Citrus Sinensis ID: 017581

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLG
ccccccccccccccccccEEEEEEEEEEccEEEEEEcccccEEEEEEEcccEEEEEEEEEEccEEEEEEccccccccccccEEEccccEEEEEcccccccccccccccHHHHHHHHccccccccccccccccccccEEEEcccccccccccccEEEEEEccccccEEEEcccccccEEEEEEccccEEcccEEEEEEEccccEEEccEEcccccccccccccccccccEEEccEEEccccccccccEEEEEccccccHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHcccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHccc
ccccccccccccccHHHHccccEEEEEcccEEEEcccccccEEEEEEEcccccEEEEEEEcccEEEEEEEEccccccccccEEccccccEEEccccHHHHHHccccccHHHHHHHccccEEccccEcccccccccEEEccccEEcccEEccccEEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEEEEEEEEcccEEEEEEEEEcccccccccHHccccccccccHHHHHHHHccccccccEEccccccccHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHcccEEEEEccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccc
mpsvygarlttfedeekeseygyvrkvsgpvviadgmnGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAglmvndpvlrthkplsvelgpgilgnifdgiqrpLKTIAIrsgdvyiprgvsvpaldkdtlwefqpkkigegdlltggdLYATVFENSLMqhhvalppdamgkvtyvapagqyslkDTVLELEFQGVKKSFTMLqawpvrtprpvssklaadtplltgqRVLDalfpsvlggtcaipgafgcgKTVISQAlskysnsdtvvyVGCGERGNEMAEVLMdfpqltmtlpdgreesvMKRTTLVantsnmpvaaREASIYTGITIAEYFRdmgynvsmmADSTSRWAEALREISGRLG
mpsvygarlttfedeekeseygyvrkvsgPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQAlskysnsdTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTlvantsnmpvaarEASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLG
MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLG
********************YGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMT*************TLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMA******************
*********************GYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLT**********VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGR**
MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLG
***************E**SEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query369 2.2.26 [Sep-21-2011]
Q9SM09 623 V-type proton ATPase cata N/A no 1.0 0.592 0.997 0.0
P09469 623 V-type proton ATPase cata N/A no 1.0 0.592 0.972 0.0
P31405 623 V-type proton ATPase cata N/A no 1.0 0.592 0.953 0.0
P13548 623 V-type proton ATPase cata N/A no 1.0 0.592 0.948 0.0
Q39291 623 V-type proton ATPase cata N/A no 1.0 0.592 0.943 0.0
O23654 623 V-type proton ATPase cata yes no 1.0 0.592 0.924 0.0
Q39442 623 V-type proton ATPase cata N/A no 1.0 0.592 0.915 0.0
Q40002 580 V-type proton ATPase cata N/A no 0.883 0.562 0.917 1e-178
P49087 561 V-type proton ATPase cata N/A no 0.826 0.543 0.921 1e-168
Q38677 613 V-type proton ATPase cata N/A no 0.953 0.574 0.761 1e-160
>sp|Q9SM09|VATA_CITUN V-type proton ATPase catalytic subunit A OS=Citrus unshiu PE=2 SV=1 Back     alignment and function desciption
 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/369 (99%), Positives = 368/369 (99%)

Query: 1   MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRL 60
           MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRL
Sbjct: 1   MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRL 60

Query: 61  EGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVY 120
           EGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVY
Sbjct: 61  EGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVY 120

Query: 121 IPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTY 180
           IPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTY
Sbjct: 121 IPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTY 180

Query: 181 VAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALF 240
           VAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALF
Sbjct: 181 VAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALF 240

Query: 241 PSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTL 300
           PSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTL
Sbjct: 241 PSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTL 300

Query: 301 PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA 360
           PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA
Sbjct: 301 PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA 360

Query: 361 LREISGRLG 369
           LREISGRL 
Sbjct: 361 LREISGRLA 369
Catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Citrus unshiu (taxid: 55188)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 1EC: 4
>sp|P09469|VATA_DAUCA V-type proton ATPase catalytic subunit A OS=Daucus carota PE=2 SV=1 Back     alignment and function description
>sp|P31405|VATA_GOSHI V-type proton ATPase catalytic subunit A OS=Gossypium hirsutum GN=CVA69.24 PE=2 SV=1 Back     alignment and function description
>sp|P13548|VATA_VIGRR V-type proton ATPase catalytic subunit A OS=Vigna radiata var. radiata PE=1 SV=3 Back     alignment and function description
>sp|Q39291|VATA_BRANA V-type proton ATPase catalytic subunit A OS=Brassica napus PE=2 SV=1 Back     alignment and function description
>sp|O23654|VATA_ARATH V-type proton ATPase catalytic subunit A OS=Arabidopsis thaliana GN=VHA-A PE=1 SV=1 Back     alignment and function description
>sp|Q39442|VATA_BETVU V-type proton ATPase catalytic subunit A OS=Beta vulgaris PE=2 SV=1 Back     alignment and function description
>sp|Q40002|VATA_HORVU V-type proton ATPase catalytic subunit A (Fragment) OS=Hordeum vulgare PE=2 SV=1 Back     alignment and function description
>sp|P49087|VATA_MAIZE V-type proton ATPase catalytic subunit A (Fragment) OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q38677|VATA2_ACEAT V-type proton ATPase catalytic subunit A isoform 2 OS=Acetabularia acetabulum PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query369
12585490 623 RecName: Full=V-type proton ATPase catal 1.0 0.592 0.997 0.0
137460 623 RecName: Full=V-type proton ATPase catal 1.0 0.592 0.972 0.0
3169287 623 vacuolar H+-ATPase catalytic subunit [Go 1.0 0.592 0.959 0.0
401322 623 RecName: Full=V-type proton ATPase catal 1.0 0.592 0.953 0.0
363806992 623 V-type proton ATPase catalytic subunit A 1.0 0.592 0.953 0.0
356521645 623 PREDICTED: V-type proton ATPase catalyti 1.0 0.592 0.953 0.0
225443399 623 PREDICTED: V-type proton ATPase catalyti 1.0 0.592 0.959 0.0
147791359 659 hypothetical protein VITISV_008123 [Viti 1.0 0.559 0.953 0.0
224109966 623 predicted protein [Populus trichocarpa] 1.0 0.592 0.953 0.0
225429795 623 PREDICTED: V-type proton ATPase catalyti 1.0 0.592 0.953 0.0
>gi|12585490|sp|Q9SM09.1|VATA_CITUN RecName: Full=V-type proton ATPase catalytic subunit A; Short=V-ATPase subunit A; AltName: Full=V-ATPase 69 kDa subunit; AltName: Full=Vacuolar proton pump subunit alpha gi|6518112|dbj|BAA87891.1| H+-ATPase catalytic subunit [Citrus unshiu] Back     alignment and taxonomy information
 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/369 (99%), Positives = 368/369 (99%)

Query: 1   MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRL 60
           MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRL
Sbjct: 1   MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRL 60

Query: 61  EGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVY 120
           EGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVY
Sbjct: 61  EGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVY 120

Query: 121 IPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTY 180
           IPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTY
Sbjct: 121 IPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTY 180

Query: 181 VAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALF 240
           VAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALF
Sbjct: 181 VAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALF 240

Query: 241 PSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTL 300
           PSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTL
Sbjct: 241 PSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTL 300

Query: 301 PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA 360
           PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA
Sbjct: 301 PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA 360

Query: 361 LREISGRLG 369
           LREISGRL 
Sbjct: 361 LREISGRLA 369

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|137460|sp|P09469.1|VATA_DAUCA RecName: Full=V-type proton ATPase catalytic subunit A; Short=V-ATPase subunit A; AltName: Full=V-ATPase 69 kDa subunit; AltName: Full=Vacuolar proton pump subunit alpha gi|167560|gb|AAA33139.1| 70kD vacuolar H+-ATPase [Daucus carota] Back     alignment and taxonomy information
>gi|3169287|gb|AAC17840.1| vacuolar H+-ATPase catalytic subunit [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|401322|sp|P31405.1|VATA_GOSHI RecName: Full=V-type proton ATPase catalytic subunit A; Short=V-ATPase subunit A; AltName: Full=V-ATPase 69 kDa subunit; AltName: Full=Vacuolar proton pump subunit alpha gi|167313|gb|AAA33050.1| vacuolar H+-ATPase catalytic subunit [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|363806992|ref|NP_001242061.1| V-type proton ATPase catalytic subunit A-like [Glycine max] gi|156616913|gb|ABU87506.1| V-H(+)-ATPase subunit A [Glycine max] Back     alignment and taxonomy information
>gi|356521645|ref|XP_003529464.1| PREDICTED: V-type proton ATPase catalytic subunit A-like [Glycine max] Back     alignment and taxonomy information
>gi|225443399|ref|XP_002267279.1| PREDICTED: V-type proton ATPase catalytic subunit A [Vitis vinifera] gi|297735751|emb|CBI18438.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147791359|emb|CAN66161.1| hypothetical protein VITISV_008123 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224109966|ref|XP_002315371.1| predicted protein [Populus trichocarpa] gi|222864411|gb|EEF01542.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225429795|ref|XP_002280695.1| PREDICTED: V-type proton ATPase catalytic subunit A [Vitis vinifera] gi|296081771|emb|CBI20776.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query369
TAIR|locus:2037493 623 VHA-A "vacuolar ATP synthase s 0.997 0.590 0.926 1.2e-182
ZFIN|ZDB-GENE-030131-9529 617 atp6v1ab "ATPase, H+ transport 0.978 0.585 0.721 5.6e-139
ZFIN|ZDB-GENE-040426-1143 617 atp6v1aa "ATPase, H+ transport 0.978 0.585 0.716 7.4e-137
UNIPROTKB|P38606 617 ATP6V1A "V-type proton ATPase 0.978 0.585 0.716 2.5e-136
UNIPROTKB|F1SP93 618 ATP6V1A "V-type proton ATPase 0.978 0.584 0.716 2.5e-136
UNIPROTKB|Q5R5H2 617 ATP6V1A "V-type proton ATPase 0.978 0.585 0.716 2.5e-136
MGI|MGI:1201780 617 Atp6v1a "ATPase, H+ transporti 0.978 0.585 0.716 2.5e-136
UNIPROTKB|P31404 617 ATP6V1A "V-type proton ATPase 0.978 0.585 0.710 4.1e-136
RGD|1596464 617 Atp6v1a "ATPase, H+ transporti 0.978 0.585 0.713 5.2e-136
UNIPROTKB|E2QYG6 618 ATP6V1A "Uncharacterized prote 0.978 0.584 0.710 8.5e-136
TAIR|locus:2037493 VHA-A "vacuolar ATP synthase subunit A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1772 (628.8 bits), Expect = 1.2e-182, P = 1.2e-182
 Identities = 341/368 (92%), Positives = 354/368 (96%)

