Citrus Sinensis ID: 017740

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------

MEYFYIVLFQKILVVLFCVALFWKIIRHMWSFLDIPKEPCRVLVTGATGQIGYALVPMIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEKHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRAMGQISERLKVHVSDVKNVIIWGNHSSTQYPDVNHATVTTSKGEKPVREAVADDNWLNTEFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTPKGTWVSMGVYSDGSYGIPEGLIYSFPVTCEKGEWSIVKGLKVDEFSRAKMDATAEELAEEKTLAYSCLN

ccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHcccccccccEEEEEEccccHHHHHHHHHHHHHHcccccccccEEEccHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHccccccccEEEEHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccEEccccEEEEcccccHHHHHHHccHHHHHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccEEEEEEEEEEccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHc

ccEEEEEHEEEEEEEEEEEEEcccHHHHcccHHHHHcccEEEEEcccccHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEEccHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHcccccccccEEEccHHHHHHHHHHHHHHHcccHHHEEccEEEEccccccEEEccccEEEEccEEccHHHHHccHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccEEEEEEccccHHcccccEEEEEEEEEccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcc

MEYFYIVLFQKILVVLFCVALFWKIIRHMWsfldipkepcrvlvtgatgqigYALVPMIArgimlgpdqpviLHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDVNIAVmvggfprkegmerkdvmsKNVSIYKAQASALekhaapnckvLVVANPANTNALIlkefapsipaknitcltrldhnramGQISERLKVHVSDVKNVIIWgnhsstqypdvnhatvttskgekpvreavaddnwlntEFITTVQQRGAAIIKARKLSSALSAASSAcdhirdwvlgtpkgtwvsmgvysdgsygipegliysfpvtcekgewsivkglkvdefsRAKMDATAEELAEEKTLAYSCLN

MEYFYIVLFQKILVVLFCVALFWKIIRHMWSFLDIPKEPCRVLVTGATGQIGYALVPMIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDVNIAVmvggfprkegmerkdvmsKNVSIYKAQASALEKHAAPNCKVLVVANPANTNALILKefapsipaknITCLTRLDHNRAMGQISERLKVHVSDVKNVIIWGnhsstqypdvnhatvttskgekpvreavaddnwlnTEFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTPKGTWVSMGVYSDGSYGIPEGLIYSFPVTCEKGEWSIVKGLKVDEFSRAKMDATAEelaeektlayscln

MEYFYIVLFQKILVVLFCVALFWKIIRHMWSFLDIPKEPCRVLVTGATGQIGYALVPMIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEKHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRAMGQISERLKVHVSDVKNVIIWGNHSSTQYPDVNHATVTTSKGEKPVREAVADDNWLNTEFITTVQQRGAAIIKARKlssalsaassaCDHIRDWVLGTPKGTWVSMGVYSDGSYGIPEGLIYSFPVTCEKGEWSIVKGLKVDEFSRAKMDataeelaeektlaYSCLN

**YFYIVLFQKILVVLFCVALFWKIIRHMWSFLDIPKEPCRVLVTGATGQIGYALVPMIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDVNIAVMVGGFPR************NVSIYKAQASALEKHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRAMGQISERLKVHVSDVKNVIIWGNHSSTQYPDVNHATV*********REAVADDNWLNTEFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTPKGTWVSMGVYSDGSYGIPEGLIYSFPVTCEKGEWSIVKGLKVDEF************************

*EYFYIVLFQKILVVLFCVALFWKIIR*********KEPCRVLVTGATGQIGYALVPMIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEKHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRAMGQISERLKVHVSDVKNVIIWGNHSSTQYPDVNHATVTTSKGEKPVREAVADDNWLNTEFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTPKGTWVSMGVYSDGSYGIPEGLIYSFPVTCEKGEWSIVKGLKVDEFSRAKMDATAEELAEEKTLAYSCLN

MEYFYIVLFQKILVVLFCVALFWKIIRHMWSFLDIPKEPCRVLVTGATGQIGYALVPMIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEKHAAPNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRAMGQISERLKVHVSDVKNVIIWGNHSSTQYPDVNHATVTTSKGEKPVREAVADDNWLNTEFITTVQQRGAAIIKA*************CDHIRDWVLGTPKGTWVSMGVYSDGSYGIPEGLIYSFPVTCEKGEWSIVKGLKVDEFSRAKMDATAEELAEEKTLAYSCLN

oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		366	2.2.26 [Sep-21-2011]
Q08062		332	Malate dehydrogenase, cyt	N/A	no	0.898	0.990	0.887	1e-169
Q7XDC8		332	Malate dehydrogenase, cyt	yes	no	0.901	0.993	0.872	1e-167
O48905		332	Malate dehydrogenase, cyt	N/A	no	0.901	0.993	0.863	1e-165
O24047		332	Malate dehydrogenase, cyt	N/A	no	0.896	0.987	0.875	1e-163
P93819		332	Malate dehydrogenase, cyt	yes	no	0.901	0.993	0.869	1e-163
P57106		332	Malate dehydrogenase, cyt	no	no	0.901	0.993	0.869	1e-162
Q9SML8		332	Malate dehydrogenase, cyt	N/A	no	0.896	0.987	0.859	1e-160
P11708		334	Malate dehydrogenase, cyt	yes	no	0.898	0.985	0.603	1e-112
Q3T145		334	Malate dehydrogenase, cyt	yes	no	0.896	0.982	0.601	1e-111
P40925		334	Malate dehydrogenase, cyt	yes	no	0.898	0.985	0.593	1e-111

>sp\|Q08062\|MDHC_MAIZE Malate dehydrogenase, cytoplasmic OS=Zea mays PE=2 SV=2	Back alignment and function desciption

 Score =  593 bits (1528), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 292/329 (88%), Positives = 306/329 (93%)

Query: 37  KEPCRVLVTGATGQIGYALVPMIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAA 96
           KEP RVLVTGA GQIGYALVPMIARG+MLG DQPVILHMLDI PAAEALNGVKMEL+DAA
Sbjct: 3   KEPMRVLVTGAAGQIGYALVPMIARGVMLGADQPVILHMLDIPPAAEALNGVKMELVDAA 62

Query: 97  FPLLKGVVATTDVVEACKDVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEKHAA 156
           FPLLKGVVATTDVVEAC  VN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QASALE HAA
Sbjct: 63  FPLLKGVVATTDVVEACTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEAHAA 122

Query: 157 PNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRAMGQISERLKVHVSDVKNV 216
           PNCKVLVVANPANTNALILKEFAPSIP KN+TCLTRLDHNRA+GQISERL V VSDVKNV
Sbjct: 123 PNCKVLVVANPANTNALILKEFAPSIPEKNVTCLTRLDHNRALGQISERLNVQVSDVKNV 182

Query: 217 IIWGNHSSTQYPDVNHATVTTSKGEKPVREAVADDNWLNTEFITTVQQRGAAIIKARKLS 276
           IIWGNHSS+QYPDVNHATV TS GEKPVRE V+DD WLN EFITTVQQRGAAIIKARK S
Sbjct: 183 IIWGNHSSSQYPDVNHATVKTSTGEKPVRELVSDDEWLNGEFITTVQQRGAAIIKARKFS 242

Query: 277 SALSAASSACDHIRDWVLGTPKGTWVSMGVYSDGSYGIPEGLIYSFPVTCEKGEWSIVKG 336
           SALSAASSACDHIRDWVLGTP+GT+VSMGVYSDGSYG+P GLIYSFPVTC  GEW IV+G
Sbjct: 243 SALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYGVPSGLIYSFPVTCSGGEWKIVQG 302

Query: 337 LKVDEFSRAKMDATAEELAEEKTLAYSCL 365
           L +DEFSR KMDATA+EL EEKTLAYSCL
Sbjct: 303 LPIDEFSRKKMDATAQELTEEKTLAYSCL 331

Zea mays (taxid: 4577)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 7

>sp\|Q7XDC8\|MDHC_ORYSJ Malate dehydrogenase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os10g0478200 PE=1 SV=3	Back alignment and function description

>sp\|O48905\|MDHC_MEDSA Malate dehydrogenase, cytoplasmic OS=Medicago sativa GN=CMDH PE=2 SV=1	Back alignment and function description

>sp\|O24047\|MDHC_MESCR Malate dehydrogenase, cytoplasmic OS=Mesembryanthemum crystallinum GN=MDH PE=2 SV=1	Back alignment and function description

>sp\|P93819\|MDHC1_ARATH Malate dehydrogenase, cytoplasmic 1 OS=Arabidopsis thaliana GN=At1g04410 PE=1 SV=2	Back alignment and function description

>sp\|P57106\|MDHC2_ARATH Malate dehydrogenase, cytoplasmic 2 OS=Arabidopsis thaliana GN=At5g43330 PE=2 SV=1	Back alignment and function description

>sp\|Q9SML8\|MDHC_BETVU Malate dehydrogenase, cytoplasmic OS=Beta vulgaris GN=NR1 PE=1 SV=1	Back alignment and function description

>sp\|P11708\|MDHC_PIG Malate dehydrogenase, cytoplasmic OS=Sus scrofa GN=MDH1 PE=1 SV=4	Back alignment and function description

>sp\|Q3T145\|MDHC_BOVIN Malate dehydrogenase, cytoplasmic OS=Bos taurus GN=MDH1 PE=2 SV=3	Back alignment and function description

>sp\|P40925\|MDHC_HUMAN Malate dehydrogenase, cytoplasmic OS=Homo sapiens GN=MDH1 PE=1 SV=4	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		366
449431976		364	PREDICTED: malate dehydrogenase, cytopla	0.978	0.983	0.893	0.0
449478013		391	PREDICTED: malate dehydrogenase, cytopla	0.969	0.907	0.892	0.0
356547879		373	PREDICTED: malate dehydrogenase, cytopla	0.986	0.967	0.845	1e-176
255647883		373	unknown [Glycine max]	0.986	0.967	0.842	1e-175
357512813		413	Malate dehydrogenase [Medicago truncatul	0.978	0.866	0.851	1e-173
147800078		361	hypothetical protein VITISV_032320 [Viti	0.980	0.994	0.856	1e-173
225453490		332	PREDICTED: malate dehydrogenase, cytopla	0.901	0.993	0.896	1e-169
255541140		332	malate dehydrogenase, putative [Ricinus	0.901	0.993	0.9	1e-169
350534656		334	cytosolic malate dehydrogenase [Solanum	0.912	1.0	0.889	1e-168
242039369		332	hypothetical protein SORBIDRAFT_01g01928	0.898	0.990	0.893	1e-167

>gi\|449431976\|ref\|XP_004133776.1\| PREDICTED: malate dehydrogenase, cytoplasmic-like [Cucumis sativus]	Back alignment and taxonomy information

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/358 (89%), Positives = 338/358 (94%)

Query: 8   LFQKILVVLFCVALFWKIIRHMWSFLDIPKEPCRVLVTGATGQIGYALVPMIARGIMLGP 67
           LFQK LVV F +A FWK+IR+MWSF+ + KEP RVLVTGA GQIGYA+VPMIARG+MLGP
Sbjct: 6   LFQKFLVVSFTIAFFWKLIRYMWSFVSMEKEPIRVLVTGAAGQIGYAIVPMIARGVMLGP 65

Query: 68  DQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDVNIAVMVGGFPR 127
           DQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGV+ATTDVVEACK+VNIAVMVGGFPR
Sbjct: 66  DQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVIATTDVVEACKEVNIAVMVGGFPR 125

Query: 128 KEGMERKDVMSKNVSIYKAQASALEKHAAPNCKVLVVANPANTNALILKEFAPSIPAKNI 187
           KEGMERKDVM+KNVSIYK QASALE+HAAP+CKVLVVANPANTNALILKEFAPSIP KNI
Sbjct: 126 KEGMERKDVMTKNVSIYKKQASALEQHAAPDCKVLVVANPANTNALILKEFAPSIPEKNI 185

