Citrus Sinensis ID: 017647
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 368 | ||||||
| 449468934 | 505 | PREDICTED: chaperone protein DnaJ-like [ | 0.915 | 0.667 | 0.820 | 1e-158 | |
| 255553237 | 511 | chaperone protein DNAj, putative [Ricinu | 0.904 | 0.651 | 0.830 | 1e-158 | |
| 356554947 | 489 | PREDICTED: chaperone protein DnaJ-like i | 0.961 | 0.723 | 0.771 | 1e-157 | |
| 356554945 | 493 | PREDICTED: chaperone protein DnaJ-like i | 0.961 | 0.718 | 0.771 | 1e-157 | |
| 357455281 | 496 | Chaperone protein dnaJ [Medicago truncat | 0.923 | 0.685 | 0.794 | 1e-156 | |
| 224134931 | 492 | predicted protein [Populus trichocarpa] | 0.801 | 0.599 | 0.901 | 1e-155 | |
| 1707657 | 498 | DnaJ homologue [Pisum sativum] | 0.942 | 0.696 | 0.772 | 1e-154 | |
| 359482375 | 489 | PREDICTED: chaperone protein DnaJ-like [ | 0.796 | 0.599 | 0.866 | 1e-151 | |
| 297839937 | 492 | hypothetical protein ARALYDRAFT_895995 [ | 0.902 | 0.674 | 0.751 | 1e-146 | |
| 18412605 | 500 | molecular chaperone Hsp40/DnaJ-like prot | 0.907 | 0.668 | 0.742 | 1e-146 |
| >gi|449468934|ref|XP_004152176.1| PREDICTED: chaperone protein DnaJ-like [Cucumis sativus] gi|449522377|ref|XP_004168203.1| PREDICTED: chaperone protein DnaJ-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 565 bits (1455), Expect = e-158, Method: Compositional matrix adjust.
Identities = 278/339 (82%), Positives = 303/339 (89%), Gaps = 2/339 (0%)
Query: 29 GGTHLRSHKNFAALTLSADSCPFGGSKLNSSNARSSTYRFGRSVVCASGDYYATLGVPKS 88
GGT LR HKNF ++ + + + SS R G VVCASGDYYATLG+PKS
Sbjct: 33 GGTQLRFHKNFLSVHSYSFNSSPSSPNSRFNKRVSSRRRLGL-VVCASGDYYATLGIPKS 91
Query: 89 ASGKEIKAAYRKLARQYHPDVNKEPGATEKFKEISAAYEVLSDDKKRAMYDQYGEAGVKS 148
A+ KEIKAAYRKLARQYHPDVNKEPGATEKFKEISAAYEVLSDDKKRA+YDQYGEAGVKS
Sbjct: 92 ANSKEIKAAYRKLARQYHPDVNKEPGATEKFKEISAAYEVLSDDKKRALYDQYGEAGVKS 151
Query: 149 TVGGGSSAYTTNPFDLFETFFGPSMGGFPGMNQTGFRTRRRSTVTKGEDLRYDIVLEFSE 208
TVGG SSAYTTNPFDLFETFFGPSMGGF GM+ TGFRTRR ST+TKGED+RYDI L SE
Sbjct: 152 TVGG-SSAYTTNPFDLFETFFGPSMGGFGGMDPTGFRTRRSSTLTKGEDIRYDINLGSSE 210
Query: 209 SIFGAEKEFELSHLETCEVCTGTGAKMGSKMRICSTCGGRGQVMRTDQTPFGLFSQVSVC 268
+IFG+EKEFELSHLETCEVCTGTG+K+GSKMRICSTCGGRGQVMRT+QTPFGLFSQVSVC
Sbjct: 211 AIFGSEKEFELSHLETCEVCTGTGSKVGSKMRICSTCGGRGQVMRTEQTPFGLFSQVSVC 270
Query: 269 PSCGGEGEVISEYCRKCSGEGRIRLKKNIKVKVPPGVSTGSILRVVGEGDAGPRGGPPGD 328
P+CGG GEVIS++CRKCSGEGRIR+KKNIKVKVPPGVS GSILRV GEGDAGPRGGPPGD
Sbjct: 271 PNCGGNGEVISDFCRKCSGEGRIRVKKNIKVKVPPGVSAGSILRVAGEGDAGPRGGPPGD 330
Query: 329 LYVYLDVEEIPGIQRDGIDLFSTISISYLDAIMGTVVKV 367
L+VYLDVEEIPGIQRDGI+L+STI+ISYLDAIMG+VVKV
Sbjct: 331 LFVYLDVEEIPGIQRDGINLYSTIAISYLDAIMGSVVKV 369
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255553237|ref|XP_002517661.1| chaperone protein DNAj, putative [Ricinus communis] gi|223543293|gb|EEF44825.1| chaperone protein DNAj, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356554947|ref|XP_003545802.1| PREDICTED: chaperone protein DnaJ-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356554945|ref|XP_003545801.1| PREDICTED: chaperone protein DnaJ-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357455281|ref|XP_003597921.1| Chaperone protein dnaJ [Medicago truncatula] gi|355486969|gb|AES68172.1| Chaperone protein dnaJ [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224134931|ref|XP_002327525.1| predicted protein [Populus trichocarpa] gi|222836079|gb|EEE74500.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|1707657|emb|CAA96305.1| DnaJ homologue [Pisum sativum] | Back alignment and taxonomy information |
|---|
| >gi|359482375|ref|XP_002265060.2| PREDICTED: chaperone protein DnaJ-like [Vitis vinifera] gi|297743480|emb|CBI36347.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297839937|ref|XP_002887850.1| hypothetical protein ARALYDRAFT_895995 [Arabidopsis lyrata subsp. lyrata] gi|297333691|gb|EFH64109.1| hypothetical protein ARALYDRAFT_895995 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18412605|ref|NP_565227.1| molecular chaperone Hsp40/DnaJ-like protein [Arabidopsis thaliana] gi|30699481|ref|NP_849910.1| molecular chaperone Hsp40/DnaJ-like protein [Arabidopsis thaliana] gi|30699483|ref|NP_849911.1| molecular chaperone Hsp40/DnaJ-like protein [Arabidopsis thaliana] gi|110739057|dbj|BAF01446.1| hypothetical protein [Arabidopsis thaliana] gi|332198224|gb|AEE36345.1| molecular chaperone Hsp40/DnaJ-like protein [Arabidopsis thaliana] gi|332198225|gb|AEE36346.1| molecular chaperone Hsp40/DnaJ-like protein [Arabidopsis thaliana] gi|332198226|gb|AEE36347.1| molecular chaperone Hsp40/DnaJ-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 368 | ||||||
| TAIR|locus:2016234 | 500 | AT1G80030 [Arabidopsis thalian | 0.896 | 0.66 | 0.693 | 6.7e-120 | |