Query:     1 MPSVYGARLTTFEDEEKESEYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRL 60
             MP+ YG +LTTFED+EKESEYGYVRKVSGPVV+ADGM GAAMYELVRVGHDNLIGEIIRL
Sbjct:     1 MPAFYGGKLTTFEDDEKESEYGYVRKVSGPVVVADGMAGAAMYELVRVGHDNLIGEIIRL 60

Query:    61 EGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVY 120
             EGDSATIQVYEETAGL VNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIA  SGDVY
Sbjct:    61 EGDSATIQVYEETAGLTVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIARISGDVY 120

Query:   121 IPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTY 180
             IPRGVSVPALDKD LWEFQP K  EGD +TGGDLYATVFEN+LM H VALPPDAMGK+TY
Sbjct:   121 IPRGVSVPALDKDCLWEFQPNKFVEGDTITGGDLYATVFENTLMNHLVALPPDAMGKITY 180

Query:   181 VAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALF 240
             +APAGQYSLKDTV+ELEFQG+KKS+TMLQ+WPVRTPRPV+SKLAADTPLLTGQRVLDALF
Sbjct:   181 IAPAGQYSLKDTVIELEFQGIKKSYTMLQSWPVRTPRPVASKLAADTPLLTGQRVLDALF 240

Query:   241 PSVLGGTCAIPGAFGCGKTVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTL 300
             PSVLGGTCAIPGAFGCGKTVISQALSKYSNSD VVYVGCGERGNEMAEVLMDFPQLTMTL
Sbjct:   241 PSVLGGTCAIPGAFGCGKTVISQALSKYSNSDAVVYVGCGERGNEMAEVLMDFPQLTMTL 300

Query:   301 PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA 360
             PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA
Sbjct:   301 PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEA 360

Query:   361 LREISGRL 368
             LREISGRL
Sbjct:   361 LREISGRL 368
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0015991 "ATP hydrolysis coupled proton transport" evidence=IEA
GO:0015992 "proton transport" evidence=IEA;ISS
GO:0016820 "hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances" evidence=IEA
GO:0046034 "ATP metabolic process" evidence=IEA
GO:0046933 "proton-transporting ATP synthase activity, rotational mechanism" evidence=IEA;ISS
GO:0046961 "proton-transporting ATPase activity, rotational mechanism" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0007030 "Golgi organization" evidence=RCA;IMP
GO:0009555 "pollen development" evidence=IMP
GO:0005618 "cell wall" evidence=IDA
GO:0000325 "plant-type vacuole" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0002020 "protease binding" evidence=IPI
GO:0005829 "cytosol" evidence=RCA
GO:0009506 "plasmodesma" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0000902 "cell morphogenesis" evidence=RCA
GO:0006007 "glucose catabolic process" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006816 "calcium ion transport" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0007033 "vacuole organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
ZFIN|ZDB-GENE-030131-9529 atp6v1ab "ATPase, H+ transporting, lysosomal V1 subunit Ab" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1143 atp6v1aa "ATPase, H+ transporting, lysosomal V1 subunit Aa" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P38606 ATP6V1A "V-type proton ATPase catalytic subunit A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SP93 ATP6V1A "V-type proton ATPase catalytic subunit A" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R5H2 ATP6V1A "V-type proton ATPase catalytic subunit A" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1201780 Atp6v1a "ATPase, H+ transporting, lysosomal V1 subunit A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P31404 ATP6V1A "V-type proton ATPase catalytic subunit A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1596464 Atp6v1a "ATPase, H+ transporting, lysosomal V1 subunit A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYG6 ATP6V1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SM09VATA_CITUN3, ., 6, ., 3, ., 1, 40.99721.00.5922N/Ano
P31404VATA_BOVIN3, ., 6, ., 3, ., 1, 40.70870.98100.5867yesno
P31405VATA_GOSHI3, ., 6, ., 3, ., 1, 40.95391.00.5922N/Ano
O23654VATA_ARATH3, ., 6, ., 3, ., 1, 40.92411.00.5922yesno
P49087VATA_MAIZE3, ., 6, ., 3, ., 1, 40.92130.82650.5436N/Ano
P13548VATA_VIGRR3, ., 6, ., 3, ., 1, 40.94851.00.5922N/Ano
Q90647VATA_CHICK3, ., 6, ., 3, ., 1, 40.70600.98100.5867yesno
Q29048VATA_PIG3, ., 6, ., 3, ., 1, 40.70870.98100.5867yesno
P50516VATA_MOUSE3, ., 6, ., 3, ., 1, 40.71420.98100.5867yesno
Q39442VATA_BETVU3, ., 6, ., 3, ., 1, 40.91591.00.5922N/Ano
Q9XW92VATA_CAEEL3, ., 6, ., 3, ., 1, 40.71380.95120.5792yesno
Q39291VATA_BRANA3, ., 6, ., 3, ., 1, 40.94301.00.5922N/Ano
P38606VATA_HUMAN3, ., 6, ., 3, ., 1, 40.71420.98100.5867yesno
Q5R5H2VATA_PONAB3, ., 6, ., 3, ., 1, 40.71420.98100.5867yesno
Q40002VATA_HORVU3, ., 6, ., 3, ., 1, 40.91710.88340.5620N/Ano
P09469VATA_DAUCA3, ., 6, ., 3, ., 1, 40.97281.00.5922N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.3.140.946
3rd Layer3.6.30.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query369
TIGR01042 591 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A 0.0
PRK04192 586 PRK04192, PRK04192, V-type ATP synthase subunit A; 0.0
COG1155 588 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su 0.0
cd01134369 cd01134, V_A-ATPase_A, V/A-type ATP synthase catal 0.0
TIGR01043 578 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, 1e-172
PRK14698 1017 PRK14698, PRK14698, V-type ATP synthase subunit A; 2e-74
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa 1e-53
PRK14698 1017 PRK14698, PRK14698, V-type ATP synthase subunit A; 8e-43
TIGR02546 422 TIGR02546, III_secr_ATP, type III secretion appara 8e-24
COG1157 441 COG1157, FliI, Flagellar biosynthesis/type III sec 2e-22
TIGR03498 418 TIGR03498, FliI_clade3, flagellar protein export A 2e-21
PRK06820 440 PRK06820, PRK06820, type III secretion system ATPa 2e-21
cd01136 326 cd01136, ATPase_flagellum-secretory_path_III, Flag 5e-21
PRK06936 439 PRK06936, PRK06936, type III secretion system ATPa 9e-18
PRK08149 428 PRK08149, PRK08149, ATP synthase SpaL; Validated 1e-17
TIGR01026 440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 2e-17
TIGR03497 413 TIGR03497, FliI_clade2, flagellar protein export A 4e-17
PRK07594 433 PRK07594, PRK07594, type III secretion system ATPa 5e-17
PRK06002 450 PRK06002, fliI, flagellum-specific ATP synthase; V 2e-16
TIGR03496 411 TIGR03496, FliI_clade1, flagellar protein export A 8e-16
PRK09099 441 PRK09099, PRK09099, type III secretion system ATPa 8e-16
PRK07721 438 PRK07721, fliI, flagellum-specific ATP synthase; V 2e-15
cd01133274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subu 2e-15
PRK08927 442 PRK08927, fliI, flagellum-specific ATP synthase; V 3e-15
PRK12597 461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta 3e-15
TIGR01039 461 TIGR01039, atpD, ATP synthase, F1 beta subunit 7e-15
PRK06315 442 PRK06315, PRK06315, type III secretion system ATPa 7e-15
COG0055 468 COG0055, AtpD, F0F1-type ATP synthase, beta subuni 1e-14
PRK04196 460 PRK04196, PRK04196, V-type ATP synthase subunit B; 2e-13
TIGR00962 501 TIGR00962, atpA, proton translocating ATP synthase 1e-12
pfam0287469 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta 5e-12
PRK05922 434 PRK05922, PRK05922, type III secretion system ATPa 7e-12
COG1156 463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su 1e-11
PRK08972 444 PRK08972, fliI, flagellum-specific ATP synthase; V 1e-11
cd01132274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c 2e-11
PRK13343 502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 9e-11
PRK05688 451 PRK05688, fliI, flagellum-specific ATP synthase; V 2e-10
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 4e-10
PRK09280 463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta 5e-10
PRK07196 434 PRK07196, fliI, flagellum-specific ATP synthase; V 7e-10
TIGR03305 449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, 7e-10
TIGR03324 497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, 7e-10
PRK06793 432 PRK06793, fliI, flagellum-specific ATP synthase; V 9e-10
COG0056 504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 3e-09
TIGR01026440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 2e-08
CHL00059 485 CHL00059, atpA, ATP synthase CF1 alpha subunit 3e-08
TIGR03497413 TIGR03497, FliI_clade2, flagellar protein export A 7e-08
PRK08472 434 PRK08472, fliI, flagellum-specific ATP synthase; V 7e-08
COG1157441 COG1157, FliI, Flagellar biosynthesis/type III sec 3e-07
PRK02118436 PRK02118, PRK02118, V-type ATP synthase subunit B; 3e-07
PRK13343 502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 4e-07
PRK06820440 PRK06820, PRK06820, type III secretion system ATPa 5e-07
PRK07960 455 PRK07960, fliI, flagellum-specific ATP synthase; V 6e-07
TIGR01041 458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, 7e-07
TIGR03496411 TIGR03496, FliI_clade1, flagellar protein export A 1e-06
PTZ00185 574 PTZ00185, PTZ00185, ATPase alpha subunit; Provisio 2e-06
CHL00060 494 CHL00060, atpB, ATP synthase CF1 beta subunit 4e-06
PRK12597 461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta 9e-06
PRK09281 502 PRK09281, PRK09281, F0F1 ATP synthase subunit alph 4e-05
TIGR02546422 TIGR02546, III_secr_ATP, type III secretion appara 5e-05
TIGR01040 466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B 2e-04
PRK07594433 PRK07594, PRK07594, type III secretion system ATPa 3e-04
COG0055 468 COG0055, AtpD, F0F1-type ATP synthase, beta subuni 3e-04
TIGR00962 501 TIGR00962, atpA, proton translocating ATP synthase 5e-04
cd01135276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- 6e-04
TIGR03498418 TIGR03498, FliI_clade3, flagellar protein export A 8e-04
PRK06315442 PRK06315, PRK06315, type III secretion system ATPa 0.001
PRK04196 460 PRK04196, PRK04196, V-type ATP synthase subunit B; 0.001
PRK09281 502 PRK09281, PRK09281, F0F1 ATP synthase subunit alph 0.001
COG0056 504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 0.003
>gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit Back     alignment and domain information 
 Score =  736 bits (1901), Expect = 0.0
 Identities = 283/350 (80%), Positives = 313/350 (89%), Gaps = 1/350 (0%)