Query: 188 TCLTRLDHNRAMGQISERLKVHVSDVKNVIIWGNHSSTQYPDVNHATVTTSKGEKPVREA 247
           TCLTRLDHNRA+GQISERLKVHVSDV NVIIWGNHSSTQYPDVNHA VTTS GEKPVRE 
Sbjct: 186 TCLTRLDHNRALGQISERLKVHVSDVNNVIIWGNHSSTQYPDVNHAKVTTSSGEKPVREL 245

Query: 248 VADDNWLNTEFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTPKGTWVSMGVY 307
           VADD WLNTEFI TVQQRGAAIIKARKLSSALSAAS+ACDHIR+WVLGTPKGTWVSMGVY
Sbjct: 246 VADDQWLNTEFIATVQQRGAAIIKARKLSSALSAASAACDHIRNWVLGTPKGTWVSMGVY 305

Query: 308 SDGSYGIPEGLIYSFPVTCEKGEWSIVKGLKVDEFSRAKMDATAEELAEEKTLAYSCL 365
           SDGSYGI  GLIYSFPVTCEKGEWSIV+GLK+DEFSRAKMDATA+EL EEK LAYSCL
Sbjct: 306 SDGSYGIERGLIYSFPVTCEKGEWSIVQGLKIDEFSRAKMDATAKELIEEKALAYSCL 363

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449478013\|ref\|XP_004155195.1\| PREDICTED: malate dehydrogenase, cytoplasmic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356547879\|ref\|XP_003542332.1\| PREDICTED: malate dehydrogenase, cytoplasmic-like [Glycine max]	Back alignment and taxonomy information

>gi\|255647883\|gb\|ACU24400.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|357512813\|ref\|XP_003626695.1\| Malate dehydrogenase [Medicago truncatula] gi\|355520717\|gb\|AET01171.1\| Malate dehydrogenase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|147800078\|emb\|CAN77649.1\| hypothetical protein VITISV_032320 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225453490\|ref\|XP_002277543.1\| PREDICTED: malate dehydrogenase, cytoplasmic [Vitis vinifera] gi\|297734557\|emb\|CBI16608.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255541140\|ref\|XP_002511634.1\| malate dehydrogenase, putative [Ricinus communis] gi\|223548814\|gb\|EEF50303.1\| malate dehydrogenase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|350534656\|ref\|NP_001234152.1\| cytosolic malate dehydrogenase [Solanum lycopersicum] gi\|52139818\|gb\|AAU29199.1\| cytosolic malate dehydrogenase [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|242039369\|ref\|XP_002467079.1\| hypothetical protein SORBIDRAFT_01g019280 [Sorghum bicolor] gi\|241920933\|gb\|EER94077.1\| hypothetical protein SORBIDRAFT_01g019280 [Sorghum bicolor]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		366
TAIR\|locus:2018244		332	c-NAD-MDH1 "cytosolic-NAD-depe	0.901	0.993	0.806	8.9e-141
TAIR\|locus:2176441		332	c-NAD-MDH2 "cytosolic-NAD-depe	0.901	0.993	0.806	8.9e-141
TAIR\|locus:2165066		339	c-NAD-MDH3 "cytosolic-NAD-depe	0.923	0.997	0.707	7.1e-132
UNIPROTKB\|P11708		334	MDH1 "Malate dehydrogenase, cy	0.849	0.931	0.583	4.3e-93
UNIPROTKB\|Q3T145		334	MDH1 "Malate dehydrogenase, cy	0.849	0.931	0.580	1.1e-92
UNIPROTKB\|P40925		334	MDH1 "Malate dehydrogenase, cy	0.849	0.931	0.576	1.5e-92
UNIPROTKB\|E2QV08		348	MDH1 "Malate dehydrogenase" [C	0.890	0.936	0.551	5e-92
MGI\|MGI:97051		334	Mdh1 "malate dehydrogenase 1,	0.849	0.931	0.583	1e-91
RGD\|3072		334	Mdh1 "malate dehydrogenase 1,	0.849	0.931	0.583	1e-91
UNIPROTKB\|Q5ZME2		334	MDH1 "Malate dehydrogenase, cy	0.849	0.931	0.573	2.7e-91

TAIR\|locus:2018244 c-NAD-MDH1 "cytosolic-NAD-dependent malate dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1377 (489.8 bits), Expect = 8.9e-141, P = 8.9e-141
 Identities = 266/330 (80%), Positives = 281/330 (85%)

Query:    37 KEPCRVLVTGATGQIGYALVPMIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAA 96
             KEP RVLVTGA GQIGYALVPMIARGIMLG DQPVILHMLDI PAAEALNGVKMELIDAA
Sbjct:     3 KEPVRVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPPAAEALNGVKMELIDAA 62

Query:    97 FPLLKGVVATTDVVEACKDVNIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEKHAA 156
             FPLLKGVVATTD VE C  VN+AVMVGGFPRKEGMERKDVMSKNVSIYK+QA+ALEKHAA
Sbjct:    63 FPLLKGVVATTDAVEGCTGVNVAVMVGGFPRKEGMERKDVMSKNVSIYKSQAAALEKHAA 122

Query:   157 PNCKVLVVANPANTNALILKEFAPSIPAKNITCLTRLDHNRAMGQISERLKVHVSDVKNV 216
             PNCKVLVVANPANTNALILKEFAPSIP KNI+CLTRLDHNRA+GQISERL V VSDVKNV
Sbjct:   123 PNCKVLVVANPANTNALILKEFAPSIPEKNISCLTRLDHNRALGQISERLSVPVSDVKNV 182

Query:   217 IIWGNHSSTQYPDVNHATVTTSKGEKPVREAVADDNWLNTEFITTVQQRGAAIIKARKXX 276
             IIWGNHSS+QYPDVNHA V TS GEKPVRE V DD WL+ EFI+TVQQRGAAIIKARK  
Sbjct:   183 IIWGNHSSSQYPDVNHAKVQTSSGEKPVRELVKDDAWLDGEFISTVQQRGAAIIKARKLS 242

Query:   277 XXXXXXXXXCDHIRDWVLGTPKGTWVSMGVYSDGSYGIPEGLIYSFPVTCEKGEWSIVKG 336
                      CDHIRDWVLGTP+GT+VSMGVYSDGSY +P GLIYSFPVTC  G+WSIV+G
Sbjct:   243 SALSAASSACDHIRDWVLGTPEGTFVSMGVYSDGSYSVPSGLIYSFPVTCRNGDWSIVQG 302

Query:   337 LKVDEFSRAKMDXXXXXXXXXXXXXYSCLN 366
             L +DE SR KMD             YSCL+
Sbjct:   303 LPIDEVSRKKMDLTAEELKEEKDLAYSCLS 332

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003824 "catalytic activity" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0005975 "carbohydrate metabolic process" evidence=IEA

GO:0006108 "malate metabolic process" evidence=IEA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0016615 "malate dehydrogenase activity" evidence=IEA;ISS

GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA

GO:0030060 "L-malate dehydrogenase activity" evidence=IEA

GO:0044262 "cellular carbohydrate metabolic process" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0005634 "nucleus" evidence=IDA

GO:0005773 "vacuole" evidence=IDA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0046686 "response to cadmium ion" evidence=IEP;RCA

GO:0005774 "vacuolar membrane" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0016020 "membrane" evidence=IDA

GO:0009651 "response to salt stress" evidence=IEP;RCA

GO:0009507 "chloroplast" evidence=IDA

GO:0048046 "apoplast" evidence=IDA

GO:0010043 "response to zinc ion" evidence=IEP

GO:0005829 "cytosol" evidence=RCA

GO:0009506 "plasmodesma" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=RCA