| TAIR|locus:2140035 | 447 | AT4G39960 [Arabidopsis thalian | 0.855 | 0.704 | 0.478 | 1.2e-72 | |
| TAIR|locus:2041258 | 442 | AT2G22360 [Arabidopsis thalian | 0.847 | 0.705 | 0.479 | 3.2e-72 | |
| TAIR|locus:2088585 | 517 | AT3G17830 [Arabidopsis thalian | 0.820 | 0.584 | 0.445 | 1.3e-70 | |
| TIGR_CMR|BA_4538 | 371 | BA_4538 "chaperone protein dna | 0.769 | 0.762 | 0.395 | 2.1e-52 | |
| TIGR_CMR|CHY_0416 | 381 | CHY_0416 "chaperone protein dn | 0.779 | 0.753 | 0.404 | 4.4e-52 | |
| TIGR_CMR|DET_1398 | 356 | DET_1398 "co-chaperone protein | 0.760 | 0.786 | 0.375 | 1.9e-51 | |
| TIGR_CMR|GSU_0034 | 373 | GSU_0034 "chaperone protein dn | 0.75 | 0.739 | 0.427 | 8.3e-51 | |
| UNIPROTKB|P95830 | 378 | dnaJ "Chaperone protein DnaJ" | 0.769 | 0.748 | 0.375 | 2.2e-50 | |
| UNIPROTKB|P08622 | 376 | dnaJ [Escherichia coli K-12 (t | 0.758 | 0.742 | 0.386 | 3.2e-49 |
| TAIR|locus:2016234 AT1G80030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1180 (420.4 bits), Expect = 6.7e-120, P = 6.7e-120
Identities = 233/336 (69%), Positives = 268/336 (79%)
Query: 38 NFAALTLSADSCPFGGS--KLNSSNARSSTYRF--GRSVV--CASGDYYATLGVPKSASG 91
NF+A + + + S L+SS++ S+ YR GRS+V SGDYYATLGV KSA+
Sbjct: 29 NFSAFSDGGSNFRYHKSFLSLSSSSSSSTPYRNRRGRSLVVFATSGDYYATLGVSKSANN 88
Query: 92 KEIKAAYRKLARQYHPDVNKEPGATEKFKEISAAYEVLSDDKKRAMYDQYGEAGVKSTVG 151
KEIKAAYR+LARQYHPDVNKEPGATEKFKEISAAYEVLSD++KRA+YDQYGEAGVKSTVG
Sbjct: 89 KEIKAAYRRLARQYHPDVNKEPGATEKFKEISAAYEVLSDEQKRALYDQYGEAGVKSTVG 148
Query: 152 GGSSAYTTNPFDLFETXXXXXXXXXXXXNQTGFRTRRRSTVTKGEDLRYDIVLEFSESIF 211
G S YT+NPFDLFET +Q F RRS VTKGEDLRYDI LE SE+IF
Sbjct: 149 GASGPYTSNPFDLFETFFGASMGGFPGMDQADFGRTRRSRVTKGEDLRYDITLELSEAIF 208
Query: 212 GAEKEFELSHLETCEVCTGTGAKMGSKMRICSTCGGRGQVMRTDQTPFGLFSQVSVCPSC 271
G+EKEF+L+HLETCE C GTGAK GSKMRICSTCGGRGQVMRT+QTPFG+FSQVS+CP+C
Sbjct: 209 GSEKEFDLTHLETCEACAGTGAKAGSKMRICSTCGGRGQVMRTEQTPFGMFSQVSICPNC 268
Query: 272 GGEGEVISEYCRKCSGEGRIRLKKNIKVKVPPGVSTGSILRVVXXXXXXXXXXXXXDLYV 331
GG+GEVISE CRKCSGEGR+R+KK+IKVK+PPGVS GSILRV DLYV
Sbjct: 269 GGDGEVISENCRKCSGEGRVRIKKSIKVKIPPGVSAGSILRVAGEGDSGPRGGPPGDLYV 328
Query: 332 YLDVEEIPGIQRDGIDLFSTISISYLDAIMGTVVKV 367
YLDVE++ GI+RDGI+L ST+SISYLDAI+G VVKV
Sbjct: 329 YLDVEDVRGIERDGINLLSTLSISYLDAILGAVVKV 364
|
|
| TAIR|locus:2140035 AT4G39960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2041258 AT2G22360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2088585 AT3G17830 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4538 BA_4538 "chaperone protein dnaJ" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0416 CHY_0416 "chaperone protein dnaJ" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1398 DET_1398 "co-chaperone protein DnaJ" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0034 GSU_0034 "chaperone protein dnaJ" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P95830 dnaJ "Chaperone protein DnaJ" [Streptococcus pneumoniae TIGR4 (taxid:170187)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08622 dnaJ [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 368 | |||
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 1e-143 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 1e-140 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 1e-119 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 1e-113 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 3e-97 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 1e-96 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 7e-91 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 7e-90 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 6e-89 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 1e-88 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 3e-88 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 3e-87 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 2e-83 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 2e-82 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 7e-81 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 1e-80 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 3e-79 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 2e-78 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 1e-76 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 3e-74 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 6e-73 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 8e-72 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 9e-70 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 2e-66 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 8e-65 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 7e-59 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 1e-57 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 6e-47 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 1e-44 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 1e-35 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 7e-34 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 7e-33 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 7e-29 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 2e-27 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 8e-27 | |