Query: 20  EYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVN 79
           EYGY+ KVSGPVV+A+ M GAAMYELVRVGHD L+GEIIRLEGD ATIQVYEET+GL V 
Sbjct: 1   EYGYIYKVSGPVVVAENMAGAAMYELVRVGHDELVGEIIRLEGDKATIQVYEETSGLTVG 60

Query: 80  DPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQ 139
           DPVLRT KPLSVELGPGILGNIFDGIQRPLK IA +S  +YIPRGV+VPALD+D  WEF 
Sbjct: 61  DPVLRTGKPLSVELGPGILGNIFDGIQRPLKAIAEQSQSIYIPRGVNVPALDRDKKWEFT 120

Query: 140 PKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEFQ 199
           PKK+  GD +TGGD+Y TVFENSL++H + LPP A G +TY+APAG Y++ DTVLE+EFQ
Sbjct: 121 PKKLRVGDHITGGDIYGTVFENSLIKHKIMLPPRARGTITYIAPAGNYTVDDTVLEVEFQ 180

Query: 200 GVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKT 259
           GVKK F+MLQ WPVR+PRPV+ KL A+TPLLTGQRVLDALFP V GGT AIPGAFGCGKT
Sbjct: 181 GVKKKFSMLQTWPVRSPRPVTEKLPANTPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKT 240

Query: 260 VISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTS 319
           VISQ+LSKYSNSD +VYVGCGERGNEMAEVLMDFP+LTM + DGREES+MKRTTLVANTS
Sbjct: 241 VISQSLSKYSNSDAIVYVGCGERGNEMAEVLMDFPELTMEV-DGREESIMKRTTLVANTS 299

Query: 320 NMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLG 369
           NMPVAAREASIYTGIT+AEYFRDMGYNVSMMADSTSRWAEALREISGRL 
Sbjct: 300 NMPVAAREASIYTGITLAEYFRDMGYNVSMMADSTSRWAEALREISGRLA 349