GO:0006094 "gluconeogenesis" evidence=RCA

GO:0006096 "glycolysis" evidence=RCA

GO:0006833 "water transport" evidence=RCA

GO:0006972 "hyperosmotic response" evidence=RCA

GO:0007030 "Golgi organization" evidence=RCA

GO:0009266 "response to temperature stimulus" evidence=RCA

TAIR\|locus:2176441 c-NAD-MDH2 "cytosolic-NAD-dependent malate dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2165066 c-NAD-MDH3 "cytosolic-NAD-dependent malate dehydrogenase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|P11708 MDH1 "Malate dehydrogenase, cytoplasmic" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3T145 MDH1 "Malate dehydrogenase, cytoplasmic" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P40925 MDH1 "Malate dehydrogenase, cytoplasmic" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QV08 MDH1 "Malate dehydrogenase" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:97051 Mdh1 "malate dehydrogenase 1, NAD (soluble)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|3072 Mdh1 "malate dehydrogenase 1, NAD (soluble)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZME2 MDH1 "Malate dehydrogenase, cytoplasmic" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
A9IIS3	MDH_BORPD	1, ., 1, ., 1, ., 3, 7	0.5524	0.8661	0.9635	yes	no
O48905	MDHC_MEDSA	1, ., 1, ., 1, ., 3, 7	0.8636	0.9016	0.9939	N/A	no
A5U1T8	MDH_MYCTA	1, ., 1, ., 1, ., 3, 7	0.5358	0.8661	0.9635	yes	no
Q0VQ52	MDH_ALCBS	1, ., 1, ., 1, ., 3, 7	0.5776	0.8661	0.9664	yes	no
Q9RXI8	MDH_DEIRA	1, ., 1, ., 1, ., 3, 7	0.5869	0.8661	0.9606	yes	no
A4FFX3	MDH_SACEN	1, ., 1, ., 1, ., 3, 7	0.5279	0.8661	0.9664	yes	no
O88989	MDHC_RAT	1, ., 1, ., 1, ., 3, 7	0.6	0.8989	0.9850	yes	no
O24047	MDHC_MESCR	1, ., 1, ., 1, ., 3, 7	0.875	0.8961	0.9879	N/A	no
Q7NZ60	MDH_CHRVO	1, ., 1, ., 1, ., 3, 7	0.5559	0.8661	0.9723	yes	no
Q0ABE6	MDH_ALHEH	1, ., 1, ., 1, ., 3, 7	0.5683	0.8661	0.9723	yes	no
Q21K60	MDH_SACD2	1, ., 1, ., 1, ., 3, 7	0.5714	0.8852	0.9908	yes	no
Q5ZME2	MDHC_CHICK	1, ., 1, ., 1, ., 3, 7	0.5909	0.8989	0.9850	yes	no
A1R2B5	MDH_ARTAT	1, ., 1, ., 1, ., 3, 7	0.5312	0.8633	0.9634	yes	no
Q6DIY9	MDHC_XENTR	1, ., 1, ., 1, ., 3, 7	0.5969	0.8989	0.9850	yes	no
A1K5Q9	MDH_AZOSB	1, ., 1, ., 1, ., 3, 7	0.5443	0.8715	0.9666	yes	no
A1WV94	MDH_HALHL	1, ., 1, ., 1, ., 3, 7	0.5590	0.8661	0.9723	yes	no
Q1Q932	MDH_PSYCK	1, ., 1, ., 1, ., 3, 7	0.5696	0.8661	0.9635	yes	no
A1KI28	MDH_MYCBP	1, ., 1, ., 1, ., 3, 7	0.5358	0.8661	0.9635	yes	no
Q08062	MDHC_MAIZE	1, ., 1, ., 1, ., 3, 7	0.8875	0.8989	0.9909	N/A	no
B3PHI3	MDH_CELJU	1, ., 1, ., 1, ., 3, 7	0.5652	0.8661	0.9694	yes	no
P93819	MDHC1_ARATH	1, ., 1, ., 1, ., 3, 7	0.8696	0.9016	0.9939	yes	no
P14152	MDHC_MOUSE	1, ., 1, ., 1, ., 3, 7	0.6	0.8989	0.9850	yes	no
P0A5J6	MDH_MYCTU	1, ., 1, ., 1, ., 3, 7	0.5358	0.8661	0.9635	yes	no
Q47TT4	MDH_THEFY	1, ., 1, ., 1, ., 3, 7	0.5434	0.8688	0.9636	yes	no
B2HRH5	MDH_MYCMM	1, ., 1, ., 1, ., 3, 7	0.55	0.8633	0.9604	yes	no
Q6PAB3	MDHC_XENLA	1, ., 1, ., 1, ., 3, 7	0.5848	0.8989	0.9850	N/A	no
A5WGM2	MDH_PSYWF	1, ., 1, ., 1, ., 3, 7	0.5603	0.8661	0.9694	yes	no
Q7XDC8	MDHC_ORYSJ	1, ., 1, ., 1, ., 3, 7	0.8727	0.9016	0.9939	yes	no
C5BU70	MDH_TERTT	1, ., 1, ., 1, ., 3, 7	0.5714	0.8661	0.9694	yes	no
P57106	MDHC2_ARATH	1, ., 1, ., 1, ., 3, 7	0.8696	0.9016	0.9939	no	no
Q7YRU4	MDHC_FELCA	1, ., 1, ., 1, ., 3, 7	0.5909	0.8989	0.9850	N/A	no
C1AMN4	MDH_MYCBT	1, ., 1, ., 1, ., 3, 7	0.5358	0.8661	0.9635	yes	no
P11708	MDHC_PIG	1, ., 1, ., 1, ., 3, 7	0.6030	0.8989	0.9850	yes	no
C1CY73	MDH_DEIDV	1, ., 1, ., 1, ., 3, 7	0.5745	0.8661	0.9606	yes	no
P0A5J7	MDH_MYCBO	1, ., 1, ., 1, ., 3, 7	0.5358	0.8661	0.9635	yes	no
Q3T145	MDHC_BOVIN	1, ., 1, ., 1, ., 3, 7	0.6018	0.8961	0.9820	yes	no
P40925	MDHC_HUMAN	1, ., 1, ., 1, ., 3, 7	0.5939	0.8989	0.9850	yes	no
Q7W5Q8	MDH_BORPA	1, ., 1, ., 1, ., 3, 7	0.5555	0.8661	0.9635	yes	no
P61976	MDH_MYCPA	1, ., 1, ., 1, ., 3, 7	0.5482	0.8661	0.9635	N/A	no
Q7WD94	MDH_BORBR	1, ., 1, ., 1, ., 3, 7	0.5555	0.8661	0.9635	yes	no
Q7VW97	MDH_BORPE	1, ., 1, ., 1, ., 3, 7	0.5555	0.8661	0.9635	yes	no
Q9SML8	MDHC_BETVU	1, ., 1, ., 1, ., 3, 7	0.8597	0.8961	0.9879	N/A	no
Q04820	MDHC_ECHGR	1, ., 1, ., 1, ., 3, 7	0.5121	0.8934	0.9849	N/A	no
A4SWW0	MDH_POLSQ	1, ., 1, ., 1, ., 3, 7	0.5462	0.8661	0.9635	yes	no
Q82HS2	MDH_STRAW	1, ., 1, ., 1, ., 3, 7	0.5310	0.8688	0.9665	yes	no
Q4FQU7	MDH_PSYA2	1, ., 1, ., 1, ., 3, 7	0.5634	0.8661	0.9635	yes	no
Q1IWC9	MDH_DEIGD	1, ., 1, ., 1, ., 3, 7	0.5791	0.8497	0.9311	yes	no
Q54GE6	MDHA_DICDI	1, ., 1, ., 1, ., 3, 7	0.5478	0.9207	0.8618	yes	no
Q9K3J3	MDH_STRCO	1, ., 1, ., 1, ., 3, 7	0.5403	0.8688	0.9665	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.1	0.983
3rd Layer	1.1.1.37	0.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00019169001	RecName- Full=Malate dehydrogenase; EC=1.1.1.37; (332 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00017898001	SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (565 aa)		•	•	0.948
	GSVIVG00003727001	RecName- Full=Citrate synthase; (472 aa)	•	•	•	0.930
	GSVIVG00028048001	SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (470 aa)		•	•	0.930
	NADP-ME	RecName- Full=Malic enzyme; (496 aa)		•	•	0.913
	VVME2	RecName- Full=Malic enzyme; (591 aa)		•	•	0.913
	GSVIVG00026767001	RecName- Full=Malic enzyme; (605 aa)		•	•	0.909
	GSVIVG00018984001	RecName- Full=Malic enzyme; (625 aa)		•	•	0.909
	GSVIVG00016723001	RecName- Full=Aspartate aminotransferase; EC=2.6.1.1; (411 aa)		•	•	0.909
	GPEPC	RecName- Full=Phosphoenolpyruvate carboxylase; EC=4.1.1.31; (965 aa)		•	•	0.908
	GSVIVG00027811001	RecName- Full=Phosphoenolpyruvate carboxylase; EC=4.1.1.31; (963 aa)		•	•	0.907

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		366
PLN00135		309	PLN00135, PLN00135, malate dehydrogenase	0.0
cd01336		325	cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic an	0.0
TIGR01758		324	TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD-	0.0
TIGR01759		323	TIGR01759, MalateDH-SF1, malate dehydrogenase	0.0
PRK05442		326	PRK05442, PRK05442, malate dehydrogenase; Provisio	0.0
cd00704		323	cd00704, MDH, Malate dehydrogenase	0.0
cd01338		322	cd01338, MDH_choloroplast_like, Chloroplast-like m	0.0
PLN00112		444	PLN00112, PLN00112, malate dehydrogenase (NADP); P	1e-103
TIGR01757		387	TIGR01757, Malate-DH_plant, malate dehydrogenase,	4e-95
TIGR01756		313	TIGR01756, LDH_protist, lactate dehydrogenase	6e-89
cd05295		452	cd05295, MDH_like, Malate dehydrogenase-like	2e-86
COG0039		313	COG0039, Mdh, Malate/lactate dehydrogenases [Energ	3e-73
cd00650		263	cd00650, LDH_MDH_like, NAD-dependent, lactate dehy	7e-62
pfam02866		173	pfam02866, Ldh_1_C, lactate/malate dehydrogenase,	1e-49
pfam00056		142	pfam00056, Ldh_1_N, lactate/malate dehydrogenase,	2e-37
cd00300		300	cd00300, LDH_like, L-lactate dehydrogenase-like en	3e-18
cd01339		300	cd01339, LDH-like_MDH, L-lactate dehydrogenase-lik	8e-17
PRK06223		307	PRK06223, PRK06223, malate dehydrogenase; Reviewed	5e-16
PTZ00117		319	PTZ00117, PTZ00117, malate dehydrogenase; Provisio	9e-15
cd05294		309	cd05294, LDH-like_MDH_nadp, A lactate dehydrogenas	3e-14
cd05293		312	cd05293, LDH_1, A subgroup of L-lactate dehydrogen	2e-13
TIGR01763		305	TIGR01763, MalateDH_bact, malate dehydrogenase, NA	3e-13
TIGR01772		312	TIGR01772, MDH_euk_gproteo, malate dehydrogenase,	2e-12
cd01337		310	cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysoma	1e-10
TIGR01771		299	TIGR01771, L-LDH-NAD, L-lactate dehydrogenase	7e-09
PRK00066		315	PRK00066, ldh, L-lactate dehydrogenase; Reviewed	5e-08
PLN00106		323	PLN00106, PLN00106, malate dehydrogenase	7e-08
PTZ00082		321	PTZ00082, PTZ00082, L-lactate dehydrogenase; Provi	2e-07
PTZ00325		321	PTZ00325, PTZ00325, malate dehydrogenase; Provisio	3e-07
PRK05086		312	PRK05086, PRK05086, malate dehydrogenase; Provisio	6e-07
PLN02602		350	PLN02602, PLN02602, lactate dehydrogenase	1e-06
cd05292		308	cd05292, LDH_2, A subgroup of L-lactate dehydrogen	2e-05
cd05291		306	cd05291, HicDH_like, L-2-hydroxyisocapronate dehyd	4e-04

>gnl\|CDD\|177744 PLN00135, PLN00135, malate dehydrogenase	Back alignment and domain information

 Score =  677 bits (1749), Expect = 0.0
 Identities = 283/309 (91%), Positives = 293/309 (94%)

Query: 58  MIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDVN 117
           MIARG+MLGPDQPVILHMLDI PAAEALNGVKMELIDAAFPLLKGVVATTDVVEACK VN
Sbjct: 1   MIARGVMLGPDQPVILHMLDIPPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKGVN 60

Query: 118 IAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEKHAAPNCKVLVVANPANTNALILKE 177
           IAVMVGGFPRKEGMERKDVMSKNVSIYK+QASALEKHAAP+CKVLVVANPANTNALILKE
Sbjct: 61  IAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKHAAPDCKVLVVANPANTNALILKE 120

Query: 178 FAPSIPAKNITCLTRLDHNRAMGQISERLKVHVSDVKNVIIWGNHSSTQYPDVNHATVTT 237
           FAPSIP KNITCLTRLDHNRA+GQISERL V VSDVKNVIIWGNHSSTQYPDVNHATV T
Sbjct: 121 FAPSIPEKNITCLTRLDHNRALGQISERLGVPVSDVKNVIIWGNHSSTQYPDVNHATVKT 180

Query: 238 SKGEKPVREAVADDNWLNTEFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTP 297
             GEKPVRE VADD WLN EFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTP
Sbjct: 181 PSGEKPVRELVADDAWLNGEFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTP 240

Query: 298 KGTWVSMGVYSDGSYGIPEGLIYSFPVTCEKGEWSIVKGLKVDEFSRAKMDATAEELAEE 357
           +GTWVSMGVYSDGSYG+P GLIYSFPVTCEKGEWSIV+GL +DEFSR KMDATA+EL EE
Sbjct: 241 EGTWVSMGVYSDGSYGVPPGLIYSFPVTCEKGEWSIVQGLSIDEFSRKKMDATAKELKEE 300

Query: 358 KTLAYSCLN 366
           K LAYSCL+
Sbjct: 301 KELAYSCLS 309

Length = 309

>gnl\|CDD\|133421 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic and cytosolic Malate dehydrogenases	Back alignment and domain information

>gnl\|CDD\|130819 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD-dependent	Back alignment and domain information

>gnl\|CDD\|130820 TIGR01759, MalateDH-SF1, malate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|235468 PRK05442, PRK05442, malate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|133420 cd00704, MDH, Malate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|133423 cd01338, MDH_choloroplast_like, Chloroplast-like malate dehydrogenases	Back alignment and domain information

>gnl\|CDD\|215060 PLN00112, PLN00112, malate dehydrogenase (NADP); Provisional	Back alignment and domain information

>gnl\|CDD\|130818 TIGR01757, Malate-DH_plant, malate dehydrogenase, NADP-dependent	Back alignment and domain information

>gnl\|CDD\|130817 TIGR01756, LDH_protist, lactate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|133431 cd05295, MDH_like, Malate dehydrogenase-like	Back alignment and domain information

>gnl\|CDD\|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family	Back alignment and domain information

>gnl\|CDD\|202437 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain	Back alignment and domain information

>gnl\|CDD\|200963 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, NAD binding domain	Back alignment and domain information

>gnl\|CDD\|133418 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes	Back alignment and domain information

>gnl\|CDD\|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins	Back alignment and domain information

>gnl\|CDD\|180477 PRK06223, PRK06223, malate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|173409 PTZ00117, PTZ00117, malate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|133430 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity	Back alignment and domain information