| cd10719 | 65 | cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H | 2e-25 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 4e-25 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 3e-22 | |
| pfam00684 | 65 | pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | 1e-19 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 4e-12 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 1e-11 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-11 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 8e-11 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 6e-07 | |
| pfam01556 | 81 | pfam01556, DnaJ_C, DnaJ C terminal domain | 3e-06 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 1e-05 | |
| TIGR00714 | 155 | TIGR00714, hscB, Fe-S protein assembly co-chaperon | 1e-05 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 7e-05 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 3e-04 | |
| PHA03102 | 153 | PHA03102, PHA03102, Small T antigen; Reviewed | 3e-04 | |
| PHA02624 | 647 | PHA02624, PHA02624, large T antigen; Provisional | 6e-04 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 0.001 | |
| COG1107 | 715 | COG1107, COG1107, Archaea-specific RecJ-like exonu | 0.003 |
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
Score = 410 bits (1056), Expect = e-143
Identities = 152/293 (51%), Positives = 187/293 (63%), Gaps = 8/293 (2%)
Query: 78 DYYATLGVPKSASGKEIKAAYRKLARQYHPDVNKEPGATEKFKEISAAYEVLSDDKKRAM 137
DYY LGV K AS +EIK AYRKLA++YHPD NK+ A EKFKEI+ AYEVLSD +KRA
Sbjct: 1 DYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNKDKEAEEKFKEINEAYEVLSDPEKRAQ 60
Query: 138 YDQYGEAGVKSTVGGGSSAY---TTNPFDLFETFFGPSMGGFPGMNQTGFRTRRRSTVTK 194
YDQ+G AG GGG + F F FG GG G RRRS +
Sbjct: 61 YDQFGHAGFNGGGGGGGGGFNGFDIGFFGDFGDIFGDFFGGGGG-----SGRRRRSGPRR 115
Query: 195 GEDLRYDIVLEFSESIFGAEKEFELSHLETCEVCTGTGAKMGSKMRICSTCGGRGQVMRT 254
GEDLRYD+ L F E++FG EKE E+ E+CE C GTGAK G+ + C TCGG GQV R
Sbjct: 116 GEDLRYDLELTFEEAVFGVEKEIEIPRKESCETCHGTGAKPGTDPKTCPTCGGTGQVRRQ 175
Query: 255 DQTPFGLFSQVSVCPSCGGEGEVISEYCRKCSGEGRIRLKKNIKVKVPPGVSTGSILRVV 314
TPFG F Q CP+CGGEG++I E C C G+GR++ +K I VK+P GV TG LRV
Sbjct: 176 QGTPFGFFQQQQTCPTCGGEGKIIKEPCSTCKGKGRVKERKTITVKIPAGVDTGQRLRVS 235
Query: 315 GEGDAGPRGGPPGDLYVYLDVEEIPGIQRDGIDLFSTISISYLDAIMGTVVKV 367
G+G+AG GGP GDLYV + V+ +RDG DL+ + IS+ AI+G ++V
Sbjct: 236 GKGNAGENGGPNGDLYVVIRVKPHKIFERDGNDLYIEVPISFTQAILGGEIEV 288
|
This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family. Length = 354 |
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 368 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 100.0 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 100.0 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 100.0 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 100.0 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 100.0 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.97 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.83 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.8 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.77 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.76 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.75 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.73 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.71 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.69 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.68 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.67 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.67 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.64 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.64 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.64 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.62 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.58 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.57 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.57 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.56 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.54 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.53 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.53 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.52 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.51 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.51 