This models eukaryotic vacuolar (H+)-ATPase that is responsible for acidifying cellular compartments. This enzyme shares extensive sequence similarity with archaeal ATP synthase [Transport and binding proteins, Cations and iron carrying compounds]. Length = 591
>gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|238554 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|238553 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|214349 CHL00060, atpB, ATP synthase CF1 beta subunit Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 369
TIGR01042 591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 100.0
TIGR01043 578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 100.0
PRK04192 586 V-type ATP synthase subunit A; Provisional 100.0
COG1155 588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 100.0
KOG1352 618 consensus Vacuolar H+-ATPase V1 sector, subunit A 100.0
PRK14698 1017 V-type ATP synthase subunit A; Provisional 100.0
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 100.0
TIGR03324 497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 100.0
COG1157 441 FliI Flagellar biosynthesis/type III secretory pat 100.0
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 100.0
TIGR00962 501 atpA proton translocating ATP synthase, F1 alpha s 100.0
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 100.0
PRK04196 460 V-type ATP synthase subunit B; Provisional 100.0
TIGR01041 458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 100.0
CHL00059 485 atpA ATP synthase CF1 alpha subunit 100.0
PRK02118 436 V-type ATP synthase subunit B; Provisional 100.0
PRK06936 439 type III secretion system ATPase; Provisional 100.0
PRK09280 463 F0F1 ATP synthase subunit beta; Validated 100.0
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 100.0
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR01040 466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 100.0
PTZ00185 574 ATPase alpha subunit; Provisional 100.0
TIGR01039 461 atpD ATP synthase, F1 beta subunit. The sequences 100.0
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 100.0
CHL00060 494 atpB ATP synthase CF1 beta subunit 100.0
COG0056 504 AtpA F0F1-type ATP synthase, alpha subunit [Energy 100.0
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03305 449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 100.0
PRK06820 440 type III secretion system ATPase; Validated 100.0
PRK09099 441 type III secretion system ATPase; Provisional 100.0
PRK05922 434 type III secretion system ATPase; Validated 100.0
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 100.0
PRK07594 433 type III secretion system ATPase SsaN; Validated 100.0
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 100.0
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 100.0
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 100.0
PRK08149 428 ATP synthase SpaL; Validated 100.0
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 100.0
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 100.0
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 100.0
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 100.0
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 100.0
PRK06315 442 type III secretion system ATPase; Provisional 100.0
COG0055 468 AtpD F0F1-type ATP synthase, beta subunit [Energy 100.0
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 100.0
COG1156 463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E 100.0
KOG1351 489 consensus Vacuolar H+-ATPase V1 sector, subunit B 100.0
KOG1350 521 consensus F0F1-type ATP synthase, beta subunit [En 100.0
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 100.0
PRK12608 380 transcription termination factor Rho; Provisional 100.0
PRK12678 672 transcription termination factor Rho; Provisional 100.0
KOG1353340 consensus F0F1-type ATP synthase, alpha subunit [E 99.97
PRK09376 416 rho transcription termination factor Rho; Provisio 99.96
cd01128 249 rho_factor Transcription termination factor rho is 99.93
TIGR00767 415 rho transcription termination factor Rho. Members 99.91
COG1158 422 Rho Transcription termination factor [Transcriptio 99.73
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.52
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.28
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.04
COG4525 259 TauB ABC-type taurine transport system, ATPase com 98.94
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 98.91
PF0287469 ATP-synt_ab_N: ATP synthase alpha/beta family, bet 98.85
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 98.84
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 98.82
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 98.68
COG1136226 SalX ABC-type antimicrobial peptide transport syst 98.63
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 98.55
COG2884223 FtsE Predicted ATPase involved in cell division [C 98.54
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 98.52
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 98.51
COG1123 539 ATPase components of various ABC-type transport sy 98.5
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 98.49
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 98.48
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 98.45
COG1127 263 Ttg2A ABC-type transport system involved in resist 98.42
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 98.4
COG3638 258 ABC-type phosphate/phosphonate transport system, A 98.4
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 98.34
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 98.34
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.33
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 98.3
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 98.24
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 98.2
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.2
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.19
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 98.18
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.18
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 98.16
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 98.15
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.15
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 98.13
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.1
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 98.09
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.08
cd01394218 radB RadB. The archaeal protein radB shares simila 98.08
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 98.08
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 98.08
PRK10908222 cell division protein FtsE; Provisional 98.07
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transp 98.06
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.05
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.05
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.02
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 98.01
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.01
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.01
cd01393226 recA_like RecA is a bacterial enzyme which has rol 98.01
COG4619223 ABC-type uncharacterized transport system, ATPase 98.0
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 97.99
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 97.99
COG4181228 Predicted ABC-type transport system involved in ly 97.99
TIGR02236310 recomb_radA DNA repair and recombination protein R 97.99
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.98
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.98
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 97.97
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 97.97
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 97.97
PRK13537 306 nodulation ABC transporter NodI; Provisional 97.96
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 97.96
PTZ00035337 Rad51 protein; Provisional 97.96
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.95
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.95
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.95
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.95
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.94
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.94
PRK06067234 flagellar accessory protein FlaH; Validated 97.94
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 97.93
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 97.93
PRK04328249 hypothetical protein; Provisional 97.92
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 97.89
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 97.89
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.88
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.88
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 97.86
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.86
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 97.86
smart00382148 AAA ATPases associated with a variety of cellular 97.84
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 97.84
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.84
PRK09354 349 recA recombinase A; Provisional 97.84
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 97.83
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 97.82
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 97.82
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.81
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 97.81
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 97.8
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 97.8
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.8
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 97.8
cd00983 325 recA RecA is a bacterial enzyme which has roles in 97.79
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.79
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 97.78
PRK13536 340 nodulation factor exporter subunit NodI; Provision 97.78
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 97.77
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 97.76
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.74
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 97.74
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 97.74
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 97.73
PRK09302 509 circadian clock protein KaiC; Reviewed 97.73
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.73
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 97.73
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 97.73
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.73
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.72
PRK14237267 phosphate transporter ATP-binding protein; Provisi 97.72
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 97.72
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 97.71
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 97.71
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 97.7
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 97.68
PRK14242253 phosphate transporter ATP-binding protein; Provisi 97.68
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 97.68
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.68
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 97.67
PLN03186342 DNA repair protein RAD51 homolog; Provisional 97.67
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 97.67
COG0411250 LivG ABC-type branched-chain amino acid transport 97.66
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.66
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.66
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.66
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 97.66
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 97.65
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 97.65
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 97.65
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 97.65
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.65
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 97.65
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 97.64
TIGR02239 316 recomb_RAD51 DNA repair protein RAD51. This eukary 97.64
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.64
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 97.63
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 97.63
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.63
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.63
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 97.62
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.62
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 97.62
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.62
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 97.61
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 97.61
cd03299235 ABC_ModC_like Archeal protein closely related to M 97.61
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 97.61
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 97.61
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.61
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.61
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.61
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 97.6
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.6
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.6
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.6
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 97.6
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 97.6
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.6
PRK09984 262 phosphonate/organophosphate ester transporter subu 97.6
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 97.59
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 97.59
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 97.59
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.59
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 97.58
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 97.58
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.58
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.58
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 97.58
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 97.58
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 97.58
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.57
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.57
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.57
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 97.57
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 97.57
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 97.56
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 97.56
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 97.56
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 97.56
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 97.56
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 97.56
PRK10419 268 nikE nickel transporter ATP-binding protein NikE; 97.55
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 97.55
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.55
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 97.54
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 97.54
cd03246173 ABCC_Protease_Secretion This family represents the 97.54
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 97.54
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 97.54
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 97.54
COG4987573 CydC ABC-type transport system involved in cytochr 97.53
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.53
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 97.53
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 97.53
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 97.53
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 97.53
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 97.53
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 97.53
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 97.52
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.52
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 97.52
PRK10619257 histidine/lysine/arginine/ornithine transporter su 97.52
PRK14238271 phosphate transporter ATP-binding protein; Provisi 97.52
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 97.52
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 97.51
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 97.51
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 97.51
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.51
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.51
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 97.5
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 97.5
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.5
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 97.49
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 97.49
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 97.49
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 97.49
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 97.49
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 97.48
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.48
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.47
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 97.47
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 97.47
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.46
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.46
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 97.46
PRK04301317 radA DNA repair and recombination protein RadA; Va 97.46
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.46
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 97.46
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 97.46
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 97.46
PRK14236272 phosphate transporter ATP-binding protein; Provisi 97.45
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.45
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.45
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 97.44
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.44
PRK14240250 phosphate transporter ATP-binding protein; Provisi 97.44
PRK14239252 phosphate transporter ATP-binding protein; Provisi 97.43
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.43
COG1123 539 ATPase components of various ABC-type transport sy 97.42
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.42
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.42
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 97.42
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 97.4
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 97.4
PRK14235267 phosphate transporter ATP-binding protein; Provisi 97.4
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 97.4
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 97.4
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 97.4
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 97.39
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.39
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.39
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 97.39
PRK11823 446 DNA repair protein RadA; Provisional 97.39
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 97.39
PRK09519 790 recA DNA recombination protein RecA; Reviewed 97.39
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.38
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 97.37
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 97.37
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 97.37
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.37
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 97.37
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.36
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 97.36
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 97.36
COG4172534 ABC-type uncharacterized transport system, duplica 97.35
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.35
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 97.35
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 97.35
PRK09580248 sufC cysteine desulfurase ATPase component; Review 97.35
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 97.34
cd03234226 ABCG_White The White subfamily represents ABC tran 97.34
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.34
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 97.34
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.33
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.33
PRK10790592 putative multidrug transporter membrane\ATP-bindin 97.32
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 97.31
COG4559 259 ABC-type hemin transport system, ATPase component 97.3
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 97.3
PRK13546264 teichoic acids export protein ATP-binding subunit; 97.3
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 97.29
COG4988559 CydD ABC-type transport system involved in cytochr 97.28
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.28
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.27
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 97.27
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 97.27
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.27
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.26
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.26
PRK09302 509 circadian clock protein KaiC; Reviewed 97.26
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 97.25
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.25
COG0410237 LivF ABC-type branched-chain amino acid transport 97.24
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.24
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.23
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 97.23
PRK11147 635 ABC transporter ATPase component; Reviewed 97.22
PRK10535 648 macrolide transporter ATP-binding /permease protei 97.22
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.22
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 97.22
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 97.22
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 97.21
PRK10938 490 putative molybdenum transport ATP-binding protein 97.2
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 97.2
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 97.2
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.2
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 97.19
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.19
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.17
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.17
PRK10522547 multidrug transporter membrane component/ATP-bindi 97.16
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 97.16
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 97.16
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.15
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 97.13
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.13
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 97.13
PRK11147 635 ABC transporter ATPase component; Reviewed 97.12
PRK03695 248 vitamin B12-transporter ATPase; Provisional 97.12
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 97.12
PTZ002431560 ABC transporter; Provisional 97.11
PRK09700510 D-allose transporter ATP-binding protein; Provisio 97.11
COG4604 252 CeuD ABC-type enterochelin transport system, ATPas 97.1
PLN03073718 ABC transporter F family; Provisional 97.1
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 97.09
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 97.08
COG0488530 Uup ATPase components of ABC transporters with dup 97.08
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 97.08
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 97.06
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.06
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 97.06
PRK10938490 putative molybdenum transport ATP-binding protein 97.05
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 97.05
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.03
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase 97.01
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.99
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 96.99
COG1119257 ModF ABC-type molybdenum transport system, ATPase 96.99
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 96.98
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 96.97
PRK15064530 ABC transporter ATP-binding protein; Provisional 96.97
COG4136213 ABC-type uncharacterized transport system, ATPase 96.97
PRK11288501 araG L-arabinose transporter ATP-binding protein; 96.96
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.96
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 96.95
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 96.95
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 96.95
COG3845 501 ABC-type uncharacterized transport systems, ATPase 96.94
PLN03073 718 ABC transporter F family; Provisional 96.93
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 96.92
COG4167 267 SapF ABC-type antimicrobial peptide transport syst 96.92
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 96.91
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 96.89
COG1117253 PstB ABC-type phosphate transport system, ATPase c 96.88
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 96.88
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 96.87
COG2256 436 MGS1 ATPase related to the helicase subunit of the 96.86
PRK10762501 D-ribose transporter ATP binding protein; Provisio 96.85
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 96.83
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.82
PRK11819556 putative ABC transporter ATP-binding protein; Revi 96.81
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 96.81
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 96.81
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.8
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 96.79
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 96.78
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 96.77
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 96.73
PF00004132 AAA: ATPase family associated with various cellula 96.73
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 96.72
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.71
PLN03130 1622 ABC transporter C family member; Provisional 96.69
COG0488 530 Uup ATPase components of ABC transporters with dup 96.69
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 96.69
PF13173128 AAA_14: AAA domain 96.65
PLN03232 1495 ABC transporter C family member; Provisional 96.64
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 96.59
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 96.58
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 96.56
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.55
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 96.55
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 96.53
PRK13409 590 putative ATPase RIL; Provisional 96.53
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 96.52
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 96.5
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 96.5
COG4586 325 ABC-type uncharacterized transport system, ATPase 96.49
PF00154 322 RecA: recA bacterial DNA recombination protein; In 96.48
PLN03211 659 ABC transporter G-25; Provisional 96.47
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.46
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 96.45
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 96.45
COG4161242 ArtP ABC-type arginine transport system, ATPase co 96.43
PRK13409 590 putative ATPase RIL; Provisional 96.42
COG4674249 Uncharacterized ABC-type transport system, ATPase 96.38
PRK08118167 topology modulation protein; Reviewed 96.38
cd01125 239 repA Hexameric Replicative Helicase RepA. RepA is 96.36
COG4152 300 ABC-type uncharacterized transport system, ATPase 96.35
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.34
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.31
PRK07261171 topology modulation protein; Provisional 96.29
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.29
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 96.27
COG1101 263 PhnK ABC-type uncharacterized transport system, AT 96.26
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.25
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 96.22
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 96.17
COG4598256 HisP ABC-type histidine transport system, ATPase c 96.16
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 96.14
PRK00300205 gmk guanylate kinase; Provisional 96.11
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 96.11
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.11
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 96.09
COG4178604 ABC-type uncharacterized transport system, permeas 96.09
TIGR00235207 udk uridine kinase. Model contains a number of lon 96.03
PF05729166 NACHT: NACHT domain 96.0
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 95.99
PRK09825176 idnK D-gluconate kinase; Provisional 95.99
PRK05973237 replicative DNA helicase; Provisional 95.96
PRK13342 413 recombination factor protein RarA; Reviewed 95.94
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.9
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.9
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 95.89
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 95.88
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 95.86
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 95.84
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 95.8
COG4133209 CcmA ABC-type transport system involved in cytochr 95.79
COG0468 279 RecA RecA/RadA recombinase [DNA replication, recom 95.77
PRK05480209 uridine/cytidine kinase; Provisional 95.76
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 95.76
COG4618580 ArpD ABC-type protease/lipase transport system, AT 95.71
PRK05541176 adenylylsulfate kinase; Provisional 95.71
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.67
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 95.66
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 95.64
PLN03232 1495 ABC transporter C family member; Provisional 95.63
PRK00411 394 cdc6 cell division control protein 6; Reviewed 95.6
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information 
Probab=100.00  E-value=5.7e-94  Score=738.18  Aligned_cols=349  Identities=81%  Similarity=1.296  Sum_probs=337.5

Q ss_pred             eEeEEEEEECcEEEEeecCCCccccEEEEcCCcEEEEEEEEeCCEEEEEEecCCCCCCCCCeEEEcCCceEEecCccccc
Q 017581           20 EYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILG   99 (369)
Q Consensus        20 ~~G~V~~I~G~ii~v~gl~~~~igE~v~i~~~~~~geVi~i~~d~v~l~~~~~t~Gi~~G~~V~~tg~~l~VpvG~~LLG   99 (369)
                      ++|+|.+|+|++++++|++++++||+|+++++.+.|||+++++|.+++|+|++++||++|+.|..||++++|++|++|||
T Consensus         1 ~~G~V~~v~G~vV~a~g~~~~~~gE~v~v~~~~l~gEVI~l~~d~a~iq~ye~t~Gl~~G~~V~~tg~~lsv~lGpglLG   80 (591)
T TIGR01042         1 EYGYIYKVSGPVVVAENMAGAAMYELVRVGHDELVGEIIRLEGDKATIQVYEETSGLTVGDPVLRTGKPLSVELGPGILG   80 (591)
T ss_pred             CceEEEEEECCEEEEecCCCCCcCCEEEECCCceEEEEEEEcCCeEEEEEccCccCCCCCCEEEeCCCccEEEcCHHHhh
Confidence            47999999999999999889999999999755699999999999999999999999999999999999999999999999