>gnl\|CDD\|133429 cd05293, LDH_1, A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>gnl\|CDD\|233562 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent	Back alignment and domain information

>gnl\|CDD\|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent	Back alignment and domain information

>gnl\|CDD\|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases	Back alignment and domain information

>gnl\|CDD\|233566 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|178836 PRK00066, ldh, L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|215058 PLN00106, PLN00106, malate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|173376 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|240360 PTZ00325, PTZ00325, malate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|235340 PRK05086, PRK05086, malate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|178212 PLN02602, PLN02602, lactate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|133428 cd05292, LDH_2, A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>gnl\|CDD\|133427 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		366
TIGR01759		323	MalateDH-SF1 malate dehydrogenase. This model repr	100.0
PRK05442		326	malate dehydrogenase; Provisional	100.0
COG0039		313	Mdh Malate/lactate dehydrogenases [Energy producti	100.0
TIGR01757		387	Malate-DH_plant malate dehydrogenase, NADP-depende	100.0
PLN00112		444	malate dehydrogenase (NADP); Provisional	100.0
cd00704		323	MDH Malate dehydrogenase. Malate dehydrogenase (MD	100.0
cd01338		322	MDH_choloroplast_like Chloroplast-like malate dehy	100.0
cd01336		325	MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli	100.0
TIGR01758		324	MDH_euk_cyt malate dehydrogenase, NAD-dependent. T	100.0
cd05290		307	LDH_3 A subgroup of L-lactate dehydrogenases. L-la	100.0
cd05295		452	MDH_like Malate dehydrogenase-like. These MDH-like	100.0
PLN00135		309	malate dehydrogenase	100.0
TIGR01771		299	L-LDH-NAD L-lactate dehydrogenase. This model repr	100.0
PLN02602		350	lactate dehydrogenase	100.0
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	100.0
KOG1495		332	consensus Lactate dehydrogenase [Energy production	100.0
cd05293		312	LDH_1 A subgroup of L-lactate dehydrogenases. L-la	100.0
TIGR01756		313	LDH_protist lactate dehydrogenase. This model repr	100.0
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	100.0
cd00300		300	LDH_like L-lactate dehydrogenase-like enzymes. Mem	100.0
PTZ00117		319	malate dehydrogenase; Provisional	100.0
cd05292		308	LDH_2 A subgroup of L-lactate dehydrogenases. L-la	100.0
TIGR01772		312	MDH_euk_gproteo malate dehydrogenase, NAD-dependen	100.0
PTZ00082		321	L-lactate dehydrogenase; Provisional	100.0
KOG1496		332	consensus Malate dehydrogenase [Energy production	100.0
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	100.0
cd01337		310	MDH_glyoxysomal_mitochondrial Glyoxysomal and mito	100.0
cd05294		309	LDH-like_MDH_nadp A lactate dehydrogenases-like st	100.0
PTZ00325		321	malate dehydrogenase; Provisional	100.0
PRK06223		307	malate dehydrogenase; Reviewed	100.0
PRK05086		312	malate dehydrogenase; Provisional	100.0
cd01339		300	LDH-like_MDH L-lactate dehydrogenase-like malate d	100.0
PLN00106		323	malate dehydrogenase	100.0
cd00650		263	LDH_MDH_like NAD-dependent, lactate dehydrogenase-	100.0
KOG1494		345	consensus NAD-dependent malate dehydrogenase [Ener	100.0
PF02866		174	Ldh_1_C: lactate/malate dehydrogenase, alpha/beta	100.0
PF00056		141	Ldh_1_N: lactate/malate dehydrogenase, NAD binding	99.97
cd05197		425	GH4_glycoside_hydrolases Glycoside Hydrases Family	99.92
cd05298		437	GH4_GlvA_pagL_like Glycoside Hydrolases Family 4;	99.9
PRK15076		431	alpha-galactosidase; Provisional	99.9
cd05296		419	GH4_P_beta_glucosidase Glycoside Hydrolases Family	99.88
cd05297		423	GH4_alpha_glucosidase_galactosidase Glycoside Hydr	99.84
COG1486		442	CelF Alpha-galactosidases/6-phospho-beta-glucosida	99.75
PF02056		183	Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP	99.63
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	98.67
KOG1502		327	consensus Flavonol reductase/cinnamoyl-CoA reducta	98.62
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	98.62
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	98.57
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.54
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	98.44
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.42
COG0240		329	GpsA Glycerol-3-phosphate dehydrogenase [Energy pr	98.39
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.35
PLN02166		436	dTDP-glucose 4,6-dehydratase	98.34
PF01073		280	3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso	98.34
COG1250		307	FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo	98.28
PF02719		293	Polysacc_synt_2: Polysaccharide biosynthesis prote	98.28
PLN02650		351	dihydroflavonol-4-reductase	98.25
TIGR01915		219	npdG NADPH-dependent F420 reductase. This model re	98.21
PLN02662		322	cinnamyl-alcohol dehydrogenase family protein	98.17
PLN02206		442	UDP-glucuronate decarboxylase	98.16
PLN02583		297	cinnamoyl-CoA reductase	98.16
PLN02427		386	UDP-apiose/xylose synthase	98.16
PRK11730		715	fadB multifunctional fatty acid oxidation complex	98.15
PLN02353		473	probable UDP-glucose 6-dehydrogenase	98.15
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.15
PLN00198		338	anthocyanidin reductase; Provisional	98.13
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.13
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	98.12
PRK11154		708	fadJ multifunctional fatty acid oxidation complex	98.12
PRK15181		348	Vi polysaccharide biosynthesis protein TviC; Provi	98.11
TIGR02440		699	FadJ fatty oxidation complex, alpha subunit FadJ.	98.1
PLN02695		370	GDP-D-mannose-3',5'-epimerase	98.07
TIGR02441		737	fa_ox_alpha_mit fatty acid oxidation complex, alph	98.06
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	98.06
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	98.05
PLN02989		325	cinnamyl-alcohol dehydrogenase family protein	98.04
KOG2304		298	consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t	98.01
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	97.99
PRK08268		507	3-hydroxy-acyl-CoA dehydrogenase; Validated	97.99
TIGR03376		342	glycerol3P_DH glycerol-3-phosphate dehydrogenase (	97.98
COG1086		588	Predicted nucleoside-diphosphate sugar epimerases	97.98
TIGR02279		503	PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa	97.98
TIGR03589		324	PseB UDP-N-acetylglucosamine 4,6-dehydratase. This	97.97
PTZ00345		365	glycerol-3-phosphate dehydrogenase; Provisional	97.96
PLN02214		342	cinnamoyl-CoA reductase	97.96
CHL00194		317	ycf39 Ycf39; Provisional	97.95
PRK08125		660	bifunctional UDP-glucuronic acid decarboxylase/UDP	97.95
TIGR02622		349	CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member	97.93
PLN02986		322	cinnamyl-alcohol dehydrogenase family protein	97.93
PLN02545		295	3-hydroxybutyryl-CoA dehydrogenase	97.91
PRK11908		347	NAD-dependent epimerase/dehydratase family protein	97.89
PLN02572		442	UDP-sulfoquinovose synthase	97.88
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	97.87
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	97.85
PLN02778		298	3,5-epimerase/4-reductase	97.85
TIGR01472		343	gmd GDP-mannose 4,6-dehydratase. Excluded from thi	97.84
PLN03209		576	translocon at the inner envelope of chloroplast su	97.82
PLN02896		353	cinnamyl-alcohol dehydrogenase	97.82
PRK12439		341	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	97.8
KOG1430		361	consensus C-3 sterol dehydrogenase/3-beta-hydroxys	97.79
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	97.79
PRK09987		299	dTDP-4-dehydrorhamnose reductase; Provisional	97.79
TIGR03466		328	HpnA hopanoid-associated sugar epimerase. The sequ	97.78
COG0451		314	WcaG Nucleoside-diphosphate-sugar epimerases [Cell	97.76
COG1087		329	GalE UDP-glucose 4-epimerase [Cell envelope biogen	97.73
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	97.73
PLN02240		352	UDP-glucose 4-epimerase	97.72
TIGR01777		292	yfcH conserved hypothetical protein TIGR01777. Thi	97.7
PRK11150		308	rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro	97.7
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	97.69
PRK10675		338	UDP-galactose-4-epimerase; Provisional	97.64
KOG1429		350	consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro	97.64
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	97.63
PRK15182		425	Vi polysaccharide biosynthesis protein TviB; Provi	97.6
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	97.6
COG2085		211	Predicted dinucleotide-binding enzymes [General fu	97.6
TIGR01181		317	dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This	97.6
PRK10217		355	dTDP-glucose 4,6-dehydratase; Provisional	97.59
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	97.58
PLN02653		340	GDP-mannose 4,6-dehydratase	97.57
PRK10084		352	dTDP-glucose 4,6 dehydratase; Provisional	97.56
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	97.56
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	97.56
KOG2711		372	consensus Glycerol-3-phosphate dehydrogenase/dihyd	97.55
PRK07806		248	short chain dehydrogenase; Provisional	97.54
PLN02260		668	probable rhamnose biosynthetic enzyme	97.53
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	97.53
TIGR01214		287	rmlD dTDP-4-dehydrorhamnose reductase. This enzyme	97.52
PLN02657		390	3,8-divinyl protochlorophyllide a 8-vinyl reductas	97.5
PLN02686		367	cinnamoyl-CoA reductase	97.5
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	97.49
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	97.49
PRK07201		657	short chain dehydrogenase; Provisional	97.48
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	97.47
PRK07067		257	sorbitol dehydrogenase; Provisional	97.42
PRK14982		340	acyl-ACP reductase; Provisional	97.4
PRK13394		262	3-hydroxybutyrate dehydrogenase; Provisional	97.4
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	97.39
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	97.39
COG0300		265	DltE Short-chain dehydrogenases of various substra	97.38
TIGR02197		314	heptose_epim ADP-L-glycero-D-manno-heptose-6-epime	97.37
PRK06194		287	hypothetical protein; Provisional	97.36
PRK07523		255	gluconate 5-dehydrogenase; Provisional	97.35
PF01370		236	Epimerase: NAD dependent epimerase/dehydratase fam	97.35
PRK08267		260	short chain dehydrogenase; Provisional	97.35
PRK06180		277	short chain dehydrogenase; Provisional	97.35
PRK10538		248	malonic semialdehyde reductase; Provisional	97.34
PRK09135		249	pteridine reductase; Provisional	97.34
PRK07326		237	short chain dehydrogenase; Provisional	97.34
PRK05717		255	oxidoreductase; Validated	97.33
PRK12828		239	short chain dehydrogenase; Provisional	97.31
TIGR03325		262	BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro	97.3
PRK12937		245	short chain dehydrogenase; Provisional	97.29
PRK06482		276	short chain dehydrogenase; Provisional	97.26
PRK06124		256	gluconate 5-dehydrogenase; Provisional	97.25
PRK14619		308	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	97.24
PRK05865		854	hypothetical protein; Provisional	97.24
PRK05875		276	short chain dehydrogenase; Provisional	97.23
PRK12320		699	hypothetical protein; Provisional	97.22
PRK05653		246	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	97.21
PRK08655		437	prephenate dehydrogenase; Provisional	97.21
PRK07774		250	short chain dehydrogenase; Provisional	97.21
PRK06128		300	oxidoreductase; Provisional	97.2
TIGR03206		250	benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr	97.16
PRK08265		261	short chain dehydrogenase; Provisional	97.16
PRK06935		258	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	97.16
PRK07424		406	bifunctional sterol desaturase/short chain dehydro	97.15
TIGR01179		328	galE UDP-glucose-4-epimerase. This enzyme intercon	97.15
PRK07102		243	short chain dehydrogenase; Provisional	97.15
PRK06500		249	short chain dehydrogenase; Provisional	97.15
PRK12746		254	short chain dehydrogenase; Provisional	97.14
PRK07680		273	late competence protein ComER; Validated	97.13
PRK06172		253	short chain dehydrogenase; Provisional	97.12
PRK12936		245	3-ketoacyl-(acyl-carrier-protein) reductase NodG;	97.12
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	97.1
PRK06138		252	short chain dehydrogenase; Provisional	97.1
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	97.1
PLN00141		251	Tic62-NAD(P)-related group II protein; Provisional	97.1
COG1088		340	RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope	97.08
PRK07060		245	short chain dehydrogenase; Provisional	97.08
PF01118		121	Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi	97.08
PRK05866		293	short chain dehydrogenase; Provisional	97.07
PRK08219		227	short chain dehydrogenase; Provisional	97.06
PLN02253		280	xanthoxin dehydrogenase	97.05
PRK05786		238	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	97.05
PRK08085		254	gluconate 5-dehydrogenase; Provisional	97.05
PRK07825		273	short chain dehydrogenase; Provisional	97.05
PLN02780		320	ketoreductase/ oxidoreductase	97.04
PRK07576		264	short chain dehydrogenase; Provisional	97.03
PRK05557		248	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	97.03
PRK08945		247	putative oxoacyl-(acyl carrier protein) reductase;	97.03
PRK08628		258	short chain dehydrogenase; Provisional	97.02
PRK07890		258	short chain dehydrogenase; Provisional	97.02
PRK08263		275	short chain dehydrogenase; Provisional	97.01
PRK08643		256	acetoin reductase; Validated	97.01
COG2910		211	Putative NADH-flavin reductase [General function p	97.0
PRK06196		315	oxidoreductase; Provisional	96.98
PRK06200		263	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog	96.98
PLN02260		668	probable rhamnose biosynthetic enzyme	96.98
PRK06101		240	short chain dehydrogenase; Provisional	96.98
PLN02996		491	fatty acyl-CoA reductase	96.98
PRK09072		263	short chain dehydrogenase; Provisional	96.97
PRK07024		257	short chain dehydrogenase; Provisional	96.97
PRK12939		250	short chain dehydrogenase; Provisional	96.96
PRK08213		259	gluconate 5-dehydrogenase; Provisional	96.96
PRK08642		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.95
TIGR01832		248	kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod	96.95
PRK07453		322	protochlorophyllide oxidoreductase; Validated	96.95
COG1090		297	Predicted nucleoside-diphosphate sugar epimerase [	96.93
PRK07814		263	short chain dehydrogenase; Provisional	96.92
PRK07856		252	short chain dehydrogenase; Provisional	96.91
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	96.91
PRK06701		290	short chain dehydrogenase; Provisional	96.91
PRK07666		239	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.91
PRK06077		252	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.91
PRK12829		264	short chain dehydrogenase; Provisional	96.9
PRK05565		247	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.9
PRK06182		273	short chain dehydrogenase; Validated	96.9
COG1893		307	ApbA Ketopantoate reductase [Coenzyme metabolism]	96.89
PRK07069		251	short chain dehydrogenase; Validated	96.89
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	96.89
PRK12384		259	sorbitol-6-phosphate dehydrogenase; Provisional	96.89
PRK06181		263	short chain dehydrogenase; Provisional	96.88
TIGR01746		367	Thioester-redct thioester reductase domain. It has	96.88
PRK12823		260	benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat	96.87
PRK07478		254	short chain dehydrogenase; Provisional	96.86
PRK05884		223	short chain dehydrogenase; Provisional	96.86
PRK05876		275	short chain dehydrogenase; Provisional	96.84
PRK08278		273	short chain dehydrogenase; Provisional	96.84
KOG1201		300	consensus Hydroxysteroid 17-beta dehydrogenase 11	96.84
PRK08339		263	short chain dehydrogenase; Provisional	96.83
PRK06197		306	short chain dehydrogenase; Provisional	96.83
PRK12367		245	short chain dehydrogenase; Provisional	96.83
COG0677		436	WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas	96.82
PLN02725		306	GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas	96.8
PRK07679		279	pyrroline-5-carboxylate reductase; Reviewed	96.8
PRK09134		258	short chain dehydrogenase; Provisional	96.8
PRK05993		277	short chain dehydrogenase; Provisional	96.8
PRK07417		279	arogenate dehydrogenase; Reviewed	96.79
PRK07063		260	short chain dehydrogenase; Provisional	96.79
PRK06841		255	short chain dehydrogenase; Provisional	96.78
PRK07985		294	oxidoreductase; Provisional	96.77