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.5 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.5 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.5 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.5 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.5 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.49 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.49 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 99.47 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.47 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.47 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.46 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.46 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.45 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.44 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.44 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.44 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.44 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.44 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.42 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.41 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.4 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.4 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.38 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.37 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.35 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.25 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.23 | |
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 99.16 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.13 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.01 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.95 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.89 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 98.87 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.86 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.83 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 98.66 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 98.62 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.43 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 98.23 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.16 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.12 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 98.04 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 97.87 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 97.46 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 97.12 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 96.78 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.54 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 96.46 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.45 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 96.28 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 95.91 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 95.47 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 94.97 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 94.26 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 94.13 | |
| PF11833 | 194 | DUF3353: Protein of unknown function (DUF3353); In | 87.16 | |
| COG5552 | 88 | Uncharacterized conserved protein [Function unknow | 85.6 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 85.52 | |
| PF10041 | 78 | DUF2277: Uncharacterized conserved protein (DUF227 | 81.0 | |
| smart00709 | 160 | Zpr1 Duplicated domain in the epidermal growth fac | 80.99 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-77 Score=570.17 Aligned_cols=283 Identities=48% Similarity=0.888 Sum_probs=257.2
Q ss_pred ccccccchhcCCCCCCCHHHHHHHHHHHHHHhCCCCCC-CcchHHHHHHHHHHHhhccchhhhhhhccccccCcccccCC
Q 017647 74 CASGDYYATLGVPKSASGKEIKAAYRKLARQYHPDVNK-EPGATEKFKEISAAYEVLSDDKKRAMYDQYGEAGVKSTVGG 152 (368)
Q Consensus 74 ~~~~d~y~iLgv~~~a~~~eIk~ayr~l~~~~hPD~~~-~~~~~~~f~~i~~Ay~~L~d~~~r~~yd~~g~~g~~~~~~~ 152 (368)
++.+|||+||||+++||++|||+|||+||++||||+|+ +++|+++|++|+|||||||||+||++||+||+++++.+..+
T Consensus 1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g 80 (371)
T COG0484 1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG 80 (371)
T ss_pred CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence 46789999999999999999999999999999999999 78999999999999999999999999999999998733222
Q ss_pred C--CCCCcCCCccccccccCCCCCCCCCCCCCCCCCccCcccccCcceEEEEeeecccccccceeeEeecceeecccccC
Q 017647 153 G--SSAYTTNPFDLFETFFGPSMGGFPGMNQTGFRTRRRSTVTKGEDLRYDIVLEFSESIFGAEKEFELSHLETCEVCTG 230 (368)
Q Consensus 153 ~--~~~~~~~~~d~F~~fFg~~~g~~~g~~~~~~~~~~~~~~~~g~di~~~l~itlee~~~G~~~~~~~~~~~~C~~C~G 230 (368)