Q ss_pred             eeecccCcccccccccCCcccccCCCCCCCCCcCcccccccccccCCccccCCcceeeeeecccccccccCCCCCCCceE
Q 017581          100 NIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVT  179 (369)
Q Consensus       100 RVlDglG~PLDg~~~~~~~~~~~~g~~~~~~~~~~~~~f~p~~~~~g~~v~~g~i~g~~~e~~~~~~~i~~~~~~~~~v~  179 (369)
                      |||||+|||||+.++..+..|++||+++++++.+++|+|.|..+++||.|.+|||+|+|+|++++.|+||+||+..|+|+
T Consensus        81 ~V~DgigrPLd~~~~~~~~~fi~rG~~~~~ld~~~~w~f~p~~~k~gd~v~~G~i~g~v~e~~~~~h~imvpp~~~g~v~  160 (591)
T TIGR01042        81 NIFDGIQRPLKAIAEQSQSIYIPRGVNVPALDRDKKWEFTPKKLRVGDHITGGDIYGTVFENSLIKHKIMLPPRARGTIT  160 (591)
T ss_pred             cccCcCCCchHHHHhhccCccccCCCCCCCCCccccceeeccccccCCCccCCCeEEEEecCCceeeeeecCCCCceEEE
Confidence            99999999999987777788999999999999999999999669999999999999999999999999999999999999


Q ss_pred             EeccCCcccccceEEEEEeecceeeeeeccceeccCCCCccccccccceeccCceeeeccccccCCCeEeecCCCCCChH
Q 017581          180 YVAPAGQYSLKDTVLELEFQGVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKT  259 (369)
Q Consensus       180 ~~~~~g~~~~~~~v~~~~~~~~~~~~~m~~~~pv~~~~~~~~r~~~~~~l~TGi~aID~l~pi~~GQr~~Ifg~sG~GKs  259 (369)
                      +|+++|+||++++|++++++|..++++|.|+||+|.++|+++|.++++||.||+|+||+|+||++|||++|||++|||||
T Consensus       161 ~i~~~g~ytv~~~i~~~~~~g~~~~~~m~~~wPvr~p~p~~~R~~~~~PL~TG~RvID~lfPi~kGqr~~I~gg~G~GKT  240 (591)
T TIGR01042       161 YIAPAGNYTVDDTVLEVEFQGVKKKFSMLQTWPVRSPRPVTEKLPANTPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKT  240 (591)
T ss_pred             EEccCCCceeeeEEEEEeeCCceeeeccceeeecccCCChhhccCCCCccccchhhhhhccchhcCCeEEEEcCCCcCHH
Confidence            99999999999999999989999999999999999988999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhcCCCeEEEEeecccchhhhHHhhhcccccccCCCCCcCCCcceeEEEEeCCCCCHHhHhhhhHHHHHHHHH
Q 017581          260 VISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEY  339 (369)
Q Consensus       260 tLl~~ia~~~~~d~vV~~~iGer~~ev~~~~~~f~~~~~~~~~~~~~~~l~~t~vv~~t~~~~~~~r~~a~~~a~tiAEy  339 (369)
                      +|+.||++++++|++||++||||++|++||+++||++++|. ++++..+|+||++|+||||+|+++|++++|+|+|+|||
T Consensus       241 ~l~~~lak~s~aDviVyvg~GERG~Em~evle~fp~l~dp~-~g~~~~~m~rtvlVa~tsd~p~~~R~~s~ytg~tiAEY  319 (591)
T TIGR01042       241 VISQSLSKYSNSDAIVYVGCGERGNEMAEVLMDFPELTMEV-DGREESIMKRTTLVANTSNMPVAAREASIYTGITLAEY  319 (591)
T ss_pred             HHHHHHHhccCcCEEEEEEEeechHHHHHHHHHhHhhcccc-cccccccccceEEEEEcCCCCHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999998877 33456889999999999999999999999999999999


Q ss_pred             HHHCCCcEEEEecchHHHHHHHHHHhhccC
Q 017581          340 FRDMGYNVSMMADSTSRWAEALREISGRLG  369 (369)
Q Consensus       340 fr~~G~~VLli~Dsltr~A~A~rEiS~~lg  369 (369)
                      |||+|+|||||+||+||||+|+||||++||
T Consensus       320 fRD~G~~Vll~~DS~tR~AeAlREIsl~lg  349 (591)
T TIGR01042       320 FRDMGYNVSMMADSTSRWAEALREISGRLA  349 (591)
T ss_pred             HHhcCCCEEEEecChHHHHHHHHHHHhccC
Confidence            999999999999999999999999999997

This models eukaryotic vacuolar (H+)-ATPase that is responsible for acidifying cellular compartments. This enzyme shares extensive sequence similarity with archaeal ATP synthase.
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>KOG1352 consensus Vacuolar H+-ATPase V1 sector, subunit A [Energy production and conversion] Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>KOG1351 consensus Vacuolar H+-ATPase V1 sector, subunit B [Energy production and conversion] Back     alignment and domain information
>KOG1350 consensus F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG1353 consensus F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query369
3m4y_A 588 Structural Characterization Of The Subunit A Mutant 1e-110
1vdz_A 588 Crystal Structure Of A-Type Atpase Catalytic Subuni 1e-110
3se0_A 588 Structural Characterization Of The Subunit A Mutant 1e-110
3sdz_A 588 Structural Characterization Of The Subunit A Mutant 1e-110
3qjy_A 588 Crystal Structure Of P-Loop G234a Mutant Of Subunit 1e-109
3qia_A 588 Crystal Structure Of P-Loop G237a Mutant Of Subunit 1e-109
3ikj_A 588 Structural Characterization For The Nucleotide Bind 1e-109
3i4l_A 588 Structural Characterization For The Nucleotide Bind 1e-109
3nd9_A 588 Structural Characterization For The Nucleotide Bind 1e-108
3qg1_A 588 Crystal Structure Of P-Loop G239a Mutant Of Subunit 1e-108
3nd8_A 588 Structural Characterization For The Nucleotide Bind 1e-108
3mfy_A 588 Structural Characterization Of The Subunit A Mutant 1e-108
3a5c_A 578 Inter-Subunit Interaction And Quaternary Rearrangem 1e-107
3gqb_A 578 Crystal Structure Of The A3b3 Complex From V-atpase 1e-106
3vr6_A 600 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 1e-100
3vr2_A 600 Crystal Structure Of Nucleotide-free A3b3 Complex F 7e-93
2obl_A 347 Structural And Biochemical Analysis Of A Prototypic 2e-17
2qe7_D 462 Crystal Structure Of The F1-Atpase From The Thermoa 3e-14
1sky_E 473 Crystal Structure Of The Nucleotide Free Alpha3beta 6e-14
4b2q_E 473 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 1e-11
4b2q_D 470 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 1e-11
3oeh_D 484 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 1e-11
3fks_D 484 Yeast F1 Atpase In The Absence Of Bound Nucleotides 1e-11
2hld_D 478 Crystal Structure Of Yeast Mitochondrial F1-Atpase 1e-11
3oaa_D 459 Structure Of The E.Coli F1-Atp Synthase Inhibited B 2e-11
1mab_B 479 Rat Liver F1-Atpase Length = 479 2e-11
2xok_D 511 Refined Structure Of Yeast F1c10 Atpase Complex To 2e-11
4asu_D 480 F1-Atpase In Which All Three Catalytic Sites Contai 4e-11
1nbm_D 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 4e-11
1cow_D 482 Bovine Mitochondrial F1-Atpase Complexed With Aurov 4e-11
1nbm_E 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 4e-11
2xnd_D 467 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 4e-11
2w6e_D 528 Low Resolution Structures Of Bovine Mitochondrial F 4e-11
2dpy_A 438 Crystal Structure Of The Flagellar Type Iii Atpase 2e-10
1fx0_A 507 Crystal Structure Of The Chloroplast F1-Atpase From 4e-10
3oaa_A 513 Structure Of The E.Coli F1-Atp Synthase Inhibited B 9e-08
3vr6_D 465 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 1e-06
2qe7_A 502 Crystal Structure Of The F1-Atpase From The Thermoa 1e-06
1sky_B 502 Crystal Structure Of The Nucleotide Free Alpha3beta 2e-06
3vr2_D 465 Crystal Structure Of Nucleotide-free A3b3 Complex F 3e-06
2r9v_A 515 Crystal Structure Of Atp Synthase Subunit Alpha (Tm 3e-06
1ohh_B 487 Bovine Mitochondrial F1-Atpase Complexed With The I 5e-06
4b2q_B 486 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 5e-06
4b2q_A 485 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 5e-06
3ofn_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 5e-06
2hld_A 510 Crystal Structure Of Yeast Mitochondrial F1-Atpase 5e-06
3oee_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 6e-06
2xnd_A 492 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 6e-06
1cow_A 510 Bovine Mitochondrial F1-Atpase Complexed With Aurov 6e-06
2jiz_A 510 The Structure Of F1-Atpase Inhibited By Resveratrol 6e-06
2f43_A 510 Rat Liver F1-atpase Length = 510 6e-06
1mab_A 510 Rat Liver F1-Atpase Length = 510 6e-06
1bmf_A 510 Bovine Mitochondrial F1-Atpase Length = 510 6e-06
1fx0_B 498 Crystal Structure Of The Chloroplast F1-Atpase From 7e-06
2xok_A 545 Refined Structure Of Yeast F1c10 Atpase Complex To 7e-06
2w6e_A 553 Low Resolution Structures Of Bovine Mitochondrial F 8e-06
>pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 Back     alignment and structure 
Iteration: 1