PRK07454		241	short chain dehydrogenase; Provisional	96.77
PRK07035		252	short chain dehydrogenase; Provisional	96.77
PRK09291		257	short chain dehydrogenase; Provisional	96.76
PRK06179		270	short chain dehydrogenase; Provisional	96.76
PRK05650		270	short chain dehydrogenase; Provisional	96.76
PRK05867		253	short chain dehydrogenase; Provisional	96.76
PRK08226		263	short chain dehydrogenase; Provisional	96.75
PRK11880		267	pyrroline-5-carboxylate reductase; Reviewed	96.75
PF04321		286	RmlD_sub_bind: RmlD substrate binding domain; Inte	96.75
PRK06113		255	7-alpha-hydroxysteroid dehydrogenase; Validated	96.74
PRK06928		277	pyrroline-5-carboxylate reductase; Reviewed	96.74
PRK07904		253	short chain dehydrogenase; Provisional	96.74
PRK08264		238	short chain dehydrogenase; Validated	96.74
PRK12742		237	oxidoreductase; Provisional	96.73
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	96.72
PRK06463		255	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.71
PRK08277		278	D-mannonate oxidoreductase; Provisional	96.71
TIGR01963		255	PHB_DH 3-hydroxybutyrate dehydrogenase. This model	96.7
PRK12935		247	acetoacetyl-CoA reductase; Provisional	96.67
PRK12491		272	pyrroline-5-carboxylate reductase; Reviewed	96.67
PRK07634		245	pyrroline-5-carboxylate reductase; Reviewed	96.67
PRK12825		249	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.66
PRK06139		330	short chain dehydrogenase; Provisional	96.66
PRK06057		255	short chain dehydrogenase; Provisional	96.65
PRK05872		296	short chain dehydrogenase; Provisional	96.64
COG4221		246	Short-chain alcohol dehydrogenase of unknown speci	96.64
PF01113		124	DapB_N: Dihydrodipicolinate reductase, N-terminus;	96.63
KOG1371		343	consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo	96.63
PRK06171		266	sorbitol-6-phosphate 2-dehydrogenase; Provisional	96.63
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	96.63
PRK12747		252	short chain dehydrogenase; Provisional	96.62
PRK12481		251	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	96.62
PLN02688		266	pyrroline-5-carboxylate reductase	96.61
PRK08269		314	3-hydroxybutyryl-CoA dehydrogenase; Validated	96.61
KOG1205		282	consensus Predicted dehydrogenase [Secondary metab	96.61
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	96.61
PRK06125		259	short chain dehydrogenase; Provisional	96.6
PRK05693		274	short chain dehydrogenase; Provisional	96.6
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	96.59
PRK07832		272	short chain dehydrogenase; Provisional	96.59
PRK08340		259	glucose-1-dehydrogenase; Provisional	96.57
PRK12480		330	D-lactate dehydrogenase; Provisional	96.57
PRK07074		257	short chain dehydrogenase; Provisional	96.56
PRK09186		256	flagellin modification protein A; Provisional	96.56
PRK12744		257	short chain dehydrogenase; Provisional	96.55
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	96.54
PRK12745		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	96.53
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	96.53
PRK06914		280	short chain dehydrogenase; Provisional	96.53
PRK06114		254	short chain dehydrogenase; Provisional	96.52
TIGR02632		676	RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc	96.52
PLN02503		605	fatty acyl-CoA reductase 2	96.51
PRK06523		260	short chain dehydrogenase; Provisional	96.5
PRK07109		334	short chain dehydrogenase; Provisional	96.5
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	96.49
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	96.48
PRK08251		248	short chain dehydrogenase; Provisional	96.48
PRK12827		249	short chain dehydrogenase; Provisional	96.47
PRK09242		257	tropinone reductase; Provisional	96.47
cd05312		279	NAD_bind_1_malic_enz NAD(P) binding domain of mali	96.44
PRK08324		681	short chain dehydrogenase; Validated	96.44
PRK08993		253	2-deoxy-D-gluconate 3-dehydrogenase; Validated	96.43
PRK07097		265	gluconate 5-dehydrogenase; Provisional	96.42
PRK08589		272	short chain dehydrogenase; Validated	96.42
PRK08217		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.41
PRK08063		250	enoyl-(acyl carrier protein) reductase; Provisiona	96.38
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	96.37
PRK06198		260	short chain dehydrogenase; Provisional	96.37
PRK06550		235	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.35
PRK06398		258	aldose dehydrogenase; Validated	96.32
TIGR03649		285	ergot_EASG ergot alkaloid biosynthesis protein, AF	96.32
PRK07578		199	short chain dehydrogenase; Provisional	96.31
PRK06924		251	short chain dehydrogenase; Provisional	96.25
TIGR02415		254	23BDH acetoin reductases. One member of this famil	96.24
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	96.23
TIGR01830		239	3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re	96.23
COG1091		281	RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo	96.22
PRK08220		252	2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	96.22
COG0289		266	DapB Dihydrodipicolinate reductase [Amino acid tra	96.22
PRK06484		520	short chain dehydrogenase; Validated	96.21
PRK06953		222	short chain dehydrogenase; Provisional	96.2
PRK08177		225	short chain dehydrogenase; Provisional	96.2
COG2084		286	MmsB 3-hydroxyisobutyrate dehydrogenase and relate	96.18
PRK07023		243	short chain dehydrogenase; Provisional	96.18
PRK11199		374	tyrA bifunctional chorismate mutase/prephenate deh	96.17
PRK06545		359	prephenate dehydrogenase; Validated	96.17
PRK12824		245	acetoacetyl-CoA reductase; Provisional	96.17
PRK07792		306	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.16
PRK06720		169	hypothetical protein; Provisional	96.15
PF05368		233	NmrA: NmrA-like family; InterPro: IPR008030 NmrA i	96.14
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	96.13
PRK15461		296	NADH-dependent gamma-hydroxybutyrate dehydrogenase	96.12
PRK07775		274	short chain dehydrogenase; Provisional	96.11
PRK08703		239	short chain dehydrogenase; Provisional	96.11
PRK07677		252	short chain dehydrogenase; Provisional	96.09
PRK12490		299	6-phosphogluconate dehydrogenase-like protein; Rev	96.09
PRK07889		256	enoyl-(acyl carrier protein) reductase; Provisiona	96.07
PRK06484		520	short chain dehydrogenase; Validated	96.07
KOG1200		256	consensus Mitochondrial/plastidial beta-ketoacyl-A	96.05
PRK06947		248	glucose-1-dehydrogenase; Provisional	96.04
PRK05855		582	short chain dehydrogenase; Validated	96.02
PRK07062		265	short chain dehydrogenase; Provisional	96.01
PRK06949		258	short chain dehydrogenase; Provisional	96.01
PRK12743		256	oxidoreductase; Provisional	96.01
PRK08261		450	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.0
PRK08415		274	enoyl-(acyl carrier protein) reductase; Provisiona	95.97
KOG2666		481	consensus UDP-glucose/GDP-mannose dehydrogenase [C	95.96
PRK06940		275	short chain dehydrogenase; Provisional	95.94
PF00106		167	adh_short: short chain dehydrogenase alcohol dehyd	95.94
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	95.92
PRK07577		234	short chain dehydrogenase; Provisional	95.91
PRK12938		246	acetyacetyl-CoA reductase; Provisional	95.87
PRK09599		301	6-phosphogluconate dehydrogenase-like protein; Rev	95.84
COG0569		225	TrkA K+ transport systems, NAD-binding component [	95.84
PRK08936		261	glucose-1-dehydrogenase; Provisional	95.83
PRK07533		258	enoyl-(acyl carrier protein) reductase; Provisiona	95.83
TIGR02371		325	ala_DH_arch alanine dehydrogenase, Archaeoglobus f	95.81
PRK06123		248	short chain dehydrogenase; Provisional	95.78
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	95.77
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	95.76
PLN02968		381	Probable N-acetyl-gamma-glutamyl-phosphate reducta	95.74
PRK07201		657	short chain dehydrogenase; Provisional	95.73
PRK09009		235	C factor cell-cell signaling protein; Provisional	95.72
PRK12748		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	95.69
COG0287		279	TyrA Prephenate dehydrogenase [Amino acid transpor	95.69
PF07993		249	NAD_binding_4: Male sterility protein; InterPro: I	95.65
PF03949		255	Malic_M: Malic enzyme, NAD binding domain; InterPr	95.6
PRK06407		301	ornithine cyclodeaminase; Provisional	95.6
PLN02256		304	arogenate dehydrogenase	95.56
PRK05854		313	short chain dehydrogenase; Provisional	95.55
PRK07041		230	short chain dehydrogenase; Provisional	95.54
PRK08291		330	ectoine utilization protein EutC; Validated	95.54
PRK07831		262	short chain dehydrogenase; Provisional	95.53
PRK08862		227	short chain dehydrogenase; Provisional	95.53
cd00762		254	NAD_bind_malic_enz NAD(P) binding domain of malic	95.52
PRK08618		325	ornithine cyclodeaminase; Validated	95.52
PRK06079		252	enoyl-(acyl carrier protein) reductase; Provisiona	95.5
COG0702		275	Predicted nucleoside-diphosphate-sugar epimerases	95.49
PLN02350		493	phosphogluconate dehydrogenase (decarboxylating)	95.46
PF02423		313	OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst	95.44
PTZ00431		260	pyrroline carboxylate reductase; Provisional	95.39
PRK06476		258	pyrroline-5-carboxylate reductase; Reviewed	95.36
PRK06483		236	dihydromonapterin reductase; Provisional	95.36
TIGR01829		242	AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy	95.33
TIGR01724		341	hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome	95.29
PRK06728		347	aspartate-semialdehyde dehydrogenase; Provisional	95.26
PRK08416		260	7-alpha-hydroxysteroid dehydrogenase; Provisional	95.18
cd05212		140	NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom	95.18
TIGR02992		326	ectoine_eutC ectoine utilization protein EutC. Mem	95.18
TIGR01831		239	fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas	95.17
PF03435		386	Saccharop_dh: Saccharopine dehydrogenase ; InterPr	95.16
PRK07589		346	ornithine cyclodeaminase; Validated	95.16
PLN02383		344	aspartate semialdehyde dehydrogenase	95.14
PRK06141		314	ornithine cyclodeaminase; Validated	95.12
PLN02712		667	arogenate dehydrogenase	95.12
PRK06823		315	ornithine cyclodeaminase; Validated	95.08
PRK05479		330	ketol-acid reductoisomerase; Provisional	95.07
PRK08017		256	oxidoreductase; Provisional	95.06
PRK14194		301	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.05
PRK07340		304	ornithine cyclodeaminase; Validated	95.03
PRK09730		247	putative NAD(P)-binding oxidoreductase; Provisiona	95.02
PRK05599		246	hypothetical protein; Provisional	95.02
KOG2305		313	consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t	95.02
PRK06505		271	enoyl-(acyl carrier protein) reductase; Provisiona	95.01
PRK14874		334	aspartate-semialdehyde dehydrogenase; Provisional	94.99
PRK08605		332	D-lactate dehydrogenase; Validated	94.95
TIGR01289		314	LPOR light-dependent protochlorophyllide reductase	94.94
PRK13302		271	putative L-aspartate dehydrogenase; Provisional	94.88
COG0002		349	ArgC Acetylglutamate semialdehyde dehydrogenase [A	94.87
COG3967		245	DltE Short-chain dehydrogenase involved in D-alani	94.86
PLN03129		581	NADP-dependent malic enzyme; Provisional	94.84
PRK07791		286	short chain dehydrogenase; Provisional	94.83
PRK15059		292	tartronate semialdehyde reductase; Provisional	94.81
PRK08507		275	prephenate dehydrogenase; Validated	94.78
PRK05671		336	aspartate-semialdehyde dehydrogenase; Reviewed	94.78
PF02882		160	THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl	94.78
TIGR02685		267	pter_reduc_Leis pteridine reductase. Pteridine red	94.75
PRK14192		283	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.63
TIGR00873		467	gnd 6-phosphogluconate dehydrogenase, decarboxylat	94.61
PRK07574		385	formate dehydrogenase; Provisional	94.6
PRK00258		278	aroE shikimate 5-dehydrogenase; Reviewed	94.59
TIGR01692		288	HIBADH 3-hydroxyisobutyrate dehydrogenase. This en	94.55
COG3320		382	Putative dehydrogenase domain of multifunctional n	94.54
PRK13243		333	glyoxylate reductase; Reviewed	94.52
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	94.47
PRK07984		262	enoyl-(acyl carrier protein) reductase; Provisiona	94.44
PRK06199		379	ornithine cyclodeaminase; Validated	94.44
PRK08303		305	short chain dehydrogenase; Provisional	94.4
PLN02712		667	arogenate dehydrogenase	94.4
cd01079		197	NAD_bind_m-THF_DH NAD binding domain of methylene-	94.38
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.38
PRK08818		370	prephenate dehydrogenase; Provisional	94.36
cd05311		226	NAD_bind_2_malic_enz NAD(P) binding domain of mali	94.36
PRK00048		257	dihydrodipicolinate reductase; Provisional	94.35
PRK07370		258	enoyl-(acyl carrier protein) reductase; Validated	94.33
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	94.33
PRK06598		369	aspartate-semialdehyde dehydrogenase; Reviewed	94.31
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	94.3
PRK06046		326	alanine dehydrogenase; Validated	94.29
PRK13940		414	glutamyl-tRNA reductase; Provisional	94.25
COG0345		266	ProC Pyrroline-5-carboxylate reductase [Amino acid	94.24
PRK14175		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.23
PRK13529		563	malate dehydrogenase; Provisional	94.21
PRK15469		312	ghrA bifunctional glyoxylate/hydroxypyruvate reduc	94.2
PLN00016		378	RNA-binding protein; Provisional	94.18
TIGR01035		417	hemA glutamyl-tRNA reductase. This enzyme, togethe	94.14
PRK08664		349	aspartate-semialdehyde dehydrogenase; Reviewed	94.14
PRK08594		257	enoyl-(acyl carrier protein) reductase; Provisiona	94.13
PRK08159		272	enoyl-(acyl carrier protein) reductase; Provisiona	94.09
PRK14179		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.06
smart00822		180	PKS_KR This enzymatic domain is part of bacterial	94.06
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	94.05
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	93.99
PRK14189		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.93
PTZ00317		559	NADP-dependent malic enzyme; Provisional	93.9
PRK00436		343	argC N-acetyl-gamma-glutamyl-phosphate reductase;	93.9
COG2423		330	Predicted ornithine cyclodeaminase, mu-crystallin	93.9
TIGR01850		346	argC N-acetyl-gamma-glutamyl-phosphate reductase,	93.74
PRK00045		423	hemA glutamyl-tRNA reductase; Reviewed	93.73
PRK06603		260	enoyl-(acyl carrier protein) reductase; Provisiona	93.71
PRK05476		425	S-adenosyl-L-homocysteine hydrolase; Provisional	93.68
PRK14806		735	bifunctional cyclohexadienyl dehydrogenase/ 3-phos	93.63
TIGR01500		256	sepiapter_red sepiapterin reductase. This model de	93.62
TIGR03443		1389	alpha_am_amid L-aminoadipate-semialdehyde dehydrog	93.62
PRK10792		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.59
PRK14173		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.4
PLN03139		386	formate dehydrogenase; Provisional	93.4
PRK14193		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.36
COG1712		255	Predicted dinucleotide-utilizing enzyme [General f	93.35
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	93.31
PF00670		162	AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase	93.3
TIGR00465		314	ilvC ketol-acid reductoisomerase. This is the seco	93.29
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	93.26
PLN00203		519	glutamyl-tRNA reductase	93.25
PRK14188		296	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.25
PRK08040		336	putative semialdehyde dehydrogenase; Provisional	93.21
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	93.17
PRK06997		260	enoyl-(acyl carrier protein) reductase; Provisiona	93.15
PRK14176		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.11
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	93.09
PRK03659		601	glutathione-regulated potassium-efflux system prot	93.08
PRK14190		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.05
TIGR01296		339	asd_B aspartate-semialdehyde dehydrogenase (peptid	93.04
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	93.0
PRK13304		265	L-aspartate dehydrogenase; Reviewed	92.97
COG0373		414	HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	92.97
PRK12557		342	H(2)-dependent methylenetetrahydromethanopterin de	92.96
KOG1210		331	consensus Predicted 3-ketosphinganine reductase [S	92.88
PRK14177		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	92.87
PRK14172		278	bifunctional 5,10-methylene-tetrahydrofolate dehyd	92.87
PRK06444		197	prephenate dehydrogenase; Provisional	92.84
KOG0409		327	consensus Predicted dehydrogenase [General functio	92.82
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	92.81
PRK13581		526	D-3-phosphoglycerate dehydrogenase; Provisional	92.79
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	92.77
PLN02928		347	oxidoreductase family protein	92.68
PF00185		158	OTCace: Aspartate/ornithine carbamoyltransferase,	92.63

>TIGR01759 MalateDH-SF1 malate dehydrogenase	Back alignment and domain information

Probab=100.00  E-value=2.2e-70  Score=524.12  Aligned_cols=320  Identities=65%  Similarity=1.010  Sum_probs=290.7

Q ss_pred             CCCCEEEEEcCCCchHHHHHHHHHhcccCCCCCCeEEEEEeCccchHhhhhHHHHHhhhhcCCccceEEeCCHhhhhCCC
Q 017740           37 KEPCRVLVTGATGQIGYALVPMIARGIMLGPDQPVILHMLDIEPAAEALNGVKMELIDAAFPLLKGVVATTDVVEACKDV  116 (366)
Q Consensus        37 ~~~~KI~IiGA~G~vG~~la~~L~~~~~~~~~~~~ei~L~D~~~~~~~l~~~~~dl~~~~~~~~~~v~~t~~l~~al~~a  116 (366)
                      ++|.||+||||+|+||+++++.|+.+++++.+...+++|+|++++.+++.|+++|+.|+..+..+++.++.+.+++++||
T Consensus         1 ~~p~KV~IIGa~G~VG~~~a~~l~~~~~~~~~~~~el~L~Di~~~~~~a~g~a~Dl~~~~~~~~~~~~i~~~~~~~~~da   80 (323)
T TIGR01759         1 KKPVRVAVTGAAGQIGYSLLFRIASGELFGKDQPVVLHLLDIPPAMKALEGVAMELEDCAFPLLAGVVATTDPEEAFKDV   80 (323)
T ss_pred             CCCeEEEEECCCcHHHHHHHHHHHhCCcccCCCccEEEEEecCCcccccchHHHHHhhccccccCCcEEecChHHHhCCC
Confidence            35789999997799999999999988887655566999999976556689999999999865555667777889999999


Q ss_pred             cEEEEecCCCCCCCCChhHHHhhhHHHHHHHHHHHHhhcCCCcEEEEEcCCcchHHHHHHHHCC-CCCCCceeecccchH
Q 017740          117 NIAVMVGGFPRKEGMERKDVMSKNVSIYKAQASALEKHAAPNCKVLVVANPANTNALILKEFAP-SIPAKNITCLTRLDH  195 (366)
Q Consensus       117 DiVIi~aG~~~~~g~~r~~~~~~n~~~~~~i~~~i~~~~~~~~~viv~tNPv~~~t~~~~~~~s-~~~~~ki~~gt~lds  195 (366)
                      |+||++||.|+++|++|.+++..|+++++++++.+.++++|+++++++|||+|+||++++++ + |||++|++|+|.|||
T Consensus        81 DvVVitAG~~~k~g~tR~dll~~Na~i~~~i~~~i~~~~~~~~iiivvsNPvDv~t~v~~k~-s~g~p~~rViG~t~LDs  159 (323)
T TIGR01759        81 DAALLVGAFPRKPGMERADLLSKNGKIFKEQGKALNKVAKKDVKVLVVGNPANTNALIASKN-APDIPPKNFSAMTRLDH  159 (323)
T ss_pred             CEEEEeCCCCCCCCCcHHHHHHHHHHHHHHHHHHHHhhCCCCeEEEEeCCcHHHHHHHHHHH-cCCCCHHHEEEeeHHHH
Confidence            99999999999999999999999999999999999999833999999999999999999998 6 999999666699999


Q ss_pred             HHHHHHHHHHhCCCCCCeeeeEEEccCCCceEeecCCCcccCCCCCcchhhccccCccchHHHHHHHHhhHHHHHHhcCC
Q 017740          196 NRAMGQISERLKVHVSDVKNVIIWGNHSSTQYPDVNHATVTTSKGEKPVREAVADDNWLNTEFITTVQQRGAAIIKARKL  275 (366)
Q Consensus       196 ~R~~~~la~~l~v~~~~v~~~~ViG~hg~~~vp~~S~~~v~~~~~~~p~~~~~~~~~~~~~~i~~~v~~~~~~i~~~kg~  275 (366)
                      +|||+++|++++++|++|++++||||||++++|+||++++    +|+|+.+++.++.|.++++.+++++++++|++.||+
T Consensus       160 ~R~r~~la~~l~v~~~~V~~~~V~GeHG~s~v~~~S~~~v----~g~pl~~~~~~~~~~~~~i~~~v~~~g~~Ii~~kG~  235 (323)
T TIGR01759       160 NRAKYQLAAKAGVPVSDVKNVIIWGNHSNTQVPDFTHATV----DGRPVKEVIKDDKWLEGEFIPTVQQRGAAVIEARGA  235 (323)
T ss_pred             HHHHHHHHHHhCcChHHeEEeEEEecCCCceeeccccCEE----CCccHHHHhcchhhHHHHHHHHHHhhHHHHHhccCC
Confidence            9999999999999999998777899999999999999999    999999998776566789999999999999999999


Q ss_pred             CcHHHHHHHHHHHHHHHHhCCCCCcEEEEEEeeCC-ccCCCCceEEEEeEEEe-CCeEEEecCCCCCHHHHHHHHHHHHH
Q 017740          276 SSALSAASSACDHIRDWVLGTPKGTWVSMGVYSDG-SYGIPEGLIYSFPVTCE-KGEWSIVKGLKVDEFSRAKMDATAEE  353 (366)
Q Consensus       276 s~~~s~a~a~~~~i~~~i~~~~~~~v~~~sv~~~g-~ygi~~~~~~s~Pv~lg-~Gv~~~~~~~~Ls~~E~~~l~~sa~~  353 (366)
                      ++|+++|+++++++++++.+.++++++|+|++++| +||+|+++|||+||++| +|+++++++++|+++|+++|++|++.
T Consensus       236 t~~~~~a~a~~~iv~ail~~~~~~~v~~~s~~~~g~~Yg~~~~v~~s~P~~lg~~Gv~~iv~~l~L~~~E~~~l~~sa~~  315 (323)
T TIGR01759       236 SSAASAANAAIDHVRDWVTGTPEGDWVSMGVYSDGNPYGIPEGIIFSFPVTCKGDGEWEIVEGLPLDDFVRGKLDATEDE  315 (323)
T ss_pred             cchHHHHHHHHHHHHHHHcCCCCCcEEEEEEEeCCcccCCCCCeEEEEEEEEcCCeeEEEcCCCCCCHHHHHHHHHHHHH
Confidence            98878889999988887775323889999999999 99998899999999999 99999996599999999999999999


Q ss_pred             HHHHHHHH
Q 017740          354 LAEEKTLA  361 (366)
Q Consensus       354 i~~~i~~~  361 (366)
                      |+++++++
T Consensus       316 lk~~~~~~  323 (323)
T TIGR01759       316 LLEEKEEA  323 (323)
T ss_pred             HHHHHhcC
Confidence            99999764

This model represents a family of malate dehydrogenases in bacteria and eukaryotes which utilize either NAD or NADP depending on the species and context. MDH interconverts malate and oxaloacetate and is a part of the citric acid cycle as well as the C4 cycle in certain photosynthetic organisms.

>PRK05442 malate dehydrogenase; Provisional	Back alignment and domain information

>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion]	Back alignment and domain information

>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent	Back alignment and domain information

>PLN00112 malate dehydrogenase (NADP); Provisional	Back alignment and domain information

>cd00704 MDH Malate dehydrogenase	Back alignment and domain information

>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases	Back alignment and domain information

>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases	Back alignment and domain information

>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent	Back alignment and domain information

>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>cd05295 MDH_like Malate dehydrogenase-like	Back alignment and domain information

>PLN00135 malate dehydrogenase	Back alignment and domain information

>TIGR01771 L-LDH-NAD L-lactate dehydrogenase	Back alignment and domain information

>PLN02602 lactate dehydrogenase	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>TIGR01756 LDH_protist lactate dehydrogenase	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>cd00300 LDH_like L-lactate dehydrogenase-like enzymes	Back alignment and domain information

>PTZ00117 malate dehydrogenase; Provisional	Back alignment and domain information

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent	Back alignment and domain information

>PTZ00082 L-lactate dehydrogenase; Provisional	Back alignment and domain information

>KOG1496 consensus Malate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases	Back alignment and domain information

>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity	Back alignment and domain information

>PTZ00325 malate dehydrogenase; Provisional	Back alignment and domain information

>PRK06223 malate dehydrogenase; Reviewed	Back alignment and domain information

>PRK05086 malate dehydrogenase; Provisional	Back alignment and domain information

>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins	Back alignment and domain information

>PLN00106 malate dehydrogenase	Back alignment and domain information

>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family	Back alignment and domain information

>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PF02866 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta C-terminal domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR022383 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4	Back alignment and domain information

>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases	Back alignment and domain information

>PRK15076 alpha-galactosidase; Provisional	Back alignment and domain information

>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase	Back alignment and domain information

>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases	Back alignment and domain information

>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms]	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PLN02166 dTDP-glucose 4,6-dehydratase	Back alignment and domain information

>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones

Back alignment and domain information

>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]	Back alignment and domain information

>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases	Back alignment and domain information

>PLN02650 dihydroflavonol-4-reductase	Back alignment and domain information

>TIGR01915 npdG NADPH-dependent F420 reductase	Back alignment and domain information

>PLN02662 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PLN02206 UDP-glucuronate decarboxylase	Back alignment and domain information

>PLN02583 cinnamoyl-CoA reductase	Back alignment and domain information

>PLN02427 UDP-apiose/xylose synthase	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PLN02353 probable UDP-glucose 6-dehydrogenase	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PLN00198 anthocyanidin reductase; Provisional	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional	Back alignment and domain information

>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ	Back alignment and domain information

>PLN02695 GDP-D-mannose-3',5'-epimerase	Back alignment and domain information

>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PLN02989 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism]	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+))	Back alignment and domain information

>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC	Back alignment and domain information

>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase	Back alignment and domain information

>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02214 cinnamoyl-CoA reductase	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated	Back alignment and domain information

>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase	Back alignment and domain information

>PLN02986 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PLN02545 3-hydroxybutyryl-CoA dehydrogenase	Back alignment and domain information

>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional	Back alignment and domain information

>PLN02572 UDP-sulfoquinovose synthase	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>PLN02778 3,5-epimerase/4-reductase	Back alignment and domain information

>TIGR01472 gmd GDP-mannose 4,6-dehydratase	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>PLN02896 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism]	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional	Back alignment and domain information

>TIGR03466 HpnA hopanoid-associated sugar epimerase	Back alignment and domain information

>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>PLN02240 UDP-glucose 4-epimerase	Back alignment and domain information

>TIGR01777 yfcH conserved hypothetical protein TIGR01777	Back alignment and domain information

>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>PRK10675 UDP-galactose-4-epimerase; Provisional	Back alignment and domain information

>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]	Back alignment and domain information

>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase	Back alignment and domain information

>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

>PLN02653 GDP-mannose 4,6-dehydratase	Back alignment and domain information

>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion]	Back alignment and domain information

>PRK07806 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02260 probable rhamnose biosynthetic enzyme	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase	Back alignment and domain information

>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase	Back alignment and domain information

>PLN02686 cinnamoyl-CoA reductase	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07201 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK07067 sorbitol dehydrogenase; Provisional	Back alignment and domain information

>PRK14982 acyl-ACP reductase; Provisional	Back alignment and domain information

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]	Back alignment and domain information

>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06180 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK10538 malonic semialdehyde reductase; Provisional	Back alignment and domain information

>PRK09135 pteridine reductase; Provisional	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05717 oxidoreductase; Validated	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06482 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK05865 hypothetical protein; Provisional	Back alignment and domain information

>PRK05875 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12320 hypothetical protein; Provisional	Back alignment and domain information

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK08655 prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06128 oxidoreductase; Provisional	Back alignment and domain information

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated	Back alignment and domain information

>TIGR01179 galE UDP-glucose-4-epimerase	Back alignment and domain information

>PRK07102 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06500 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12746 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07680 late competence protein ComER; Validated	Back alignment and domain information

>PRK06172 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06138 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PLN00141 Tic62-NAD(P)-related group II protein; Provisional	Back alignment and domain information

>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate	Back alignment and domain information

>PRK05866 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08219 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02253 xanthoxin dehydrogenase	Back alignment and domain information

>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08085 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK07825 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02780 ketoreductase/ oxidoreductase	Back alignment and domain information

>PRK07576 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08628 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07890 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08263 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08643 acetoin reductase; Validated	Back alignment and domain information

>COG2910 Putative NADH-flavin reductase [General function prediction only]	Back alignment and domain information

>PRK06196 oxidoreductase; Provisional	Back alignment and domain information

>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional	Back alignment and domain information

>PLN02260 probable rhamnose biosynthetic enzyme	Back alignment and domain information

>PRK06101 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02996 fatty acyl-CoA reductase	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase	Back alignment and domain information

>PRK07453 protochlorophyllide oxidoreductase; Validated	Back alignment and domain information

>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]	Back alignment and domain information

>PRK07814 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07856 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>PRK06701 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK07069 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK06181 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01746 Thioester-redct thioester reductase domain	Back alignment and domain information

>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional	Back alignment and domain information

>PRK07478 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05884 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08278 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK08339 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06197 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12367 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase	Back alignment and domain information

>PRK07679 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK09134 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05993 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>PRK07063 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07985 oxidoreductase; Provisional	Back alignment and domain information

>PRK07454 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07035 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09291 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06179 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05650 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05867 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08226 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK11880 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1	Back alignment and domain information

>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated	Back alignment and domain information

>PRK06928 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK07904 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08264 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK12742 oxidoreductase; Provisional	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08277 D-mannonate oxidoreductase; Provisional	Back alignment and domain information

>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase	Back alignment and domain information

>PRK12935 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK12491 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK07634 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06139 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05872 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]	Back alignment and domain information

>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]	Back alignment and domain information

>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>PRK12747 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PLN02688 pyrroline-5-carboxylate reductase	Back alignment and domain information

>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PRK06125 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05693 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>PRK07832 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08340 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK12480 D-lactate dehydrogenase; Provisional	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09186 flagellin modification protein A; Provisional	Back alignment and domain information

>PRK12744 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>PRK06914 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06114 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase	Back alignment and domain information

>PLN02503 fatty acyl-CoA reductase 2	Back alignment and domain information

>PRK06523 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07109 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PRK08251 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12827 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09242 tropinone reductase; Provisional	Back alignment and domain information

>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1	Back alignment and domain information

>PRK08324 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated	Back alignment and domain information

>PRK07097 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK08589 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK06198 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06398 aldose dehydrogenase; Validated	Back alignment and domain information

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family	Back alignment and domain information

>PRK07578 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06924 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02415 23BDH acetoin reductases	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase	Back alignment and domain information

>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	Back alignment and domain information

>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06484 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK06953 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08177 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]	Back alignment and domain information

>PRK07023 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK06545 prephenate dehydrogenase; Validated	Back alignment and domain information

>PRK12824 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06720 hypothetical protein; Provisional	Back alignment and domain information

>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK07775 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08703 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07677 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06484 short chain dehydrogenase; Validated	Back alignment and domain information

>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism]	Back alignment and domain information

>PRK06947 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07062 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12743 oxidoreductase; Provisional	Back alignment and domain information

>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>PRK06940 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>PRK07577 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12938 acetyacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK08936 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type	Back alignment and domain information

>PRK06123 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase	Back alignment and domain information

>PRK07201 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09009 C factor cell-cell signaling protein; Provisional	Back alignment and domain information

>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila	Back alignment and domain information

>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e	Back alignment and domain information

>PRK06407 ornithine cyclodeaminase; Provisional	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>PRK05854 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07041 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08291 ectoine utilization protein EutC; Validated	Back alignment and domain information

>PRK07831 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08862 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme	Back alignment and domain information

>PRK08618 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02350 phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline []	Back alignment and domain information

>PTZ00431 pyrroline carboxylate reductase; Provisional	Back alignment and domain information

>PRK06476 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK06483 dihydromonapterin reductase; Provisional	Back alignment and domain information

>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase	Back alignment and domain information

>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein	Back alignment and domain information

>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional	Back alignment and domain information

>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>TIGR02992 ectoine_eutC ectoine utilization protein EutC	Back alignment and domain information

>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative	Back alignment and domain information

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase	Back alignment and domain information

>PRK07589 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PLN02383 aspartate semialdehyde dehydrogenase	Back alignment and domain information

>PRK06141 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>PRK06823 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK05479 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PRK08017 oxidoreductase; Provisional	Back alignment and domain information

>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK07340 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional	Back alignment and domain information

>PRK05599 hypothetical protein; Provisional	Back alignment and domain information

>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism]	Back alignment and domain information

>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PRK08605 D-lactate dehydrogenase; Validated	Back alignment and domain information

>TIGR01289 LPOR light-dependent protochlorophyllide reductase	Back alignment and domain information

>PRK13302 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN03129 NADP-dependent malic enzyme; Provisional	Back alignment and domain information

>PRK07791 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK15059 tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK08507 prephenate dehydrogenase; Validated	Back alignment and domain information

>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF)	Back alignment and domain information

>TIGR02685 pter_reduc_Leis pteridine reductase	Back alignment and domain information

>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating	Back alignment and domain information

>PRK07574 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase	Back alignment and domain information

>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK13243 glyoxylate reductase; Reviewed	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06199 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK08303 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK08818 prephenate dehydrogenase; Provisional	Back alignment and domain information

>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2	Back alignment and domain information

>PRK00048 dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>PRK07370 enoyl-(acyl carrier protein) reductase; Validated	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>PRK06046 alanine dehydrogenase; Validated	Back alignment and domain information

>PRK13940 glutamyl-tRNA reductase; Provisional	Back alignment and domain information

>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK13529 malate dehydrogenase; Provisional	Back alignment and domain information

>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional	Back alignment and domain information

>PLN00016 RNA-binding protein; Provisional	Back alignment and domain information

>TIGR01035 hemA glutamyl-tRNA reductase	Back alignment and domain information

>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PTZ00317 NADP-dependent malic enzyme; Provisional	Back alignment and domain information

>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated	Back alignment and domain information

>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form	Back alignment and domain information

>PRK00045 hemA glutamyl-tRNA reductase; Reviewed	Back alignment and domain information

>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional	Back alignment and domain information

>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional	Back alignment and domain information

>TIGR01500 sepiapter_red sepiapterin reductase	Back alignment and domain information

>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase	Back alignment and domain information

>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN03139 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3	Back alignment and domain information

>TIGR00465 ilvC ketol-acid reductoisomerase	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>PLN00203 glutamyl-tRNA reductase	Back alignment and domain information

>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK08040 putative semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional	Back alignment and domain information

>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms)	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>PRK13304 L-aspartate dehydrogenase; Reviewed	Back alignment and domain information

>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional	Back alignment and domain information

>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK06444 prephenate dehydrogenase; Provisional	Back alignment and domain information

>KOG0409 consensus Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PLN02928 oxidoreductase family protein	Back alignment and domain information

>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		366
4mdh_A		334	Refined Crystal Structure Of Cytoplasmic Malate Deh		1e-103
5mdh_A		333	Crystal Structure Of Ternary Complex Of Porcine Cyt		1e-103
1iz9_A		327	Crystal Structure Of Malate Dehydrogenase From Ther		9e-87
1bmd_A		327	Determinants Of Protein Thermostability Observed In		1e-86
1wze_A		327	Structural Basis For Alteration Of Cofactor Specifi		5e-86
1bdm_A		327	The Structure At 1.8 Angstroms Resolution Of A Sing		7e-86
4h7p_A		345	Crystal Structure Of A Putative Cytosolic Malate De		1e-85
3d5t_A		331	Crystal Structure Of Malate Dehydrogenase From Burk		6e-85
1b8p_A		329	Malate Dehydrogenase From Aquaspirillum Arcticum Le		1e-84
1civ_A		385	Chloroplast Nadp-Dependent Malate Dehydrogenase Fro		2e-60
7mdh_A		375	Structural Basis For Light Acitvation Of A Chloropl		3e-59
3fi9_A		343	Crystal Structure Of Malate Dehydrogenase From Porp		7e-16
3gvh_A		324	Crystal Structure Of LactateMALATE DEHYDROGENASE FR		3e-09
3nep_X		314	1.55a Resolution Structure Of Malate Dehydrogenase		4e-09
1hyg_A		313	Crystal Structure Of Mj0490 Gene Product, The Famil		2e-08
1gv1_A		310	Structural Basis For Thermophilic Protein Stability		2e-07
3p7m_A		321	Structure Of Putative Lactate Dehydrogenase From Fr		5e-07
1gv0_A		310	Structural Basis For Thermophilic Protein Stability		6e-07
1guz_A		310	Structural Basis For Thermophilic Protein Stability		7e-07
2hjr_A		328	Crystal Structure Of Cryptosporidium Parvum Malate		9e-07
1mld_A		314	Refined Structure Of Mitochondrial Malate Dehydroge		1e-06
2dfd_A		342	Crystal Structure Of Human Malate Dehydrogenase Typ		1e-06
3tl2_A		315	Crystal Structure Of Bacillus Anthracis Str. Ames M		1e-06
1ez4_A		318	Crystal Structure Of Non-Allosteric L-Lactate Dehyd		2e-06
2v65_A		331	Apo Ldh From The Psychrophile C. Gunnari Length = 3		2e-06
1uxh_A		309	Large Improvement In The Thermal Stability Of A Tet		2e-06
1guy_A		309	Structural Basis For Thermophilic Protein Stability		2e-06
1uxi_A		309	Large Improvement In The Thermal Stability Of A Tet		2e-06
1y6j_A		318	L-Lactate Dehydrogenase From Clostridium Thermocell		5e-06
1v6a_A		332	Crystal Structure Of L-Lactate Dehydrogenase From C		8e-06
5ldh_A		334	Structure Of The Active Ternary Complex Of Pig Hear		9e-06
1ur5_A		309	Stabilization Of A Tetrameric Malate Dehydrogenase		1e-05
9ldt_A		332	Design And Synthesis Of New Enzymes Based On The La		1e-05
3pqd_A		326	Crystal Structure Of L-Lactate Dehydrogenase From B		2e-05
3h3f_A		331	Rabbit Muscle L-Lactate Dehydrogenase In Complex Wi		3e-05
1i10_A		331	Human Muscle L-Lactate Dehydrogenase M Chain, Terna		4e-05
4ajp_A		337	Human Ldha In Complex With 2-((4-(4-((3-((2-Methyl-		4e-05
4e0b_A		313	2.17 Angstrom Resolution Crystal Structure Of Malat		4e-05
1t2f_A		333	Human B Lactate Dehydrogenase Complexed With Nad+ A		4e-05
3pqe_A		326	Crystal Structure Of L-Lactate Dehydrogenase From B		5e-05
2zqy_A		326	T-State Structure Of Allosteric L-Lactate Dehydroge		5e-05
1i0z_A		333	Human Heart L-Lactate Dehydrogenase H Chain, Ternar		5e-05
1llc_A		325	Structure Determination Of The Allosteric L-Lactate		7e-05
2pwz_A		312	Crystal Structure Of The Apo Form Of E.Coli Malate		7e-05
6ldh_A		330	Refined Crystal Structure Of Dogfish M4 Apo-Lactate		8e-05
1ldm_A		329	Refined Crystal Structure Of Dogfish M4 Apo-Lactate		8e-05
1emd_A		312	Crystal Structure Of A Ternary Complex Of Escherich		9e-05
4aj1_A		331	Rat Ldha In Complex With N-(2-(Methylamino)-1,3- Be		1e-04
4aj4_A		332	Rat Ldha In Complex With 4-((2-Allylsulfanyl-1,3-Be		1e-04
1ib6_A		312	Crystal Structure Of R153c E. Coli Malate Dehydroge		2e-04
3vku_A		326	Penta Mutant Of Lactobacillus Casei Lactate Dehydro		2e-04
3d0o_A		317	Crystal Structure Of Lactate Dehydrogenase From Sta		4e-04
2x0i_A		294	2.9 A Resolution Structure Of Malate Dehydrogenase		4e-04
2ldx_A		331	Characterization Of The Antigenic Sites On The Refi		5e-04
3h3j_A		317	Crystal Structure Of Lactate Dehydrogenase Mutant (		5e-04
2j5k_A		304	2.0 A Resolution Structure Of The Wild Type Malate		7e-04
2x0r_A		304	R207s,R292s Mutant Of Malate Dehydrogenase From The		7e-04
2hlp_A		303	Crystal Structure Of The E267r Mutant Of A Halophil		7e-04
1o6z_A		303	1.95 A Resolution Structure Of (r207s,r292s) Mutant		7e-04
1hlp_A		303	Structural Features Stabilizing Halophilic Malate D		7e-04

>pdb|4MDH|A Chain A, Refined Crystal Structure Of Cytoplasmic Malate Dehydrogenase At 2.5-Angstroms Resolution Length = 334