+ .+.|..++.|||++|||++.+ +++++..+.++.||.+.|+|+|+||++|+++++.+.+...|..|+|
T Consensus 81 g~g~~~fgg~~~DIF~~~FgGg~~----------~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~G 150 (371)
T COG0484 81 GFGFGGFGGDFGDIFEDFFGGGGG----------GRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHG 150 (371)
T ss_pred CCCcCCCCCCHHHHHHHhhcCCCc----------ccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCC
Confidence 2 222333578899999973211 1223334678999999999999999999999999999999999999
Q ss_pred CccccCceeeeCCCCCCccEEEEeeeCCCcceeeeeeCCCCCCccEEEceeeeeeccceEEEEeeEEEEEeCCCCcCCCE
Q 017647 231 TGAKMGSKMRICSTCGGRGQVMRTDQTPFGLFSQVSVCPSCGGEGEVISEYCRKCSGEGRIRLKKNIKVKVPPGVSTGSI 310 (368)
Q Consensus 231 ~G~~~~~~~~~C~~C~G~G~~~~~~~~~~g~~~~~~~C~~C~G~G~~~~~~C~~C~g~g~v~~~~~l~V~Ip~G~~~G~~ 310 (368)
+|++.+..+.+|++|+|+|.+...+++ |+|+++++|+.|+|+|.+++++|.+|+|.|++.+.++|+|+||+|+.+|++
T Consensus 151 sGak~gt~~~tC~tC~G~G~v~~~~~~--g~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ 228 (371)
T COG0484 151 SGAKPGTDPKTCPTCNGSGQVRTVQRT--GFFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDR 228 (371)
T ss_pred CCCCCCCCCCcCCCCCCcCeEEEEEee--eEEEEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccCCE
Confidence 999999999999999999999887777 889999999999999999999999999999999999999999999999999
Q ss_pred EEEccCCCCCCCCCCCccEEEEEEEEeCCCcccccCceEEEeccCHhhhccCCeEEeC
Q 017647 311 LRVVGEGDAGPRGGPPGDLYVYLDVEEIPGIQRDGIDLFSTISISYLDAIMGTVVKVT 368 (368)
Q Consensus 311 i~l~g~G~~~~~~~~~GDL~v~i~v~~~~~f~r~g~dL~~~~~Isl~eALlG~~v~V~ 368 (368)
|++.|+|+++.+++++|||||+|.|++|+.|.|+|+|||++++|++.+|+||++|+|+
T Consensus 229 ir~~g~G~~g~~Ggp~GDLyv~i~v~~h~~F~R~g~dL~~~~~Is~~~AalG~~i~vp 286 (371)
T COG0484 229 IRLSGEGEAGPNGGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIEVP 286 (371)
T ss_pred EEEecCcccCCCCCCCccEEEEEEeecCCCeEECCCceEeccccCHHHHhcCCEEEEE
Confidence 9999999999988899999999999999999999999999999999999999999885
|
|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >COG5552 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
| >PF10041 DUF2277: Uncharacterized conserved protein (DUF2277); InterPro: IPR018735 Members of this family of hypothetical bacterial proteins have no known function | Back alignment and domain information |
|---|
| >smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 368 | ||||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 1e-20 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 3e-18 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 6e-18 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 1e-17 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 1e-16 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 4e-16 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 6e-16 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 7e-16 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 9e-16 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 1e-15 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 3e-15 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 4e-15 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 7e-15 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 1e-14 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 2e-14 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 2e-14 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 7e-14 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 2e-13 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 2e-13 | ||
| 1exk_A | 79 | Solution Structure Of The Cysteine-Rich Domain Of T | 2e-12 | ||
| 2ctt_A | 104 | Solution Structure Of Zinc Finger Domain From Human | 7e-10 | ||
| 1nlt_A | 248 | The Crystal Structure Of Hsp40 Ydj1 Length = 248 | 1e-08 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 1e-07 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 1e-07 | ||
| 2qsa_A | 109 | Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 | 4e-07 | ||
| 2ctq_A | 112 | Solution Structure Of J-Domain From Human Dnaj Subf | 5e-06 | ||
| 2yua_A | 99 | Solution Structure Of The Dnaj Domain From Human Wi | 5e-06 | ||
| 2l6l_A | 155 | Solution Structure Of Human J-Protein Co-Chaperone, | 5e-05 | ||
| 1wjz_A | 94 | Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P | 1e-04 | ||
| 2ys8_A | 90 | Solution Structure Of The Dnaj-Like Domain From Hum | 6e-04 |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
|
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|1EXK|A Chain A, Solution Structure Of The Cysteine-Rich Domain Of The Escherichia Coli Chaperone Protein Dnaj Length = 79 | Back alignment and structure |
| >pdb|2CTT|A Chain A, Solution Structure Of Zinc Finger Domain From Human Dnaj Subfamily A Menber 3 Length = 104 | Back alignment and structure |
| >pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 | Back alignment and structure |
| >pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 | Back alignment and structure |
| >pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 | Back alignment and structure |
| >pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 | Back alignment and structure |
| >pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 | Back alignment and structure |
| >pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 368 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 2e-77 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 6e-64 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 1e-45 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 3e-45 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-43 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 2e-41 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 4e-41 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 6e-41 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 1e-39 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 1e-39 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 4e-39 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 4e-39 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 4e-39 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 9e-39 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 1e-38 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 2e-38 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 3e-38 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 3e-37 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 4e-37 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 4e-36 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 5e-36 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 6e-36 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 3e-33 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 1e-32 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 2e-32 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 6e-31 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 6e-27 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-23 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 6e-21 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 9e-21 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 1e-20 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 2e-20 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 4e-20 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 1e-17 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 7e-17 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 6e-15 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 6e-15 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 1e-12 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 3e-10 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 5e-09 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 2e-08 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
Score = 240 bits (615), Expect = 2e-77
Identities = 74/295 (25%), Positives = 114/295 (38%), Gaps = 75/295 (25%)
Query: 78 DYYATLGVPKSASGKEIKAAYRKLARQYHPDVNKEPGATEKFKEISAAYEVLSDDKKRAM 137
DYYA LGV + K IK AYR+LAR+YHPDV+KE A KFK+++ A+EVL D+++RA
Sbjct: 29 DYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAE 88
Query: 138 YDQYGEAGVKSTVGGGSSAYTTNPF-----DLFETFFGPSMGGFPGMNQTGFRTRRRSTV 192
YDQ + G + + D+F + FG RRR
Sbjct: 89 YDQLWQHRNDPGFGRQRQTHEQSYSQQDFDDIFSSMFG-----------QQAHQRRRQHA 137
Query: 193 TKGEDLRYDIVLEFSESIFGAEKEFELSHLETCEVCTGTGAKMGSKMRICSTCGGRGQVM 252
+G DL ++ + E++ + + G +
Sbjct: 138 ARGHDLEIEVAVFLEETLAEQTRTISYN-------------------LPVYNVFGMIESE 178
Query: 253 RTDQTPFGLFSQVSVCPSCGGEGEVISEYCRKCSGEGRIRLKKNIKVKVPPGVSTGSILR 312
K + VK+P GV G +R
Sbjct: 179 TP----------------------------------------KTLNVKIPAGVVDGQRIR 198
Query: 313 VVGEGDAGPRGGPPGDLYVYLDVEEIPGIQRDGIDLFSTISISYLDAIMGTVVKV 367
+ G+G G GGP GDL++ + + P G +L + ++ +A +G V V
Sbjct: 199 LKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTV 253
|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 368 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 100.0 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 100.0 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 99.94 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 99.92 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 99.9 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.89 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.88 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.86 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.85 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.84 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.84 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.84 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.84 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.83 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.83 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.83 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 99.83 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.82 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.82 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.81 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.8 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.77 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.77 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.77 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.73 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.72 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.72 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.71 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.7 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.68 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.67 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.66 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.65 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.65 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.63 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.62 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.61 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.58 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 99.54 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 99.48 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 99.29 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 99.24 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 99.0 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 98.99 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.94 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 98.94 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.86 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 98.82 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 97.77 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 97.73 | |
| 3pmq_A | 669 | Decaheme cytochrome C MTRF; greek KEY, C type cyto | 97.63 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 97.3 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.28 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.1 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 96.94 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 90.17 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-48 Score=375.50 Aligned_cols=223 Identities=33% Similarity=0.572 Sum_probs=100.0
Q ss_pred ccccchhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCcchHHHHHHHHHHHhhccchhhhhhhccccccCcccccCCC--
Q 017647 76 SGDYYATLGVPKSASGKEIKAAYRKLARQYHPDVNKEPGATEKFKEISAAYEVLSDDKKRAMYDQYGEAGVKSTVGGG-- 153 (368)
Q Consensus 76 ~~d~y~iLgv~~~a~~~eIk~ayr~l~~~~hPD~~~~~~~~~~f~~i~~Ay~~L~d~~~r~~yd~~g~~g~~~~~~~~-- 153 (368)
..|||+||||+++|+.+|||+|||+||++||||+++++.++++|++|++||++|+||.+|+.||+|+.+....+.+++
T Consensus 27 ~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~~~~ 106 (329)
T 3lz8_A 27 LKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGRQRQ 106 (329)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred ccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCcccccc
Confidence 479999999999999999999999999999999998888999999999999999999999999999544221111100
Q ss_pred --CCCC-cCCCccccccccCCCCCCCCCCCCCCCCCccCcccccCcceEEEEeeecccccccceeeEeecceeecccccC
Q 017647 154 --SSAY-TTNPFDLFETFFGPSMGGFPGMNQTGFRTRRRSTVTKGEDLRYDIVLEFSESIFGAEKEFELSHLETCEVCTG 230 (368)
Q Consensus 154 --~~~~-~~~~~d~F~~fFg~~~g~~~g~~~~~~~~~~~~~~~~g~di~~~l~itlee~~~G~~~~~~~~~~~~C~~C~G 230 (368)
.+.| ..++.|+|++|||+. +. +. ......++.|++++|.|+|+|+|.|+++++.+.+.+.|
T Consensus 107 ~~~~~f~~~~f~diF~~~Fg~~--g~--------~~-~~~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~----- 170 (329)
T 3lz8_A 107 THEQSYSQQDFDDIFSSMFGQQ--AH--------QR-RRQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYN----- 170 (329)
T ss_dssp -----------------------------------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECC-----
T ss_pred cccCCcCCCchhhhhHhhhcCc--CC--------CC-CCCCcCCCCCEEEEEecchhhhhhccceEEEEEEEeec-----
Confidence 0112 123457788777631 00 00 01124578999999999999999999999998764421
Q ss_pred CccccCceeeeCCCCCCccEEEEeeeCCCcceeeeeeCCCCCCccEEEceeeeeeccceEEEEeeEEEEEeCCCCcCCCE
Q 017647 231 TGAKMGSKMRICSTCGGRGQVMRTDQTPFGLFSQVSVCPSCGGEGEVISEYCRKCSGEGRIRLKKNIKVKVPPGVSTGSI 310 (368)
Q Consensus 231 ~G~~~~~~~~~C~~C~G~G~~~~~~~~~~g~~~~~~~C~~C~G~G~~~~~~C~~C~g~g~v~~~~~l~V~Ip~G~~~G~~ 310 (368)
|.|.+. +...++++|+||||+++|++
T Consensus 171 ----------------g~G~v~--------------------------------------~~~~~~l~V~IP~Gv~~G~~ 196 (329)
T 3lz8_A 171 ----------------VFGMIE--------------------------------------SETPKTLNVKIPAGVVDGQR 196 (329)
T ss_dssp ----------------SCC-CC--------------------------------------EEEEEEEEEEECTTCCTTCE
T ss_pred ----------------CCeEEE--------------------------------------EecceEEEEeCCCCCCCCCE
Confidence 122211 12246899999999999999
Q ss_pred EEEccCCCCCCCCCCCccEEEEEEEEeCCCcccccCceEEEeccCHhhhccCCeEEeC
Q 017647 311 LRVVGEGDAGPRGGPPGDLYVYLDVEEIPGIQRDGIDLFSTISISYLDAIMGTVVKVT 368 (368)
Q Consensus 311 i~l~g~G~~~~~~~~~GDL~v~i~v~~~~~f~r~g~dL~~~~~Isl~eALlG~~v~V~ 368 (368)
|+|+|+|++++.++.+|||||+|+|++|+.|+|+|+||+++++|+|+|||||++|+|+
T Consensus 197 Irl~G~G~~g~~gg~~GDL~v~I~v~~h~~F~R~G~DL~~~~~Isl~eAllG~~v~Vp 254 (329)
T 3lz8_A 197 IRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTVP 254 (329)
T ss_dssp EEESSCSCCC---CCCCCEEEEECCCCCSSCEEETTEEEEEEEECHHHHHHCEEEEEC
T ss_pred EEEcccccCCCCCCCCCcEEEEEEEecCCccEEcCCcEEEEEECCHHHHcCCCeEEEE
Confidence 9999999998777889999999999999999999999999999999999999999986
|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 368 | ||||
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 2e-25 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 9e-24 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 2e-20 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 2e-20 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 7e-20 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 8e-20 | |
| d1exka_ | 79 | g.54.1.1 (A:) Cysteine-rich domain of the chaperon | 6e-19 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 1e-18 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-17 | |
| d1nlta3 | 74 | g.54.1.1 (A:139-212) Mitochondrial protein import | 1e-16 | |
| d1m1qa_ | 90 | a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum | 1e-15 | |
| d1c3ga1 | 80 | b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba | 4e-14 | |
| d1nlta1 | 74 | b.4.1.1 (A:110-138,A:213-257) Mitochondrial protei | 1e-06 | |
| d1qo8a1 | 101 | a.138.1.3 (A:2-102) Flavocytochrome c3 (respirator | 7e-05 | |
| d1nlta2 | 80 | b.4.1.1 (A:258-337) Mitochondrial protein import p | 4e-04 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Score = 95.5 bits (237), Expect = 2e-25
Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
Query: 75 ASGDYYATLGVPKSASGKEIKAAYRKLARQYHPDVNK-EPGATEKFKEISAAYEVLSDDK 133
A DYY LGV K+A +EI+ AY++LA +YHPD N+ + A KFKEI AYEVL+D +
Sbjct: 1 AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQ 60
Query: 134 KRAMYDQYGEAGVK 147
KRA YDQYG A +
Sbjct: 61 KRAAYDQYGHAAFE 74
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 368 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.89 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.8 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.79 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.71 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.68 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.67 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.66 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.66 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.64 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 99.56 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.41 | |
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.2 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 99.14 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 97.95 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 97.66 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 97.66 | |
| d1m1qa_ | 90 | Flavocytochrome c3 (respiratory fumarate reductase | 96.54 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 93.87 | |
| d1m1qa_ | 90 | Flavocytochrome c3 (respiratory fumarate reductase | 85.31 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.89 E-value=3.1e-24 Score=160.25 Aligned_cols=72 Identities=56% Similarity=0.916 Sum_probs=66.9
Q ss_pred ccccchhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCC-cchHHHHHHHHHHHhhccchhhhhhhccccccCcc
Q 017647 76 SGDYYATLGVPKSASGKEIKAAYRKLARQYHPDVNKE-PGATEKFKEISAAYEVLSDDKKRAMYDQYGEAGVK 147 (368)
Q Consensus 76 ~~d~y~iLgv~~~a~~~eIk~ayr~l~~~~hPD~~~~-~~~~~~f~~i~~Ay~~L~d~~~r~~yd~~g~~g~~ 147 (368)
.+|||+||||+++||.+|||+|||+|++++|||+++. +.+.++|++|++||+||+||.+|+.||+||.+++.
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e 74 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE 74 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence 5799999999999999999999999999999999874 56788999999999999999999999999987653
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|