 Score =  395 bits (1016), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/350 (57%), Positives = 256/350 (73%), Gaps = 10/350 (2%)
Query: 22  GYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDP 81
           G + +V+GP+V+ADGM GA MYE+VRVG   LIGEIIRLEGD A IQVYEETAG+   +P
Sbjct: 5   GRIIRVTGPLVVADGMKGAKMYEVVRVGELGLIGEIIRLEGDKAVIQVYEETAGVRPGEP 64
Query: 82  VLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPK 141
           V+ T   LSVELGPG+L +I+DGIQRPL+ I  ++GD +I RGV+ PAL +D  W F PK
Sbjct: 65  VVGTGASLSVELGPGLLTSIYDGIQRPLEVIREKTGD-FIARGVTAPALPRDKKWHFIPK 123
Query: 142 -KIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEF-Q 199
            K+  GD + GGD+   V E S++ H + +PP   G++  +A  G Y++++ + +++   
Sbjct: 124 AKV--GDKVVGGDIIGEVPETSIIVHKIMVPPGIEGEIVEIAEEGDYTIEEVIAKVKTPS 181
Query: 200 GVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKT 259
           G  K   M Q WPVR  RP   KL  + PL+TGQRV+D  FP   GGT AIPGAFG GKT
Sbjct: 182 GEIKELKMYQRWPVRVKRPYKEKLPPEVPLITGQRVIDTFFPQAKGGTAAIPGAFGSGKT 241
Query: 260 VISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGRE-ESVMKRTTLVANT 318
           V    L+K+S++  V+Y+GCGERGNEM +VL +FP+L     D +  + +M+RT L+ANT
Sbjct: 242 VTQHQLAKWSDAQVVIYIGCGERGNEMTDVLEEFPKLK----DPKTGKPLMERTVLIANT 297
Query: 319 SNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRL 368
           SNMPVAAREASIYTGITIAEYFRDMGY+V++MADSTSRWAEALREISGRL
Sbjct: 298 SNMPVAAREASIYTGITIAEYFRDMGYDVALMADSTSRWAEALREISGRL 347
>pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 Back     alignment and structure
>pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3A5C|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 578 Back     alignment and structure
>pdb|3GQB|A Chain A, Crystal Structure Of The A3b3 Complex From V-atpase Length = 578 Back     alignment and structure
>pdb|3VR6|A Chain A, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 600 Back     alignment and structure
>pdb|3VR2|A Chain A, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 600 Back     alignment and structure
>pdb|2OBL|A Chain A, Structural And Biochemical Analysis Of A Prototypical Atpase From The Type Iii Secretion System Of Pathogenic Bacteria Length = 347 Back     alignment and structure
>pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 462 Back     alignment and structure
>pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 473 Back     alignment and structure
>pdb|4B2Q|E Chain E, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 473 Back     alignment and structure
>pdb|4B2Q|D Chain D, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 470 Back     alignment and structure
>pdb|3OEH|D Chain D, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f Length = 484 Back     alignment and structure
>pdb|3FKS|D Chain D, Yeast F1 Atpase In The Absence Of Bound Nucleotides Length = 484 Back     alignment and structure
>pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 478 Back     alignment and structure
>pdb|3OAA|D Chain D, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 459 Back     alignment and structure
>pdb|1MAB|B Chain B, Rat Liver F1-Atpase Length = 479 Back     alignment and structure
>pdb|2XOK|D Chain D, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 511 Back     alignment and structure
>pdb|4ASU|D Chain D, F1-Atpase In Which All Three Catalytic Sites Contain Bound Nucleotide, With Magnesium Ion Released In The Empty Site Length = 480 Back     alignment and structure
>pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 482 Back     alignment and structure
>pdb|1NBM|E Chain E, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|2XND|D Chain D, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 467 Back     alignment and structure
>pdb|2W6E|D Chain D, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 528 Back     alignment and structure
>pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 Back     alignment and structure
>pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 Back     alignment and structure
>pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 Back     alignment and structure
>pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 Back     alignment and structure
>pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 Back     alignment and structure
>pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 Back     alignment and structure
>pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 Back     alignment and structure
>pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 Back     alignment and structure
>pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 Back     alignment and structure
>pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 Back     alignment and structure
>pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 Back     alignment and structure
>pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 Back     alignment and structure
>pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 Back     alignment and structure
>pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 Back     alignment and structure
>pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 Back     alignment and structure
>pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 Back     alignment and structure
>pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 Back     alignment and structure
>pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 Back     alignment and structure
>pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|1FX0|B Chain B, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 498 Back     alignment and structure
>pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 Back     alignment and structure
>pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query369
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 0.0
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 0.0
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 2e-24
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 5e-22
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 2e-07
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 5e-17
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 7e-15
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 7e-17
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 8e-17
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 8e-13
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 7e-11
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 8e-11
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 1e-08
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 2e-04
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 1e-08
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 2e-06
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 1e-08
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 2e-04
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 2e-08
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 1e-04
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 4e-08
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 Back     alignment and structure
 Score =  545 bits (1406), Expect = 0.0
 Identities = 195/349 (55%), Positives = 249/349 (71%), Gaps = 6/349 (1%)

Query: 22  GYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDP 81
           G + +V+GP+V+ADGM GA MYE+VRVG   LIGEIIRLEGD A IQVYEETAG+   +P
Sbjct: 5   GRIIRVTGPLVVADGMKGAKMYEVVRVGELGLIGEIIRLEGDKAVIQVYEETAGVRPGEP 64

Query: 82  VLRTHKPLSVELGPGILGNIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPK 141
           V+ T   LSVELGP +L +I+DGIQRPL+ I  ++GD +I RGV+ PAL +D  W F PK
Sbjct: 65  VVGTGASLSVELGPRLLTSIYDGIQRPLEVIREKTGD-FIARGVTAPALPRDKKWHFIPK 123

Query: 142 KIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVTYVAPAGQYSLKDTVLELEF-QG 200
               GD + GGD+   V E S++ H + +PP   G++  +A  G Y++++ + +++   G
Sbjct: 124 -AKVGDKVVGGDIIGEVPETSIIVHKIMVPPGIEGEIVEIAEEGDYTIEEVIAKVKTPSG 182

Query: 201 VKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTV 260
             K   M Q WPVR  RP   KL  + PL+TGQRV+D  FP   GGT AIPG  G GKTV
Sbjct: 183 EIKELKMYQRWPVRVKRPYKEKLPPEVPLITGQRVIDTFFPQAKGGTAAIPGPAGSGKTV 242

Query: 261 ISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSN 320
               L+K+S++  V+Y+GCGERGNEM +VL +FP+L         + +M+RT L+ANTSN
Sbjct: 243 TQHQLAKWSDAQVVIYIGCGERGNEMTDVLEEFPKLKDPKTG---KPLMERTVLIANTSN 299

Query: 321 MPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLG 369
           MPVAAREASIYTGITIAEYFRDMGY+V++MADSTSRWAEALREISGRL 
Sbjct: 300 MPVAAREASIYTGITIAEYFRDMGYDVALMADSTSRWAEALREISGRLE 348
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Length = 473 Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Length = 482 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query369
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 100.0
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 100.0
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 100.0
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 100.0
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 100.0
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 100.0
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 100.0
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 100.0
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 100.0
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 100.0
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 100.0
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 100.0
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 100.0
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 100.0
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 100.0
3l0o_A 427 Transcription termination factor RHO; helicase, RH 100.0
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 100.0
3ice_A 422 Transcription termination factor RHO; transcriptio 100.0
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 98.63
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 98.63
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 98.53
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 98.45
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 98.43
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.4
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 98.4
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 98.39
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 98.38
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.37
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 98.32
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.23
1b0u_A 262 Histidine permease; ABC transporter, transport pro 98.22
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 98.21
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 98.13
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.08
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 98.07
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 98.02
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 98.01
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.97
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 97.94
1g6h_A257 High-affinity branched-chain amino acid transport 97.92
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.9
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.88
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 97.84
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 97.8
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 97.8
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.79
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.78
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 97.78
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.78
1sgw_A214 Putative ABC transporter; structural genomics, P p 97.77
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 97.73
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.73
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 97.71
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 97.69
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.69
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 97.67
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.67
2ghi_A260 Transport protein; multidrug resistance protein, M 97.65
2z43_A324 DNA repair and recombination protein RADA; archaea 97.61
3io5_A 333 Recombination and repair protein; storage dimer, i 97.58
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.57
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.53
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 97.52
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.52
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.51
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 97.51
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.5
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 97.48
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 97.46
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.43
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.39
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.39
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.38
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.37
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 97.32
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 97.3
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.28
1u94_A 356 RECA protein, recombinase A; homologous recombinat 97.27
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.27
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.26
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.22
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.2
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 97.19
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.15
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 97.11
1xp8_A 366 RECA protein, recombinase A; recombination, radior 97.1
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 97.07
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.04
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.02
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.01
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.0
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 96.99
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.96
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 96.96
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 96.93
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.91
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.89
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 96.88
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 96.85
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.8
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.8
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.79
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 96.79
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 96.78
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.78
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 96.75
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.71
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 96.71
2eyu_A 261 Twitching motility protein PILT; pilus retraction 96.69
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.66
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.66
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.65
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.64
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 96.62
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.6
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.6
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 96.58
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.55
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.55
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.53
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 96.53
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.52
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.51
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.5
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.49
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 96.49
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.49
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.49
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.48
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.48
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 96.46
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.43
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.42
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 96.41
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.41
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.41
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.35
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.34
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.34
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.33
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.33
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.32
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.28
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.28
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.26
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 96.24
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.23
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 96.23
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.23
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.22
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 96.21
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 96.21
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.2
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.18
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.13
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 96.13
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 96.1
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.09
2r6a_A 454 DNAB helicase, replicative helicase; replication, 96.09
2og2_A359 Putative signal recognition particle receptor; nuc 96.05
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.02
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.01
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.01
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.0
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.97
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.96
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 95.93
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.89
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.89
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.81
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.75
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 95.74
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.73
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.7
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.66
3kta_A182 Chromosome segregation protein SMC; structural mai 95.64
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.61
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.5
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.42
2ewv_A 372 Twitching motility protein PILT; pilus retraction 95.42
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.42
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.41
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 95.37
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.36
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 95.3
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.28
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 95.24
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.22
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.2
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.18
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.17
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 95.12
3bos_A242 Putative DNA replication factor; P-loop containing 95.1
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.08
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 95.07
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 95.05
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.05
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 95.02
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 94.99
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.93
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.93
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 94.93
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.91
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.88
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.81
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.8
1p9r_A 418 General secretion pathway protein E; bacterial typ 94.8
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 94.79
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.76
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.75
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 94.71
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.7
2wji_A165 Ferrous iron transport protein B homolog; membrane 94.68
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 94.67
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.63
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.62
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 94.59
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.57
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.56
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 94.55
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.48
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.48
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.46
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.42
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.41
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.41
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.4
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 94.38
3bs4_A 260 Uncharacterized protein PH0321; structural genomic 94.32
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.3
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.3
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 94.28
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 94.25
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.23
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.22
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 94.2
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.16
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.16
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 94.13
3pvs_A 447 Replication-associated recombination protein A; ma 94.11
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.08
1via_A175 Shikimate kinase; structural genomics, transferase 94.07
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.04
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 94.04
3r20_A233 Cytidylate kinase; structural genomics, seattle st 94.04
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 94.03
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.0
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.99
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 93.98
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.94
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 93.92
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 93.91
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 93.91
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.9
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.87
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 93.86
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.84
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.83
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 93.83
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 93.83
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 93.76
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 93.76
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 93.75
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.72
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 93.71
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 93.71
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.69
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 93.68
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 93.67
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 93.66
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 93.66
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 93.65
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.64
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 93.63
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 93.63
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 93.62
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 93.61
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.61
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.57
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 93.56
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 93.55
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.55
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 93.53
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 93.52
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 93.52
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 93.51
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 93.5
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.48
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.46
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 93.44
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.44
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.43
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 93.4
2r62_A268 Cell division protease FTSH homolog; ATPase domain 93.4
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 93.39
2ged_A193 SR-beta, signal recognition particle receptor beta 93.37
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 93.33
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.32
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 93.32
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 93.32
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 93.31
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 93.31
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 93.31
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 93.24
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 93.23
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 93.23
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 93.23
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.22
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 93.21
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 93.2
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.18
3lxx_A239 GTPase IMAP family member 4; structural genomics c 93.17
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.17
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.13
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.12
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 93.12
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 93.12
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.11
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 93.09
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 93.08
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 93.07
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 93.06
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 93.06
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.05
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 93.03
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 93.02
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 93.01
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 92.97
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 92.95
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.95
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 92.94
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 92.92
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 92.9
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 92.88
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 92.87
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 92.85
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 92.83
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 92.82
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 92.82
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 92.81
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 92.81
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 92.8
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 92.78
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 92.71
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 92.71
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 92.69
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 92.68
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 92.68
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 92.67
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 92.66
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 92.65
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.64
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 92.62
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 92.59
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 92.59
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 92.58
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 92.55
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 92.53
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 92.51
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 92.49
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 92.47
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.45
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 92.45
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 92.42
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 92.39
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 92.36
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 92.36
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 92.34
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 92.32
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 92.32
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 92.32
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 92.27
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 92.27
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.27
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 92.25
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 92.25
3t1o_A198 Gliding protein MGLA; G domain containing protein, 92.24
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 92.23
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 92.22
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 92.22
2r44_A 331 Uncharacterized protein; putative ATPase, structur 92.2
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 92.19
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 92.19
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 92.17
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 92.13
2qgz_A308 Helicase loader, putative primosome component; str 92.11
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 92.11
1nrj_B218 SR-beta, signal recognition particle receptor beta 92.08
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 92.06
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 92.06
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 92.03
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 92.02
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 92.0
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 91.99
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 91.98
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 91.96
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 91.92
2fh5_B214 SR-beta, signal recognition particle receptor beta 91.92
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 91.9
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 91.88
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 91.88
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 91.88
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 91.85
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 91.85
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 91.81
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 91.79
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 91.74
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 91.72
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 91.7
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 91.68
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 91.68
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 91.67
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 91.67
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 91.65
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 91.63
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 91.58
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 91.56
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 91.55
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 91.52
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 91.52
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 91.52
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 91.51
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 91.51
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 91.5
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 91.47
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.43
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 91.4
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 91.39
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 91.39
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 91.37
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 91.35
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 91.31
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 91.3
2fna_A 357 Conserved hypothetical protein; structural genomic 91.27
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 91.26
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 91.23
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 91.21
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 91.2
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 91.18
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 91.16
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 91.15
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 91.11
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 91.03
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 91.03
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 90.94
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 90.94
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 90.88
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 90.81
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 90.78
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 90.76
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 90.76
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 90.73
3co5_A143 Putative two-component system transcriptional RES 90.73
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 90.68
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 90.65
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 90.65
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 90.64
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 90.56
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 90.52
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 90.51
3llu_A196 RAS-related GTP-binding protein C; structural geno 90.5
2hf9_A226 Probable hydrogenase nickel incorporation protein 90.47
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 90.4
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 90.38
1e69_A 322 Chromosome segregation SMC protein; structural mai 90.38
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 90.29
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 90.25
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 90.21
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 90.14
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 90.11
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 90.06
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 90.04
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 90.02
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.02
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 89.99
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 89.95
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 89.91
1xjc_A169 MOBB protein homolog; structural genomics, midwest 89.85
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 89.85
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 89.76
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 89.76
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 89.73
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 89.71
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 89.68
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 89.63
1tue_A212 Replication protein E1; helicase, replication, E1E 89.57
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 89.54
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 89.53
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 89.53
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 89.52
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 89.44
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 89.34
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 89.33
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 89.21
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 89.04
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 89.04
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 88.86
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 88.82
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 88.79
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 88.67
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
Probab=100.00  E-value=5.6e-87  Score=689.70  Aligned_cols=344  Identities=53%  Similarity=0.909  Sum_probs=329.8

Q ss_pred             eEeEEEEEECcEEEEeecCCCccccEEEEcCCcEEEEEEEEeCCEEEEEEecCCCCCCCCCeEEEcCCceEEecCccccc
Q 017581           20 EYGYVRKVSGPVVIADGMNGAAMYELVRVGHDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILG   99 (369)
Q Consensus        20 ~~G~V~~I~G~ii~v~gl~~~~igE~v~i~~~~~~geVi~i~~d~v~l~~~~~t~Gi~~G~~V~~tg~~l~VpvG~~LLG   99 (369)
                      ..|+|++|.|++++++|+.++++||+|+|.++.+.|||+++++|.+.+|+|++++||++|++|++||++++||||++|||
T Consensus         9 ~~G~V~~V~G~vv~v~g~~~~~~gE~v~v~~~~l~gEVi~~~~d~a~i~v~e~t~Gl~~G~~V~~tG~~lsV~vG~~lLG   88 (600)
T 3vr4_A            9 QIGKIIKVSGPLVMAENMSEASIQDMCLVGDLGVIGEIIEMRQDVASIQVYEETSGIGPGEPVRSTGEALSVELGPGIIS   88 (600)
T ss_dssp             CCEEEEEEETTEEEEESCTTSCTTCEEEETTTTEEEEEEEEETTEEEEEESSCCTTCCTTCEEEECSSSSEEEESTTCTT
T ss_pred             cceEEEEEECcEEEEEcCCCCccCCEEEECCCcEEEEEEEEcCCcEEEEEccCCCCCCCCCEEEECCCCCEEEeCHHHHh
Confidence            36999999999999999988999999999766799999999999999999999999999999999999999999999999


Q ss_pred             eeecccCcccccccccCCcccccCCCCCCCCCcCcccccccccccCCccccCCcceeeeeecccccccccCCCCCCCceE
Q 017581          100 NIFDGIQRPLKTIAIRSGDVYIPRGVSVPALDKDTLWEFQPKKIGEGDLLTGGDLYATVFENSLMQHHVALPPDAMGKVT  179 (369)
Q Consensus       100 RVlDglG~PLDg~~~~~~~~~~~~g~~~~~~~~~~~~~f~p~~~~~g~~v~~g~i~g~~~e~~~~~~~i~~~~~~~~~v~  179 (369)
                      ||||++|+|||+.++..|+.|++||+++++++.+++|+|.|. +++||.|.+|||+|+|+|+.++.|+||+||+..|+|+
T Consensus        89 rV~DglGrPlD~~~~~~g~~~~~~g~~~~~l~~~~~w~f~p~-~~~Gd~v~~g~i~g~v~e~~~i~h~im~pp~~~g~v~  167 (600)
T 3vr4_A           89 QMFDGIQRPLDTFMEVTQSNFLGRGVQLPALDHEKQWWFEAT-IEEGTEVSAGDIIGYVDETKIIQHKIMVPNGIKGTVQ  167 (600)
T ss_dssp             CEECTTCCBHHHHHHHHCSSBCCTTCCCCSSCSSCCEEEEEC-SCTTCEECTTCEEEEEECSSSCEEEEECCTTCCEEEE
T ss_pred             hhhCcCCCcccccccccCccccccCCcCCCCCcccccccCcc-cccCCEecCCceEEEEecCCceeeeeecCCCCCceEE
Confidence            999999999999877777789999999999999999999997 9999999999999999999999999999999999999


Q ss_pred             EeccCCcccccceEEEEEee-cceeeeeeccceeccCCCCccccccccceeccCceeeeccccccCCCeEeecCCCCCCh
Q 017581          180 YVAPAGQYSLKDTVLELEFQ-GVKKSFTMLQAWPVRTPRPVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGK  258 (369)
Q Consensus       180 ~~~~~g~~~~~~~v~~~~~~-~~~~~~~m~~~~pv~~~~~~~~r~~~~~~l~TGi~aID~l~pi~~GQr~~Ifg~sG~GK  258 (369)
                      || ++|+|+++++|+++++. |. ++++|.|+||++.++|+++|.++++||.||||+||+|+||+||||++|||++|+||
T Consensus       168 ~i-~~g~~~v~~~v~~i~~~~g~-~~i~~~~~wpv~~~~p~~~R~~~~epl~TGirvID~l~PigrGqr~~Ifgg~g~GK  245 (600)
T 3vr4_A          168 KI-ESGSFTIDDPICVIETEQGL-KELTMMQKWPVRRGRPIKQKLNPDVPMITGQRVIDTFFPVTKGGAAAVPGPFGAGK  245 (600)
T ss_dssp             EE-CCEEECTTSCCEEEEETTEE-EEECSCEEEETTSCCCCSEEECCCSBCCCCCHHHHHHSCCBTTCEEEEECCTTSCH
T ss_pred             Ee-cCCcceeceeEEEEeccCCc-ccccccccccccCCCchhhccCCCceecccchhhhccCCccCCCEEeeecCCCccH
Confidence            99 99999999999999864 66 89999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcCCCeEEEEeecccchhhhHHhhhcccccccCCCCCcCCCcceeEEEEeCCCCCHHhHhhhhHHHHHHHH
Q 017581          259 TVISQALSKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAE  338 (369)
Q Consensus       259 stLl~~ia~~~~~d~vV~~~iGer~~ev~~~~~~f~~~~~~~~~~~~~~~l~~t~vv~~t~~~~~~~r~~a~~~a~tiAE  338 (369)
                      |+|+.+|++++++|+|||++||||++|+++|+++|+++++|.   .+.++|+||++|+||+|+|+.+|++++++|+|+||
T Consensus       246 T~L~~~ia~~~~~~v~V~~~iGER~~Ev~e~~~~~~el~d~~---~G~~~m~rtvvV~~tsd~p~~~R~~~~~~altiAE  322 (600)
T 3vr4_A          246 TVVQHQIAKWSDVDLVVYVGCGERGNEMTDVVNEFPELIDPN---TGESLMERTVLIANTSNMPVAAREASIYTGITIAE  322 (600)
T ss_dssp             HHHHHHHHHHSSCSEEEEEEEEECHHHHHHHHHHTTTCBCTT---TCSBGGGGEEEEEEETTSCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhccCCCEEEEEEecccHHHHHHHHHHHHhhcccc---cccccccceEEEEECCCCCHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999997766554   45678999999999999999999999999999999


Q ss_pred             HHHHCCCcEEEEecchHHHHHHHHHHhhccC
Q 017581          339 YFRDMGYNVSMMADSTSRWAEALREISGRLG  369 (369)
Q Consensus       339 yfr~~G~~VLli~Dsltr~A~A~rEiS~~lg  369 (369)
                      ||||+|+||||++||+||||+|+||||++||
T Consensus       323 yfrd~G~dVLl~~Ds~tR~A~A~rEiS~~lg  353 (600)
T 3vr4_A          323 YFRDMGYDVAIMADSTSRWAEALREMSGRLE  353 (600)
T ss_dssp             HHHTTTCEEEEEEECHHHHHHHHHHHHHHTT
T ss_pred             HHHHcCCCEEEEecchHHHHHHHHHHHhccC
Confidence            9999999999999999999999999999987
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 369
d2jdid3276 c.37.1.11 (D:82-357) Central domain of beta subuni 8e-45
d2jdia3285 c.37.1.11 (A:95-379) Central domain of alpha subun 7e-41
d1fx0a3276 c.37.1.11 (A:97-372) Central domain of alpha subun 6e-30
d1xpua3 289 c.37.1.11 (A:129-417) Transcription termination fa 3e-26
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of beta subunit of F1 ATP synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  153 bits (388), Expect = 8e-45
 Identities = 48/166 (28%), Positives = 71/166 (42%), Gaps = 9/166 (5%)

Query: 209 QAWPVRTPRP-VSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQAL-- 265
           Q   +    P           L+TG +V+D L P   GG   + G  G GKTV+   L  
Sbjct: 31  QFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELIN 90

Query: 266 -SKYSNSDTVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVA 324
               ++    V+ G GER  E  ++  +  +          +    +  LV    N P  
Sbjct: 91  NVAKAHGGYSVFAGVGERTREGNDLYHEMIESG----VINLKDATSKVALVYGQMNEPPG 146

Query: 325 AREASIYTGITIAEYFRDM-GYNVSMMADSTSRWAEALREISGRLG 369
           AR     TG+T+AEYFRD  G +V +  D+  R+ +A  E+S  LG
Sbjct: 147 ARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLG 192
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query369
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 100.0
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 100.0
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 100.0
d1xpua3 289 Transcription termination factor Rho, ATPase domai 100.0
d1skyb275 F1 ATP synthase alpha subunit, domain 1 {Bacillus 99.29
d2jdia271 F1 ATP synthase alpha subunit, domain 1 {Cow (Bos 99.2
d1fx0a272 F1 ATP synthase alpha subunit, domain 1 {Spinach ( 99.14
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.03
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 98.86
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.83
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.73
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.69
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.65
d2jdid272 F1 ATP synthase beta subunit, domain 1 {Rat (Rattu 98.59
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 98.5
d1fx0b279 F1 ATP synthase beta subunit, domain 1 {Spinach (S 98.42
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 98.42
d1skye282 F1 ATP synthase beta subunit, domain 1 {Bacillus s 98.4
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 98.08
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.98
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.98
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.97
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.96
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.96
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.94
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.87
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.87
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.87
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.82
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.78
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 97.76
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.75
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.68
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 97.66
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.62
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.52
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 97.51
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 97.36
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 97.34
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 97.3
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.98
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 96.63
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.61
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.44
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.31
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.23
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.2
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.11
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.02
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.97
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.97
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 95.96
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.95
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.83
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.79
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.78
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.72
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 95.63
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.62
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.59
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.53
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.52
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.34
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.3
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.29
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.22
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.22
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.22
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.15
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.14
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.11
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.09
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.06
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.04
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.01
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.98
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.98
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.97
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.95
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.9
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.82
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.81
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.78
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.75
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.71
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.67
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.66
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.66
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.63
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.56
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.55
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.55
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.53
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.45
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.44
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.42
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.42
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.41
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.39
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.38
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.38
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.36
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.34
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.25
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 94.2
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.17
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.11
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 94.1
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.07
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.07
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.06
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 94.04
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 94.04
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.02
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.0
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.99
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.98
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.91
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.82
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.82
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.81
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 93.81
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.8
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.77
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 93.71
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 93.67
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.65
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 93.62
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.62
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.57
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.54
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.51
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 93.5
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.47
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.42
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 93.4
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.31
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 93.26
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 93.26
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.24
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.23
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 93.14
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.12
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.12
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 93.1
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 93.09
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.09
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 93.07
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 93.01
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.97
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 92.95
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.94
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.94
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.82
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.81
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.77
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 92.76
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.76
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.74
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.7
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.68
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.67
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.55
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.42
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.38
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.3
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.13
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 92.11
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 92.09
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.07
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 91.91
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.91
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.87
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.77
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.74
d1svma_362 Papillomavirus large T antigen helicase domain {Si 91.62
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.55
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.5
d2fh5b1207 Signal recognition particle receptor beta-subunit 91.44
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 91.43
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 91.38
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.38
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.32
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 90.92
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.89
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.87
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 90.52
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.34
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.26
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.23
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.21
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.09
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.99
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 89.98
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.81
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.81
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 89.4
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 89.02
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 88.85
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 88.84
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 88.56
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 88.45
d1vmaa2213 GTPase domain of the signal recognition particle r 88.21
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.13
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.12
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.1
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 88.0
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 87.76
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 87.76
d1okkd2207 GTPase domain of the signal recognition particle r 87.22
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 87.06
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.7
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 86.29
d2qy9a2211 GTPase domain of the signal recognition particle r 86.12
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 85.47
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 84.54
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 84.22
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 84.19
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.16
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 83.74
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 83.17
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 82.52
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 81.96
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 81.76
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 81.61
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 81.39
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 81.19
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 81.07
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 80.75
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 80.71
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 80.6
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 80.43
d1ls1a2207 GTPase domain of the signal sequence recognition p 80.28
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of beta subunit of F1 ATP synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=7.9e-53  Score=401.42  Aligned_cols=157  Identities=30%  Similarity=0.431  Sum_probs=141.1

Q ss_pred             cceeccCCC-CccccccccceeccCceeeeccccccCCCeEeecCCCCCChHHHHHHHHhh---cCCCeEEEEeecccch
Q 017581          209 QAWPVRTPR-PVSSKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQALSKY---SNSDTVVYVGCGERGN  284 (369)
Q Consensus       209 ~~~pv~~~~-~~~~r~~~~~~l~TGi~aID~l~pi~~GQr~~Ifg~sG~GKstLl~~ia~~---~~~d~vV~~~iGer~~  284 (369)
                      ++||++.++ ++++|.+++++|.||||+||+|+||+||||++|||++|+|||+|+.+|+++   .++|++||++||||++
T Consensus        31 ~~~~i~~~~p~~~~R~~i~~~l~TGIraID~l~pigkGQr~~If~~~g~GKt~l~~~i~~~~~~~~~~v~V~~~iGer~~  110 (276)
T d2jdid3          31 QFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTR  110 (276)
T ss_dssp             CEEESCCCCCCGGGCCCCCCEECCSCHHHHHHSCEETTCEEEEEECTTSSHHHHHHHHHHHHTTTCSSEEEEEEESCCHH
T ss_pred             ccccccCCCCChhHhcCCCcccccCceeeeeeccccCCCEEEeeCCCCCCHHHHHHHHHHHHHhhCCCeEEEEEeccChH
Confidence            567887555 489999999999999999999999999999999999999999999999876   3568999999999999


Q ss_pred             hhhHHhhhcccccccCCCCCcCCCcceeEEEEeCCCCCHHhHhhhhHHHHHHHHHHHH-CCCcEEEEecchHHHHHHHHH
Q 017581          285 EMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRD-MGYNVSMMADSTSRWAEALRE  363 (369)
Q Consensus       285 ev~~~~~~f~~~~~~~~~~~~~~~l~~t~vv~~t~~~~~~~r~~a~~~a~tiAEyfr~-~G~~VLli~Dsltr~A~A~rE  363 (369)
                      |+.+|+++|.+....    .....++|+++|+|++++|+.+|+++|++|+++|||||+ +|+|||+++|||||||+||||
T Consensus       111 ev~~~~~~~~~~~~~----~~~~~~~~tvvv~~~s~~~~~~r~~~~~~a~~iAEyf~~~~G~~VLv~~Dsltr~A~A~re  186 (276)
T d2jdid3         111 EGNDLYHEMIESGVI----NLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSE  186 (276)
T ss_dssp             HHHHHHHHHHHHTSS----CSSSSCCCEEEEEECTTSCHHHHHHHHHHHHHHHHHHHHTTCSCEEEEEECTHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCcc----ccccccceEEEEEECCCCCHHHHHHHHHHHHHHHHHHHhcCCCeEEEEEcchhHHHHHHHH
Confidence            999999998442210    124568899999999999999999999999999999996 599999999999999999999


Q ss_pred             HhhccC
Q 017581          364 ISGRLG  369 (369)
Q Consensus       364 iS~~lg  369 (369)
                      +|.+||
T Consensus       187 is~~~g  192 (276)
T d2jdid3         187 VSALLG  192 (276)
T ss_dssp             HHGGGT
T ss_pred             HHHhcC
Confidence            999987
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure