)-specific enoyl-CoA	96.31
TIGR02286		114	PaaD phenylacetic acid degradation protein PaaD. S	96.06
PLN02322		154	acyl-CoA thioesterase	95.77
PF14539		132	DUF4442: Domain of unknown function (DUF4442); PDB	95.19
TIGR00369		117	unchar_dom_1 uncharacterized domain 1. Most protei	94.96
COG4109		432	Predicted transcriptional regulator containing CBS	94.89
cd00556		99	Thioesterase_II Thioesterase II (TEII) is thought	94.8
cd01288		131	FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier	94.8
PLN02647		437	acyl-CoA thioesterase	94.72
PF13622		255	4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A	94.68
cd03455		123	SAV4209 SAV4209 is a Streptomyces avermitilis prot	94.51
PRK13691		166	(3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro	94.41
PRK10694		133	acyl-CoA esterase; Provisional	94.35
cd00493		131	FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr	93.83
PLN02864		310	enoyl-CoA hydratase	93.46
cd03447		126	FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t	93.45
PRK13692		159	(3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro	93.38
cd03441		127	R_hydratase_like (R)-hydratase [(R)-specific enoyl	93.35
cd03454		140	YdeM YdeM is a Bacillus subtilis protein that belo	93.31
TIGR02447		138	yiiD_Cterm thioesterase domain, putative. This fam	93.21
cd03446		140	MaoC_like MoaC_like Similar to the MaoC (monoamine	92.93
cd03453		127	SAV4209_like SAV4209_like. Similar in sequence to	92.77
PRK00006		147	fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review	92.53
cd03451		146	FkbR2 FkbR2 is a Streptomyces hygroscopicus protei	92.23
PRK11688		154	hypothetical protein; Provisional	92.13
TIGR01750		140	fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd	92.07
PRK04424		185	fatty acid biosynthesis transcriptional regulator;	91.97
KOG4366		213	consensus Predicted thioesterase [General function	91.82
PF13452		132	MaoC_dehydrat_N: N-terminal half of MaoC dehydrata	90.16
cd03449		128	R_hydratase (R)-hydratase [(R)-specific enoyl-CoA	90.15
cd03452		142	MaoC_C MaoC_C The C-terminal hot dog fold of the M	89.79
PRK08190		466	bifunctional enoyl-CoA hydratase/phosphate acetylt	89.38
KOG4366		213	consensus Predicted thioesterase [General function	88.48
cd03445		94	Thioesterase_II_repeat2 Thioesterase II (TEII) is	88.35
cd03455		123	SAV4209 SAV4209 is a Streptomyces avermitilis prot	87.18
PRK10293		136	acyl-CoA esterase; Provisional	86.74
TIGR00189		271	tesB acyl-CoA thioesterase II. Subunit: homotetram	85.7
COG1607		157	Acyl-CoA hydrolase [Lipid metabolism]	85.15
KOG3328		148	consensus HGG motif-containing thioesterase [Gener	84.54
cd03453		127	SAV4209_like SAV4209_like. Similar in sequence to	83.79
cd03447		126	FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t	82.77
COG2050		141	PaaI HGG motif-containing thioesterase, possibly i	82.48
cd03441		127	R_hydratase_like (R)-hydratase [(R)-specific enoyl	82.43

>PLN02370 acyl-ACP thioesterase	Back alignment and domain information

Probab=100.00  E-value=1.9e-54  Score=433.28  Aligned_cols=284  Identities=46%  Similarity=0.840  Sum_probs=236.9

Q ss_pred             CCccccccccCCCCCCCccEEEEEEeeecCCCCCCCcCHHHHHHHHHHHHHHHHHHcCCCCCCccchhhhhhcCeEEEeE
Q 017534           65 PCSLADRLRLGTLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTA  144 (370)
Q Consensus        65 ~~~~~~~~~~~~~~~~~~~f~~~~~Vr~~D~D~~Ghv~~~~yl~~~qea~~~~~~~lG~~~~~~~~~~~l~~~gl~wVv~  144 (370)
                      ..-|.|.+++|++.+||+.|+++|+||+||||.+|++++..+++||||++..|++.+|+..++|+.+++|.+.|++|||+
T Consensus       121 ~~~~~~~~~~~~~~~~~~~y~~~f~Ir~yEvD~~g~lsl~~L~n~lQd~A~~Hs~~lGll~~Gfg~~~~m~~~gl~WVLt  200 (419)
T PLN02370        121 SDMLIDPFGIGRIVQDGLVFRQNFSIRSYEIGADRTASIETLMNHLQETALNHVKTAGLLGDGFGSTPEMSKRNLIWVVT  200 (419)
T ss_pred             CcccccccccCceeccCcEEEEEEEEeeEEECCCCCCCHHHHHHHHHHHHHHHHHHhCccccccccHHHHHhCCceEEEE
Confidence            36799999999999999999999999999999999999999999999999999999998444444445788999999999


Q ss_pred             eeeeeEccccCCCCEEEEEEEEEEeCCeEEEEEEEEEECCCCcEEEEEEEEEEEEeCCCCceecCCHHHHHHHhhcCccc
Q 017534          145 RMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRE  224 (370)
Q Consensus       145 r~~Iey~r~p~~gD~V~I~Twv~~~~r~~~~R~f~I~d~~~Gevla~a~s~wV~vD~~trRp~rip~e~~e~~~~~~~~~  224 (370)
                      +++|+|.|+|+|||+|+|+||+.+++++++.|+|+|+|.++|+++++|.++||+||++||||+|||+++++.+..+..+.
T Consensus       201 r~~I~~~R~P~~gD~V~V~Twv~~~~k~~~~Rdf~I~D~~~Ge~la~A~SvWV~mD~~TRRpvRIP~Evr~~i~~y~~~~  280 (419)
T PLN02370        201 RMQVLVDRYPTWGDVVQVDTWVSASGKNGMRRDWLVRDCKTGETLTRASSVWVMMNKLTRRLSKIPEEVRGEIEPYFLNS  280 (419)
T ss_pred             EEEEEeCcCCCCCCEEEEEEEEeeCCCCEEEEEEEEEECCCCeEEEEEEEEEEEEECCCCcccCCCHHHHHhhhhccccc
Confidence            99999999999999999999999999999999999999447999999999999999999999999999976654322111


Q ss_pred             ccccCCccCccccccCCCCCCc-ccceeeeeeeecccCcCCcccchhhHHHHHHHhCCcccccccceEEEEEEeccccCC
Q 017534          225 LRLAFPEENSSSSRKISKLEDP-AQYSRLGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQ  303 (370)
Q Consensus       225 ~~l~~p~e~~~~~~ki~~~~~~-~~~~~~~~~Vr~sDiD~ngHVNN~~Y~~w~~~~~~~~~~~~~~l~~~~i~Y~~e~~~  303 (370)
                       ...++    ...+|++++++. .++.+..++|||+|||.||||||++|++|++|++|.+++.++.+.+++|.|++||.+
T Consensus       281 -~~~i~----~~~~kl~~l~~~~~~~~~~~~~VRysDLD~NgHVNNvkYi~Wild~lP~e~l~~~~l~~i~I~Y~kE~~~  355 (419)
T PLN02370        281 -DPVVN----EDSRKLPKLDDKTADYIRKGLTPRWSDLDVNQHVNNVKYIGWILESAPPPIMESHELAAITLEYRRECGR  355 (419)
T ss_pred             -ccccc----cccccCCccccccccceeeeeeecHHHCcccCccccHHHHHHHHhhCchhhhhcceEEEEEEEEcccCCC
Confidence             00121    134667766543 123345699999999999999999999999999999999999999999999999999


Q ss_pred             CCEEEEEEEeeccCCCcccccccCCCCCCcccCCCCCceEEEEEEEECCCCcEEEEEEEEEEeccC
Q 017534          304 DDVVDSLTSAEPFEDAEPVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGDGSEINRGRSVWRKKPA  369 (370)
Q Consensus       304 gd~v~v~t~v~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~h~l~~~~dG~~ia~~~t~W~~~~~  369 (370)
                      ||.|.+.+.....+...     .+          .+....+.|.++ ..||+++++++|+|++|.+
T Consensus       356 gd~V~s~~~~~~~~~~~-----~~----------~~~~~~~~h~~~-~~dG~e~a~a~t~Wr~~~~  405 (419)
T PLN02370        356 DSVLQSLTAVSGTGIGN-----LG----------TAGDVECQHLLR-LEDGAEIVRGRTEWRPKHA  405 (419)
T ss_pred             CCEEEEEEeeccccccc-----cc----------CCCcceEEEEEE-cCCCeEEEEEEEEEEECCc
Confidence            99999987653211000     00          112245788775 6799999999999999853

>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid []	Back alignment and domain information

>COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism]	Back alignment and domain information

>PRK10800 acyl-CoA thioesterase YbgC; Provisional	Back alignment and domain information

>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase	Back alignment and domain information

>COG0824 FcbC Predicted thioesterase [General function prediction only]	Back alignment and domain information

>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family	Back alignment and domain information

>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT)	Back alignment and domain information

>COG0824 FcbC Predicted thioesterase [General function prediction only]	Back alignment and domain information

>PRK10800 acyl-CoA thioesterase YbgC; Provisional	Back alignment and domain information

>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family	Back alignment and domain information

>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A	Back alignment and domain information

>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase	Back alignment and domain information

>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT)	Back alignment and domain information

>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT)	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>cd03440 hot_dog The hotdog fold was initially identified in the E	Back alignment and domain information

>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases	Back alignment and domain information

>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria	Back alignment and domain information

>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid []	Back alignment and domain information

>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT)	Back alignment and domain information

>cd03440 hot_dog The hotdog fold was initially identified in the E	Back alignment and domain information

>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases	Back alignment and domain information

>PLN02370 acyl-ACP thioesterase	Back alignment and domain information

>PRK10694 acyl-CoA esterase; Provisional	Back alignment and domain information

>PLN02647 acyl-CoA thioesterase	Back alignment and domain information

>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria	Back alignment and domain information

>COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism]	Back alignment and domain information

>COG1607 Acyl-CoA hydrolase [Lipid metabolism]	Back alignment and domain information

>TIGR00369 unchar_dom_1 uncharacterized domain 1	Back alignment and domain information

>TIGR02286 PaaD phenylacetic acid degradation protein PaaD	Back alignment and domain information

>PRK10293 acyl-CoA esterase; Provisional	Back alignment and domain information

>PRK11688 hypothetical protein; Provisional	Back alignment and domain information

>PRK10254 thioesterase; Provisional	Back alignment and domain information

>COG5496 Predicted thioesterase [General function prediction only]	Back alignment and domain information

>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only]	Back alignment and domain information

>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway	Back alignment and domain information

>TIGR02286 PaaD phenylacetic acid degradation protein PaaD	Back alignment and domain information

>PLN02322 acyl-CoA thioesterase	Back alignment and domain information

>PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B	Back alignment and domain information

>TIGR00369 unchar_dom_1 uncharacterized domain 1	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively	Back alignment and domain information

>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway	Back alignment and domain information

>PLN02647 acyl-CoA thioesterase	Back alignment and domain information

>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B	Back alignment and domain information

>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit	Back alignment and domain information

>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional	Back alignment and domain information

>PRK10694 acyl-CoA esterase; Provisional	Back alignment and domain information

>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation	Back alignment and domain information

>PLN02864 enoyl-CoA hydratase	Back alignment and domain information

>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit	Back alignment and domain information

>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional	Back alignment and domain information

>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase]	Back alignment and domain information

>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function	Back alignment and domain information

>TIGR02447 yiiD_Cterm thioesterase domain, putative	Back alignment and domain information

>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain	Back alignment and domain information

>cd03453 SAV4209_like SAV4209_like	Back alignment and domain information

>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed	Back alignment and domain information

>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes	Back alignment and domain information

>PRK11688 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ	Back alignment and domain information

>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional	Back alignment and domain information

>KOG4366 consensus Predicted thioesterase [General function prediction only]	Back alignment and domain information

>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A	Back alignment and domain information

>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway	Back alignment and domain information

>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein	Back alignment and domain information

>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated	Back alignment and domain information

>KOG4366 consensus Predicted thioesterase [General function prediction only]	Back alignment and domain information

>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively	Back alignment and domain information

>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit	Back alignment and domain information

>PRK10293 acyl-CoA esterase; Provisional	Back alignment and domain information

>TIGR00189 tesB acyl-CoA thioesterase II	Back alignment and domain information

>COG1607 Acyl-CoA hydrolase [Lipid metabolism]	Back alignment and domain information

>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only]	Back alignment and domain information

>cd03453 SAV4209_like SAV4209_like	Back alignment and domain information

>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit	Back alignment and domain information

>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		370
4gak_A		250	Crystal Structure Of Acyl-Acp Thioesterase From Spi		1e-12
2own_A		262	Crystal Structure Of Oleoyl Thioesterase (Putative)		2e-12
2ess_A		248	Crystal Structure Of An Acyl-Acp Thioesterase (Np_8		4e-11

>pdb|4GAK|A Chain A, Crystal Structure Of Acyl-Acp Thioesterase From Spirosoma Linguale Length = 250

Back alignment and structure

Iteration: 1

Score = 70.9 bits (172), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 55/222 (24%), Positives = 96/222 (43%), Gaps = 18/222 (8%) Query: 86 EKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTAR 145 + F +R YE ++ + NL QE +A G A + + W R Sbjct: 10 DTFTLRGYECDAFGRXSIPALXNLXQESANRNAIDYGIGIADLA------QKGVGWXLXR 63 Query: 146 MHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYAT-GEVIGRATSKWVMMNQDTR 204 + I++YP + D +++ T+ + + RD + AT G ++ A S W++ + + R Sbjct: 64 FCLRIHQYPRYGDTIQLXTYPTTVDKYFIHRD--FRVLATDGTLLADARSTWLVFSXEKR 121 Query: 205 RLQKVSDDVREEYLVFCPRELRLAFPEENSSSSRKISKLEDPAQYS-RLGLIPRRADLDM 263 + D +R+ P P + + A S ++G + ++D Sbjct: 122 SXVPLPDFIRQ----LSPPANVDPLPALPLKPDFQTASFATAASKSVQVGWL----NIDQ 173 Query: 264 NQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQDD 305 NQHVNNV Y+ WLLE + +++ T E+ I L YR E D Sbjct: 174 NQHVNNVAYVQWLLEGVDSEIVQTREIAEIDLVYRTESHWHD 215

PyMOL of 4gak

>pdb|2OWN|A Chain A, Crystal Structure Of Oleoyl Thioesterase (Putative) (Np_784467.1) From Lactobacillus Plantarum At 2.00 A Resolution Length = 262

Back alignment and structure

>pdb|2ESS|A Chain A, Crystal Structure Of An Acyl-Acp Thioesterase (Np_810988.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.90 A Resolution Length = 248

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		370
2own_A		262	Putative oleoyl-[acyl-carrier protein] thioestera;	2e-72
2ess_A		248	Acyl-ACP thioesterase; NP_810988.1, structural gen	3e-68
2oiw_A		136	Putative 4-hydroxybenzoyl-COA thioesterase; struct	9e-07
2fuj_A		137	Conserved hypothetical protein; structural genomic	1e-05
3ck1_A		150	Putative thioesterase; structural genomics, joint	4e-05
2ali_A		158	Hypothetical protein PA2801; structural genomics,	8e-05
2oaf_A		151	Thioesterase superfamily; YP_508616.1, structural	1e-04
2o5u_A		148	Thioesterase; putative thioesterese,, hydrolase; 1	1e-04
2o5u_A		148	Thioesterase; putative thioesterese,, hydrolase; 1	9e-04
2nuj_A		163	Thioesterase superfamily; YP_509914.1, structural	2e-04
2nuj_A		163	Thioesterase superfamily; YP_509914.1, structural	5e-04
2hx5_A		152	Hypothetical protein; thioesterase/thiol ester deh	2e-04
2gf6_A		135	Conserved hypothetical protein; putative thioester	2e-04
2cye_A		133	TTHA1846, putative thioesterase; structural genomi	4e-04

>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Length = 262	Back alignment and structure

 Score =  225 bits (575), Expect = 2e-72
 Identities = 62/295 (21%), Positives = 113/295 (38%), Gaps = 38/295 (12%)

Query: 74  LGTLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTT 133
           + TL  +   Y E+  +  YE      AT+ T+ ++      + + ++G +T+       
Sbjct: 2   MATLGANASLYSEQHRITYYECDRTGRATLTTLIDIAVLASEDQSDALGLTTE------M 55

Query: 134 MRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRAT 193
           ++   + WV  +  I+I + P   +VV I     +       R++ ++D A G+ +   T
Sbjct: 56  VQSHGVGWVVTQYAIDITRMPRQDEVVTIAVRGSAYNPYFAYREFWIRD-ADGQQLAYIT 114

Query: 194 SKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLAFPEENSSSSRKISKLEDPAQYSRLG 253
           S WVMM+Q TRR+ K+  ++   Y              +      +    E         
Sbjct: 115 SIWVMMSQTTRRIVKILPELVAPYQSE---------VVKRIPRLPRPISFEATDTTITKP 165

Query: 254 LIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQDDVVDSLTSA 313
              R  D+D N+HVNN  Y  WL++++P   +  H+L  + + Y  E +    V +  + 
Sbjct: 166 YHVRFFDIDPNRHVNNAHYFDWLVDTLPATFLLQHDLVHVDVRYENEVKYGQTVTAHANI 225

Query: 314 EPFEDAEPVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGDGSEINRGRSVWRKKP 368
            P E                      D     HL+ +  D  +       WR  P
Sbjct: 226 LPSEV--------------------ADQVTTSHLIEV--DDEKCCEVTIQWRTLP 258

PyMOL of 2own

>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Length = 248	Back alignment and structure

>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Length = 136	Back alignment and structure

>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Length = 137	Back alignment and structure

>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Length = 150	Back alignment and structure

>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Length = 158	Back alignment and structure

>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Length = 151	Back alignment and structure

>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Length = 148	Back alignment and structure

>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Length = 148	Back alignment and structure

>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Length = 163	Back alignment and structure

>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Length = 163	Back alignment and structure

>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Length = 152	Back alignment and structure

>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Length = 135	Back alignment and structure

>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Length = 133	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		370
4gak_A		250	Acyl-ACP thioesterase; MCSG, PSI-biology, structur	100.0
2own_A		262	Putative oleoyl-[acyl-carrier protein] thioestera;	100.0
2ess_A		248	Acyl-ACP thioesterase; NP_810988.1, structural gen	100.0
4i4j_A		159	ACP-polyene thioesterase; structural genomics, PSI	99.94
3r87_A		135	Putative uncharacterized protein; unknown function	99.94
2gf6_A		135	Conserved hypothetical protein; putative thioester	99.94
1lo7_A		141	4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c	99.94
1s5u_A		138	Protein YBGC; structural genomics, hypothetical pr	99.93
3hm0_A		167	Probable thioesterase; niaid, ssgcid, decode, UW,	99.93
2w3x_A		147	CALE7; hydrolase, hotdog fold, thioesterase, enedi	99.93
2egj_A		128	Hypothetical protein AQ_1494; structural genomics;	99.93
2o5u_A		148	Thioesterase; putative thioesterese,, hydrolase; 1	99.93
3ck1_A		150	Putative thioesterase; structural genomics, joint	99.93
2nuj_A		163	Thioesterase superfamily; YP_509914.1, structural	99.93
2hlj_A		157	Hypothetical protein; putative thioesterase, struc	99.93
1z54_A		132	Probable thioesterase; hypothetical protein, struc	99.93
2xem_A		150	DYNE7, TEBC; biosynthetic protein, polyketide bios	99.93
2oaf_A		151	Thioesterase superfamily; YP_508616.1, structural	99.93
2hx5_A		152	Hypothetical protein; thioesterase/thiol ester deh	99.92
2oiw_A		136	Putative 4-hydroxybenzoyl-COA thioesterase; struct	99.92
2pzh_A		135	Hypothetical protein HP_0496; lipid, acyl-COA, bac	99.92
2fuj_A		137	Conserved hypothetical protein; structural genomic	99.92
2ali_A		158	Hypothetical protein PA2801; structural genomics,	99.92
1njk_A		156	Hypothetical protein YBAW; structural genomics, th	99.91
2cye_A		133	TTHA1846, putative thioesterase; structural genomi	99.89
2gvh_A		288	AGR_L_2016P; 15159470, acyl-COA hydrolase, structu	99.89
3b7k_A		333	Acyl-coenzyme A thioesterase 12; hotdog fold, stru	99.78
3r87_A		135	Putative uncharacterized protein; unknown function	99.68
2eis_A		133	Hypothetical protein TTHB207; COA binding motif, N	99.67
2fuj_A		137	Conserved hypothetical protein; structural genomic	99.67
2o5u_A		148	Thioesterase; putative thioesterese,, hydrolase; 1	99.65
2gf6_A		135	Conserved hypothetical protein; putative thioester	99.65
3bjk_A		153	Acyl-COA thioester hydrolase HI0827; hotdog fold,	99.64
4i4j_A		159	ACP-polyene thioesterase; structural genomics, PSI	99.64
2pzh_A		135	Hypothetical protein HP_0496; lipid, acyl-COA, bac	99.64
3hm0_A		167	Probable thioesterase; niaid, ssgcid, decode, UW,	99.63
1lo7_A		141	4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c	99.63
2w3x_A		147	CALE7; hydrolase, hotdog fold, thioesterase, enedi	99.62
1njk_A		156	Hypothetical protein YBAW; structural genomics, th	99.62
2xem_A		150	DYNE7, TEBC; biosynthetic protein, polyketide bios	99.61
2egj_A		128	Hypothetical protein AQ_1494; structural genomics;	99.61
2ali_A		158	Hypothetical protein PA2801; structural genomics,	99.61
2nuj_A		163	Thioesterase superfamily; YP_509914.1, structural	99.61
2oiw_A		136	Putative 4-hydroxybenzoyl-COA thioesterase; struct	99.61
2cye_A		133	TTHA1846, putative thioesterase; structural genomi	99.6
2hlj_A		157	Hypothetical protein; putative thioesterase, struc	99.59
3ck1_A		150	Putative thioesterase; structural genomics, joint	99.59
2oaf_A		151	Thioesterase superfamily; YP_508616.1, structural	99.58
1z54_A		132	Probable thioesterase; hypothetical protein, struc	99.58
1s5u_A		138	Protein YBGC; structural genomics, hypothetical pr	99.58
2hx5_A		152	Hypothetical protein; thioesterase/thiol ester deh	99.57
1vpm_A		169	Acyl-COA hydrolase; NP_241664.1, structural genomi	99.55
2v1o_A		151	Cytosolic acyl coenzyme A thioester hydrolase; acy	99.55
3d6l_A		137	Putative hydrolase; hot DOG fold, thioesterase, ac	99.54
2own_A		262	Putative oleoyl-[acyl-carrier protein] thioestera;	99.53
2ess_A		248	Acyl-ACP thioesterase; NP_810988.1, structural gen	99.48
4gak_A		250	Acyl-ACP thioesterase; MCSG, PSI-biology, structur	99.4
2gvh_A		288	AGR_L_2016P; 15159470, acyl-COA hydrolase, structu	99.36
2qq2_A		193	Cytosolic acyl coenzyme A thioester hydrolase; ACO	99.34
1y7u_A		174	Acyl-COA hydrolase; structural genomics, coenzyme	99.34
2q2b_A		179	Cytosolic acyl coenzyme A thioester hydrolase; ACO	99.32
2eis_A		133	Hypothetical protein TTHB207; COA binding motif, N	99.3
4ien_A		163	Putative acyl-COA hydrolase; hot DOG fold; HET: CO	99.19
1wlu_A		136	PAAI protein, phenylacetic acid degradation protei	99.14
1vpm_A		169	Acyl-COA hydrolase; NP_241664.1, structural genomi	99.06
2v1o_A		151	Cytosolic acyl coenzyme A thioester hydrolase; acy	99.04
3bjk_A		153	Acyl-COA thioester hydrolase HI0827; hotdog fold,	99.01
3d6l_A		137	Putative hydrolase; hot DOG fold, thioesterase, ac	98.93
1zki_A		133	Hypothetical protein PA5202; structural genomics,	98.88
3b7k_A		333	Acyl-coenzyme A thioesterase 12; hotdog fold, stru	98.78
1y7u_A		174	Acyl-COA hydrolase; structural genomics, coenzyme	98.75
2qq2_A		193	Cytosolic acyl coenzyme A thioester hydrolase; ACO	98.74
2q2b_A		179	Cytosolic acyl coenzyme A thioester hydrolase; ACO	98.74
4i82_A		137	Putative uncharacterized protein; PAAI/YDII-like,	98.68
2hbo_A		158	Hypothetical protein (NP_422103.1); thioesterase/t	98.6
2prx_A		160	Thioesterase superfamily protein; ZP_00837258.1, s	98.53
1wlu_A		136	PAAI protein, phenylacetic acid degradation protei	98.52
2pim_A		141	Phenylacetic acid degradation-related protein; thi	98.5
2fs2_A		151	Phenylacetic acid degradation protein PAAI; operon	98.5
2h4u_A		145	Thioesterase superfamily member 2; structural geno	98.48
1q4t_A		151	Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A	98.43
2cwz_A		141	Thioesterase family protein; structural genomics,	98.37
3nwz_A		176	BH2602 protein; structural genomics, PSI-biology,	98.36
1zki_A		133	Hypothetical protein PA5202; structural genomics,	98.36
3lbe_A		163	Putative uncharacterized protein SMU.793; hypothet	98.29
1o0i_A		138	Hypothetical protein HI1161; structural genomics,	98.29
2ov9_A		216	Hypothetical protein; rhodococcus SP. RHA1, RHA085	98.29
4ien_A		163	Putative acyl-COA hydrolase; hot DOG fold; HET: CO	98.27
3dkz_A		142	Thioesterase superfamily protein; Q7W9W5, borpa, P	98.24
3s4k_A		144	Putative esterase RV1847/MT1895; seattle structura	98.22
1vh5_A		148	Hypothetical protein YDII; PSI, protein structure	98.22
3f5o_A		148	Thioesterase superfamily member 2; hotdog fold, hy	98.21
3e1e_A		141	Thioesterase family protein; structural genomics,	98.2
4ae7_A		220	Thioesterase superfamily member 5; hydrolase, hotd	98.15
1vh9_A		149	P15, hypothetical protein YBDB; structural genomic	98.13
1sh8_A		154	Hypothetical protein PA5026; structural genomics,	98.07
2hbo_A		158	Hypothetical protein (NP_422103.1); thioesterase/t	98.07
2h4u_A		145	Thioesterase superfamily member 2; structural geno	97.97
4ae8_A		211	Thioesterase superfamily member 4; hydrolase, hotd	97.96
3e29_A		144	Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG,	97.96
2qwz_A		159	Phenylacetic acid degradation-related protein; put	97.93
3gek_A		146	Putative thioesterase YHDA; structure genomics, NE	97.9
1sc0_A		138	Hypothetical protein HI1161; structural genomics,	97.89
2prx_A		160	Thioesterase superfamily protein; ZP_00837258.1, s	97.8
2pim_A		141	Phenylacetic acid degradation-related protein; thi	97.73
2fs2_A		151	Phenylacetic acid degradation protein PAAI; operon	97.71
4i82_A		137	Putative uncharacterized protein; PAAI/YDII-like,	97.65
3f1t_A		148	Uncharacterized protein Q9I3C8_pseae; PAR319A, NES	97.54
3hdu_A		157	Putative thioesterase; structural genomics, joint	97.51
3e8p_A		164	Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG	97.39
1ixl_A		131	Hypothetical protein PH1136; alpha+beta, hot-DOG-f	97.33
1q4t_A		151	Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A	97.27
3f5o_A		148	Thioesterase superfamily member 2; hotdog fold, hy	97.07
2ov9_A		216	Hypothetical protein; rhodococcus SP. RHA1, RHA085	97.02
1yoc_A		147	Hypothetical protein PA1835; structural genomics,	97.0
3qoo_A		138	Uncharacterized protein; structural genomics, PSI-	96.94
3kuv_A		139	Fluoroacetyl coenzyme A thioesterase; fluoroacetyl	96.87
2qwz_A		159	Phenylacetic acid degradation-related protein; put	96.84
1vh9_A		149	P15, hypothetical protein YBDB; structural genomic	96.78
1vh5_A		148	Hypothetical protein YDII; PSI, protein structure	96.75
3lbe_A		163	Putative uncharacterized protein SMU.793; hypothet	96.74
3dkz_A		142	Thioesterase superfamily protein; Q7W9W5, borpa, P	96.68
2q78_A		153	Uncharacterized protein; structural genomics, join	96.6
3nwz_A		176	BH2602 protein; structural genomics, PSI-biology,	96.55
1sh8_A		154	Hypothetical protein PA5026; structural genomics,	96.45
3s4k_A		144	Putative esterase RV1847/MT1895; seattle structura	96.42
3e1e_A		141	Thioesterase family protein; structural genomics,	96.27
1t82_A		155	Hypothetical acetyltransferase; structural genomic	96.12
1o0i_A		138	Hypothetical protein HI1161; structural genomics,	96.02
4ae8_A		211	Thioesterase superfamily member 4; hydrolase, hotd	95.95
1ixl_A		131	Hypothetical protein PH1136; alpha+beta, hot-DOG-f	95.94
3e29_A		144	Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG,	95.84
4ae7_A		220	Thioesterase superfamily member 5; hydrolase, hotd	95.75
1iq6_A		134	(R)-hydratase, (R)-specific enoyl-COA hydratase; p	95.48
3bnv_A		152	CJ0977; virulence factor, hot-DOG fold, flagel unk	95.47
1q6w_A		161	Monoamine oxidase regulatory protein, putative; st	95.3
1pn2_A		280	Peroxisomal hydratase-dehydrogenase-epimerase; hot	95.13
3f1t_A		148	Uncharacterized protein Q9I3C8_pseae; PAR319A, NES	95.1
3lw3_A		145	HP0420 homologue; hotdog-fold, structural genomics	94.88
2cwz_A		141	Thioesterase family protein; structural genomics,	94.83
3gek_A		146	Putative thioesterase YHDA; structure genomics, NE	94.75
3khp_A		311	MAOC family protein; dehydrogenase, oxidoreductase	94.71
2b3n_A		159	Hypothetical protein AF1124; structural genomics,	94.37
3kh8_A		332	MAOC-like dehydratase; hot DOG domain, lyase; 2.00	94.32
3e8p_A		164	Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG	94.24
2f41_A		121	Transcription factor FAPR; 'HOT-DOG' fold, gene re	94.07
3exz_A		154	MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A	94.04
3ir3_A		148	HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc	93.93
4ffu_A		176	Oxidase; structural genomics, protein structure in	93.66
3hdu_A		157	Putative thioesterase; structural genomics, joint	93.61
3bbj_A		272	Putative thioesterase II; structural genomics, joi	93.39
4h4g_A		160	(3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY;	93.07
3lmb_A		165	Uncharacterized protein; protein OLEI01261, unknow	92.99
3oml_A		613	GH14720P, peroxisomal multifunctional enzyme type	92.84
3d6x_A		146	(3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY;	92.72
3k67_A		159	Putative dehydratase AF1124; hypothetical protein	92.4
1s9c_A		298	Peroxisomal multifunctional enzyme type 2; hot-DOG	92.33
2gll_A		171	FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d	92.28
1sc0_A		138	Hypothetical protein HI1161; structural genomics,	92.17
2f3x_A		157	Transcription factor FAPR; 'HOT-DOG' fold / malony	91.95
4a0z_A		190	Transcription factor FAPR; lipid homeostasis; HET:	90.95
1u1z_A		168	(3R)-hydroxymyristoyl-[acyl carrier protein] dehyd	90.78
2c2i_A		151	RV0130; hotdog, hydratase, lyase, structural prote	90.31
4i83_A		152	3-hydroxyacyl-[acyl-carrier-protein] dehydratase;	89.5
1iq6_A		134	(R)-hydratase, (R)-specific enoyl-COA hydratase; p	88.89
2cf2_C		342	Fatty acid synthase, DH domain; transferase, fatty	88.77
3cjy_A		259	Putative thioesterase; YP_496845.1, structural gen	87.99
4e3e_A		352	MAOC domain protein dehydratase; structural genomi	87.95
2f41_A		121	Transcription factor FAPR; 'HOT-DOG' fold, gene re	85.26
3u0a_A		285	Acyl-COA thioesterase II TESB2; structural genomic	85.16
1yoc_A		147	Hypothetical protein PA1835; structural genomics,	85.11
1c8u_A		285	Acyl-COA thioesterase II; internal repeats, hydrol	84.6
3bnv_A		152	CJ0977; virulence factor, hot-DOG fold, flagel unk	84.34
3ir3_A		148	HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc	84.21
1z6b_A		154	Pffabz, fatty acid synthesis protein; malaria, bet	84.02
1tbu_A		118	Peroxisomal acyl-coenzyme A thioester hydrolase 1;	83.61
3rqb_A		275	Uncharacterized protein; structural genomics, PSI-	82.84
1q6w_A		161	Monoamine oxidase regulatory protein, putative; st	81.12
2bi0_A		337	Hypothetical protein RV0216; conserved hypothetica	80.38
2b3n_A		159	Hypothetical protein AF1124; structural genomics,	80.32
2f3x_A		157	Transcription factor FAPR; 'HOT-DOG' fold / malony	80.13

>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale}	Back alignment and structure

Probab=100.00  E-value=1.8e-54  Score=408.09  Aligned_cols=247  Identities=23%  Similarity=0.399  Sum_probs=213.7

Q ss_pred             CCccEEEEEEeeecCCCCCCCcCHHHHHHHHHHHHHHHHHHcCCCCCCccchhhhhhcCeEEEeEeeeeeEccccCCCCE
Q 017534           80 DGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWSDV  159 (370)
Q Consensus        80 ~~~~f~~~~~Vr~~D~D~~Ghv~~~~yl~~~qea~~~~~~~lG~~~~~~~~~~~l~~~gl~wVv~r~~Iey~r~p~~gD~  159 (370)
                      .+++|+++|+||++|||++|||++++|++|||+|+.+|++++|++++      +|.+.|++|||++++|+|++||.+||.
T Consensus         4 M~~i~t~~f~Vr~~e~D~~g~v~~~~~l~~~q~a~~~~~~~~G~~~~------~l~~~g~~wVv~~~~i~~~r~~~~~d~   77 (250)
T 4gak_A            4 MAFIQTDTFTLRGYECDAFGRMSIPALMNLMQESANRNAIDYGIGIA------DLAQKGVGWMLMRFCLRIHQYPRYGDT   77 (250)
T ss_dssp             SCCCEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHHHTCSHH------HHHTTTEEEEEEEEEEEESSCCBTTCE
T ss_pred             CCceEEEEEEECHHHcCCCCcCCHHHHHHHHHHHHHHHHHHcCCCHH------HHHhcCceEEEEEEEEEEecCCCCCCE
Confidence            35678999999999999999999999999999999999999999876      688999999999999999999999999


Q ss_pred             EEEEEEEEEeCCeEEEEEEEEEECCCCcEEEEEEEEEEEEeCCCCceecCCHHHHHHHhhcCcccccccCCccCcccccc
Q 017534          160 VEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLVFCPRELRLAFPEENSSSSRK  239 (370)
Q Consensus       160 V~I~Twv~~~~r~~~~R~f~I~d~~~Gevla~a~s~wV~vD~~trRp~rip~e~~e~~~~~~~~~~~l~~p~e~~~~~~k  239 (370)
                      |+|+||+.+.+++++.|+|+|+| ++|+++++|.++||+||++||||+++|+++++.+....... ...+|.    ...+
T Consensus        78 v~V~T~~~~~~~~~~~r~~~i~d-~~g~~l~~a~s~wv~iD~~trrp~~ip~~~~~~~~~~~~~~-~~~~~~----~~~~  151 (250)
T 4gak_A           78 IQLMTYPTTVDKYFIHRDFRVLA-TDGTLLADARSTWLVFSMEKRSMVPLPDFIRQLSPPANVDP-LPALPL----KPDF  151 (250)
T ss_dssp             EEEEEEEEEECSSEEEEEEEEEE-TTCCEEEEEEEEEEEEETTTTEEECCCHHHHTCCCCTTCCC-CCCCCS----SCGG
T ss_pred             EEEEEEEEEcCCCEEEEEEEEEe-CCCCEEEEEEEEEEeeccccCCCcCCCHHHHhhcccccccc-cccccc----cchh
Confidence            99999999999999999999999 99999999999999999999999999999998765322110 001110    0111


Q ss_pred             CCCCCCcccceeeeeeeecccCcCCcccchhhHHHHHHHhCCcccccccceEEEEEEeccccCCCCEEEEEEEeeccCCC
Q 017534          240 ISKLEDPAQYSRLGLIPRRADLDMNQHVNNVTYIGWLLESMPQDVIDTHELQTITLDYRRECQQDDVVDSLTSAEPFEDA  319 (370)
Q Consensus       240 i~~~~~~~~~~~~~~~Vr~sDiD~ngHVNN~~Y~~w~~~~~~~~~~~~~~l~~~~i~Y~~e~~~gd~v~v~t~v~~~~~~  319 (370)
                      .+. +. ......+++|||+|||+||||||++|++|++|+++.+++..+.+.+++|+|++|+++||.|.+.++++..+  
T Consensus       152 ~~~-~~-~~~~~~~~~vr~~d~D~~gHvNN~~Y~~~~~e~~~~~~~~~~~~~~~~i~y~~e~~~gd~l~~~~~~~~~~--  227 (250)
T 4gak_A          152 QTA-SF-ATAASKSVQVGWLNIDQNQHVNNVAYVQWLLEGVDSEIVQTREIAEIDLVYRTESHWHDWLSVQSVTETDN--  227 (250)
T ss_dssp             GGC-CC-TTSCCEEEECCGGGBCTTSSBCHHHHHHHHHHTSCHHHHHHCCEEEEEEEECSCCCTTCEEEEEEEEEETT--
T ss_pred             ccc-cc-ccceeEEEEeCHHHcCccCcccHHHHHHHHHHHhhHHHHHhcCeeEEEEEEcccCCCCCEEEEEEEEecCC--
Confidence            111 11 11224679999999999999999999999999999999999999999999999999999999999887521  


Q ss_pred             cccccccCCCCCCcccCCCCCceEEEEEEEECCCCcEEEEEEEEEE
Q 017534          320 EPVSKLQGTNGSPAITGDKEDNHQFLHLLRLSGDGSEINRGRSVWR  365 (370)
Q Consensus       320 ~~~~~~~~~~g~~~~~~~~~~~~~~~h~l~~~~dG~~ia~~~t~W~  365 (370)
                                             .+.|.|...+||+++++|+|+||
T Consensus       228 -----------------------~~~~~i~~~~dg~~~~~a~t~Wr  250 (250)
T 4gak_A          228 -----------------------SVLHRISQTESGKDVLLARSRWR  250 (250)
T ss_dssp             -----------------------EEEEEEEETTTCCEEEEEEEEEC
T ss_pred             -----------------------eEEEEEEECCCCcEEEEEEEEEC
Confidence                                   46788888899999999999996

PyMOL of 4gak

>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8	Back alignment and structure

>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8	Back alignment and structure

>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus}	Back alignment and structure

>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum}	Back alignment and structure

>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1	Back alignment and structure

>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A*	Back alignment and structure

>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1	Back alignment and structure

>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae}	Back alignment and structure

>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora}	Back alignment and structure

>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A	Back alignment and structure

>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A	Back alignment and structure

>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha}	Back alignment and structure

>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1	Back alignment and structure

>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1	Back alignment and structure

>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1	Back alignment and structure

>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A	Back alignment and structure

>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1	Back alignment and structure

>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1	Back alignment and structure

>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1	Back alignment and structure

>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori}	Back alignment and structure

>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1	Back alignment and structure

>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A	Back alignment and structure

>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1	Back alignment and structure

>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1	Back alignment and structure

>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1	Back alignment and structure

>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens}	Back alignment and structure

>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum}	Back alignment and structure

>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus}	Back alignment and structure

>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1	Back alignment and structure

>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A	Back alignment and structure

>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1	Back alignment and structure

>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A*	Back alignment and structure

>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus}	Back alignment and structure

>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori}	Back alignment and structure

>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae}	Back alignment and structure

>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A*	Back alignment and structure

>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora}	Back alignment and structure

>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1	Back alignment and structure

>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A	Back alignment and structure

>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A	Back alignment and structure

>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A	Back alignment and structure

>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1	Back alignment and structure

>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1	Back alignment and structure

>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1	Back alignment and structure

>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1	Back alignment and structure

>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha}	Back alignment and structure

>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1	Back alignment and structure

>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1	Back alignment and structure

>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1	Back alignment and structure

>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1	Back alignment and structure

>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A	Back alignment and structure

>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus}	Back alignment and structure

>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni}	Back alignment and structure

>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8	Back alignment and structure

>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8	Back alignment and structure

>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale}	Back alignment and structure

>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1	Back alignment and structure

>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens}	Back alignment and structure

>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1	Back alignment and structure

>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus}	Back alignment and structure

>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus}	Back alignment and structure

>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis}	Back alignment and structure

>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A	Back alignment and structure

>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A	Back alignment and structure

>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus}	Back alignment and structure

>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A*	Back alignment and structure

>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni}	Back alignment and structure

>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5	Back alignment and structure

>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens}	Back alignment and structure

>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1	Back alignment and structure

>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens}	Back alignment and structure

>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus}	Back alignment and structure

>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae}	Back alignment and structure

>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5	Back alignment and structure

>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica}	Back alignment and structure

>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A	Back alignment and structure

>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134}	Back alignment and structure

>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A	Back alignment and structure

>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5	Back alignment and structure

>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A*	Back alignment and structure

>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7	Back alignment and structure

>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans}	Back alignment and structure

>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5	Back alignment and structure

>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A*	Back alignment and structure

>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A	Back alignment and structure

>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5	Back alignment and structure

>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis}	Back alignment and structure

>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis}	Back alignment and structure

>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0	Back alignment and structure

>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A	Back alignment and structure

>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A	Back alignment and structure

>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi}	Back alignment and structure

>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens}	Back alignment and structure

>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5	Back alignment and structure

>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5	Back alignment and structure

>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5	Back alignment and structure

>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5	Back alignment and structure

>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A*	Back alignment and structure

>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0	Back alignment and structure

>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP}	Back alignment and structure

>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp}	Back alignment and structure

>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A	Back alignment and structure

>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica}	Back alignment and structure

>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134}	Back alignment and structure

>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A	Back alignment and structure

>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae}	Back alignment and structure

>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa}	Back alignment and structure

>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB}	Back alignment and structure

>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis}	Back alignment and structure

>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5	Back alignment and structure

>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A*	Back alignment and structure

>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A	Back alignment and structure

>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5	Back alignment and structure

>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5	Back alignment and structure

>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans}	Back alignment and structure

>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A	Back alignment and structure

>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP}	Back alignment and structure

>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5	Back alignment and structure

>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A	Back alignment and structure

>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A*	Back alignment and structure

>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis}	Back alignment and structure

>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7	Back alignment and structure

>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans}	Back alignment and structure

>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5	Back alignment and structure

>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0	Back alignment and structure

>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi}	Back alignment and structure

>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5	Back alignment and structure

>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A	Back alignment and structure

>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A*	Back alignment and structure

>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5	Back alignment and structure

>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0	Back alignment and structure

>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens}	Back alignment and structure

>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4	Back alignment and structure

>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni}	Back alignment and structure

>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4	Back alignment and structure

>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A*	Back alignment and structure

>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa}	Back alignment and structure

>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A	Back alignment and structure

>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7	Back alignment and structure

>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp}	Back alignment and structure

>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV}	Back alignment and structure

>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A	Back alignment and structure

>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici}	Back alignment and structure

>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis}	Back alignment and structure

>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5	Back alignment and structure

>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum}	Back alignment and structure

>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens}	Back alignment and structure

>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti}	Back alignment and structure

>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB}	Back alignment and structure

>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca}	Back alignment and structure

>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis}	Back alignment and structure

>3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0	Back alignment and structure

>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster}	Back alignment and structure

>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp}	Back alignment and structure

>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A	Back alignment and structure

>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S	Back alignment and structure

>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A*	Back alignment and structure

>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A	Back alignment and structure

>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5	Back alignment and structure

>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A	Back alignment and structure

>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6	Back alignment and structure

>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4	Back alignment and structure

>4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis}	Back alignment and structure

>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4	Back alignment and structure

>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2	Back alignment and structure

>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans}	Back alignment and structure

>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus}	Back alignment and structure

>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5	Back alignment and structure

>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum}	Back alignment and structure

>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5	Back alignment and structure

>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3	Back alignment and structure

>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni}	Back alignment and structure

>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens}	Back alignment and structure

>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A	Back alignment and structure

>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3	Back alignment and structure

>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4	Back alignment and structure

>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4	Back alignment and structure

>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A	Back alignment and structure

>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		370
d2essa1		149	d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroi	1e-22
d2owna1		147	d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesteras	2e-19
d2essa2		98	d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacter	6e-12
d2owna2		109	d.38.1.8 (A:150-258) Putative oleoyl-ACP thioester	8e-12
d1njka_		133	d.38.1.1 (A:) Hypothetical protein YbaW {Escherich	2e-06
d2hx5a1		144	d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {P	2e-06
d2o5ua1		139	d.38.1.1 (A:5-143) Hypothetical thioesterase PA518	5e-06
d2oiwa1		131	d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus ste	1e-05
d2cyea1		132	d.38.1.1 (A:1-132) Probable thioesterase TTHA1846	5e-05
d2alia1		130	d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Ps	8e-05
d2nuja1		159	d.38.1.1 (A:3-161) Hypothetical protein Jann_1972	2e-04
d2oafa1		143	d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {	3e-04
d2hlja1		156	d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Ps	3e-04
d1lo7a_		140	d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {P	0.002
d2fuja1		118	d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {X	0.004

>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 149	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: Acyl-ACP thioesterase-like
domain: Acyl-ACP thioesterase
species: Bacteroides thetaiotaomicron [TaxId: 818]

 Score = 90.2 bits (223), Expect = 1e-22
 Identities = 35/148 (23%), Positives = 66/148 (44%), Gaps = 7/148 (4%)

Query: 77  LTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRK 136
           ++E+      +F+   + V  N   T+  + N L      HA   GF         T+ +
Sbjct: 1   MSEENKIGTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFHASDRGFGIA------TLNE 54

Query: 137 LHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKW 196
            +  WV +R+ IE+ + P   +   ++TW ++  R+ T R++ + D   G+ IG A S W
Sbjct: 55  DNYTWVLSRLAIELDEMPYQYEKFSVQTWVENVYRLFTDRNFAVIDK-DGKKIGYARSVW 113

Query: 197 VMMNQDTRRLQKVSDDVREEYLVFCPRE 224
            M+N +TR+   +        + +   E
Sbjct: 114 AMINLNTRKPADLLALHGGSIVDYICDE 141

PyMOL of d2essa1

>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Length = 147	Back information, alignment and structure

>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 98	Back information, alignment and structure

>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Length = 109	Back information, alignment and structure

>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Length = 133	Back information, alignment and structure

>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Length = 144	Back information, alignment and structure

>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Length = 139	Back information, alignment and structure

>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 131	Back information, alignment and structure

>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Length = 132	Back information, alignment and structure

>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130	Back information, alignment and structure

>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Length = 159	Back information, alignment and structure

>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Length = 143	Back information, alignment and structure

>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Length = 156	Back information, alignment and structure

>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Length = 140	Back information, alignment and structure

>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Length = 118	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		370
d2owna1		147	Putative oleoyl-ACP thioesterase LP0708 {Lactobaci	99.97
d2essa1		149	Acyl-ACP thioesterase {Bacteroides thetaiotaomicro	99.97
d1s5ua_		129	Hypothetical protein YbgC {Escherichia coli [TaxId	99.95
d1njka_		133	Hypothetical protein YbaW {Escherichia coli [TaxId	99.93
d2oiwa1		131	GK1870 orthologue {Bacillus stearothermophilus [Ta	99.93
d2hlja1		156	Hypothetical protein PP0301 {Pseudomonas putida [T	99.93
d2gf6a1		134	Hypothetical protein SSO2295 {Archaeon Sulfolobus	99.92
d2o5ua1		139	Hypothetical thioesterase PA5185 {Pseudomonas aeru	99.92
d2hx5a1		144	Hypothetical protein PMT2055 {Prochlorococcus mari	99.92
d2oafa1		143	Hypothetical protein Jann0674 {Jannaschia sp. ccs1	99.92
d2nuja1		159	Hypothetical protein Jann_1972 {Jannaschia sp. CCS	99.92
d2alia1		130	Hypothetical protein PA2801 {Pseudomonas aeruginos	99.92
d1z54a1		132	Probable thioesterase TTHA0908 {Thermus thermophil	99.91
d1lo7a_		140	4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp.	99.91
d2cyea1		132	Probable thioesterase TTHA1846 {Thermus thermophil	99.9
d2owna2		109	Putative oleoyl-ACP thioesterase LP0708 {Lactobaci	99.9
d2fuja1		118	Hypothetical protein XCC1147 {Xanthomonas campestr	99.86
d2essa2		98	Acyl-ACP thioesterase {Bacteroides thetaiotaomicro	99.86
d2fuja1		118	Hypothetical protein XCC1147 {Xanthomonas campestr	99.73
d1njka_		133	Hypothetical protein YbaW {Escherichia coli [TaxId	99.7
d2o5ua1		139	Hypothetical thioesterase PA5185 {Pseudomonas aeru	99.7
d2oiwa1		131	GK1870 orthologue {Bacillus stearothermophilus [Ta	99.68
d2owna2		109	Putative oleoyl-ACP thioesterase LP0708 {Lactobaci	99.68
d1s5ua_		129	Hypothetical protein YbgC {Escherichia coli [TaxId	99.68
d2cyea1		132	Probable thioesterase TTHA1846 {Thermus thermophil	99.65
d2alia1		130	Hypothetical protein PA2801 {Pseudomonas aeruginos	99.65
d2nuja1		159	Hypothetical protein Jann_1972 {Jannaschia sp. CCS	99.63
d1z54a1		132	Probable thioesterase TTHA0908 {Thermus thermophil	99.62
d2hx5a1		144	Hypothetical protein PMT2055 {Prochlorococcus mari	99.62
d2hlja1		156	Hypothetical protein PP0301 {Pseudomonas putida [T	99.61
d2oafa1		143	Hypothetical protein Jann0674 {Jannaschia sp. ccs1	99.6
d2gf6a1		134	Hypothetical protein SSO2295 {Archaeon Sulfolobus	99.57
d2owna1		147	Putative oleoyl-ACP thioesterase LP0708 {Lactobaci	99.57
d1lo7a_		140	4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp.	99.56
d2essa1		149	Acyl-ACP thioesterase {Bacteroides thetaiotaomicro	99.49
d2essa2		98	Acyl-ACP thioesterase {Bacteroides thetaiotaomicro	99.48
d1ylia1		142	Putative acyl-coa thioester hydrolase HI0827 {Haem	98.65
d2gvha2		116	Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter	98.37
d1vpma_		155	Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta	98.27
d1y7ua1		164	Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId:	98.17
d2hboa1		142	Hypothetical protein CC3309 {Caulobacter crescentu	98.13
d2gvha1		135	Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter	98.06
d2f0xa1		136	Hypothetical protein Them2 {Human (Homo sapiens) [	98.05
d1sc0a_		137	Hypothetical protein HI1161 {Haemophilus influenza	98.0
d1vh5a_		138	Hypothetical protein YdiI {Escherichia coli [TaxId	97.96
d1zkia1		126	Hypothetical protein PA5202 {Pseudomonas aeruginos	97.95
d2ov9a1		203	Hypothetical protein RHA1_ro05818 {Rhodococcus sp.	97.92
d1wlua1		116	Phenylacetic acid degradation protein PaaI {Thermu	97.9
d2fs2a1		131	Phenylacetic acid degradation protein PaaI {Escher	97.89
d1q4ua_		140	4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp	97.87
d2cwza1		138	Hypothetical protein TTHA0967 {Thermus thermophilu	97.74
d1ixla_		130	Hypothetical protein PH1136 {Archaeon Pyrococcus h	97.74
d1vh9a_		138	Hypothetical protein YbdB {Escherichia coli [TaxId	97.7
d2q78a1		130	Uncharacterized protein TM0581 {Thermotoga maritim	97.09
d2f0xa1		136	Hypothetical protein Them2 {Human (Homo sapiens) [	96.64
d2f41a1		111	Transcription factor FapR, C-terminal domain {Baci	96.54
d1ylia1		142	Putative acyl-coa thioester hydrolase HI0827 {Haem	96.43
d1wlua1		116	Phenylacetic acid degradation protein PaaI {Thermu	96.14
d2ov9a1		203	Hypothetical protein RHA1_ro05818 {Rhodococcus sp.	95.99
d2fs2a1		131	Phenylacetic acid degradation protein PaaI {Escher	95.2
d1sh8a_		153	Hypothetical protein PA5026 {Pseudomonas aeruginos	95.1
d2hboa1		142	Hypothetical protein CC3309 {Caulobacter crescentu	95.04
d1ixla_		130	Hypothetical protein PH1136 {Archaeon Pyrococcus h	94.62
d1yoca1		145	Hypothetical protein PA1835 {Pseudomonas aeruginos	94.43
d1iq6a_		132	(R)-specific enoyl-CoA hydratase {Aeromonas caviae	94.37
d1u1za_		145	(3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo	94.36
d1t82a_		143	Putative thioesterase SO4397 {Shewanella oneidensi	94.03
d1q4ua_		140	4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp	93.98
d1vh5a_		138	Hypothetical protein YdiI {Escherichia coli [TaxId	93.87
d2gvha2		116	Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter	93.73
d1zkia1		126	Hypothetical protein PA5202 {Pseudomonas aeruginos	93.7
d2gvha1		135	Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter	93.32
d1vh9a_		138	Hypothetical protein YbdB {Escherichia coli [TaxId	92.8
d1sc0a_		137	Hypothetical protein HI1161 {Haemophilus influenza	92.69
d2f41a1		111	Transcription factor FapR, C-terminal domain {Baci	92.66
d2bi0a1		178	Hypothetical protein Rv0216/MT0226 {Mycobacterium	92.45
d2cwza1		138	Hypothetical protein TTHA0967 {Thermus thermophilu	91.77
d1q6wa_		151	Monoamine oxidase regulatory protein {Archaeon Arc	91.49
d2b3na1		154	Hypothetical protein AF1124 {Archaeon Archaeoglobu	91.33
d1y7ua1		164	Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId:	91.04
d1s9ca2		154	2-enoyl-coa hydratase domain of multifunctional pe	90.82
d1pn2a1		148	2-enoyl-coa hydratase domain of multifunctional pe	90.8
d1vpma_		155	Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta	90.8
d1iq6a_		132	(R)-specific enoyl-CoA hydratase {Aeromonas caviae	89.93
d1tbua1		104	Peroxisomal long-chain acyl-CoA thioesterase 1, TE	88.4
d1yoca1		145	Hypothetical protein PA1835 {Pseudomonas aeruginos	86.2
d1z6ba1		146	(3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria	85.77
d2bi0a1		178	Hypothetical protein Rv0216/MT0226 {Mycobacterium	83.46
d1s9ca2		154	2-enoyl-coa hydratase domain of multifunctional pe	83.26
d1q6wa_		151	Monoamine oxidase regulatory protein {Archaeon Arc	80.89

>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: Acyl-ACP thioesterase-like
domain: Putative oleoyl-ACP thioesterase LP0708
species: Lactobacillus plantarum [TaxId: 1590]

Probab=99.97  E-value=1.8e-30  Score=221.94  Aligned_cols=137  Identities=26%  Similarity=0.426  Sum_probs=130.8

Q ss_pred             CCCCCCccEEEEEEeeecCCCCCCCcCHHHHHHHHHHHHHHHHHHcCCCCCCccchhhhhhcCeEEEeEeeeeeEccccC
Q 017534           76 TLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPA  155 (370)
Q Consensus        76 ~~~~~~~~f~~~~~Vr~~D~D~~Ghv~~~~yl~~~qea~~~~~~~lG~~~~~~~~~~~l~~~gl~wVv~r~~Iey~r~p~  155 (370)
                      +|+.++.+|+++++|||+|||.+|||+++.|++|||+|+..+++++|++.+      .+.+.|++||+++++|+|++|+.
T Consensus         1 ~~~~~~~~f~~~~~Vr~~d~D~~g~v~~~~y~~~~~~a~~~~~~~~g~~~~------~~~~~~~~~vv~~~~i~y~~~~~   74 (147)
T d2owna1           1 TLGANASLYSEQHRITYYECDRTGRATLTTLIDIAVLASEDQSDALGLTTE------MVQSHGVGWVVTQYAIDITRMPR   74 (147)
T ss_dssp             CTTTTSCCEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHHTTCCHH------HHHTTTEEEEEEEEEEEESSCCB
T ss_pred             CCCCCCCeEEEEEEECHHHcCCCCcCCHHHHHHHHHHHHHHHHHHhcccch------hhhcccceeEEEEEEeeEecccc
Confidence            577889999999999999999999999999999999999999999999876      57889999999999999999999


Q ss_pred             CCCEEEEEEEEEEeCCeEEEEEEEEEECCCCcEEEEEEEEEEEEeCCCCceecCCHHHHHHHhh
Q 017534          156 WSDVVEIETWCQSEGRIGTRRDWILKDYATGEVIGRATSKWVMMNQDTRRLQKVSDDVREEYLV  219 (370)
Q Consensus       156 ~gD~V~I~Twv~~~~r~~~~R~f~I~d~~~Gevla~a~s~wV~vD~~trRp~rip~e~~e~~~~  219 (370)
                      +||+|+|+||+.+.++.++.++|+|++ ++|+++++|.++||+||+++|||+++|+++++.|..
T Consensus        75 ~~d~l~V~t~~~~~~~~~~~~~~~i~~-~~g~~~a~~~~~~v~id~~~rr~~~ip~~~~~~~~~  137 (147)
T d2owna1          75 QDEVVTIAVRGSAYNPYFAYREFWIRD-ADGQQLAYITSIWVMMSQTTRRIVKILPELVAPYQS  137 (147)
T ss_dssp             TTCEEEEEEEEEEECSSCEEEEEEEEC-TTCCEEEEEEEEEEEEETTTCSEECCCGGGTGGGTC
T ss_pred             cCCEEEEEEEEeecCCcEEEEEEEEEe-CCCCEEEEEEEEEEEEECCCCcCcCCCHHHHHHHhc
Confidence            999999999999999999999999999 899999999999999999999999999999988753

PyMOL of d2owna1

>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]}	Back information, alignment and structure

>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]}	Back information, alignment and structure

>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]}	Back information, alignment and structure

>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]}	Back information, alignment and structure

>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]}	Back information, alignment and structure

>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]}	Back information, alignment and structure

>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]}	Back information, alignment and structure

>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]}	Back information, alignment and structure

>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]}	Back information, alignment and structure

>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]}	Back information, alignment and structure

>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]}	Back information, alignment and structure

>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]}	Back information, alignment and structure

>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]}	Back information, alignment and structure

>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]}	Back information, alignment and structure

>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]}	Back information, alignment and structure

>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]}	Back information, alignment and structure

>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}	Back information, alignment and structure

>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]}	Back information, alignment and structure

>d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure