Citrus Sinensis ID: 017863

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MDQETQKSNRNDDNLSQVNCVISENSRYSVNRVALDTVAAANSVEAVSIGGGIDDFGSKTDDPGSSRALVEAQEVVINHDTCTSRVIGENSSNPVDGVSLETVAVRNSEQNTGFTEENGRLGLKIDKMVSSGAVVNAPETCNGQGTDERRQTDPESSGNSSHVGDVVVPVIVINSNQTACSGGENRDLEVKSNDLGSGKALVENSIRKMSKPETEKESCVIDMKCSAGGGKGFRENPDGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAKNITGVGDYRFMEEWNERRFIASSSASERGGCWRGQPFCNFLMACLVIAFVLPWFFRVNMF
ccHHHHcccccccccccHHHHHccccccccccHHHHHHHHccccccEEEEccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccEEEEccccccccHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccc
ccccccccccccccccHEccccccccccccccEEEEEEEEEcccccEEEccEEHcccccccccccccccccHEEEEEccccccccEEccccccccccEEEEEEEEEEcccccccccccccEEEEEccccccccccccccHcccccccccccccccccccccccccEEEcEEEEcccccccccccccccccccccccccccccccEEEEEccccccccccEEEcccccccccccccccccccEEEEEEEEccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEccEEEEEccccccHHHHHHccccccccccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHccc
mdqetqksnrnddnlsqvncvisensrysvNRVALDTVAAANSVEAvsigggiddfgsktddpgssrALVEAQEVVinhdtctsrvigenssnpvdgvSLETVAVRnseqntgfteengrlglkIDKMvssgavvnapetcngqgtderrqtdpessgnsshvgdvVVPVIVInsnqtacsggenrdlevksndlgsgKALVENSIrkmskpetekescvidmkcsagggkgfrenpdgervcrichlgseqllettatASTTVNLIQLgcgckdelgvaHSDCAEAWFKLKgnrlceicgqsaknitgvgdyRFMEEWNERRFIAsssaserggcwrgqpfcNFLMACLVIAFVLPWFFRVNMF
mdqetqksnrnddnlsqvNCVISENSRYSVNRVALDTVAAANSVEAVSIGGGIDDFGSKTDDPGSSRALVEAQEVVINHdtctsrvigenssnpvdgvSLETVAVrnseqntgfteengrlglKIDKMVSSGAVVnapetcngqgtderrqtdpessgnsshvgDVVVPVIVINSNqtacsggenrdlevksndlgsgkalvensirkmskpetekescvidmkcsagggkgfrenpDGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEIcgqsaknitgvGDYRFMEEWNERRFIASSSASERGGCWRGQPFCNFLMACLVIAFVLPWFFRVNMF
MDQETQKSNRNDDNLSQVNCVISENSRYSVNRVALDTVAAANSVEAVSIGGGIDDFGSKTDDPGSSRALVEAQEVVINHDTCTSRVIGENSSNPVDGVSLETVAVRNSEQNTGFTEENGRLGLKIDKMVSSGAVVNAPETCNGQGTDERRQTDPESSGNSSHvgdvvvpvivINSNQTACSGGENRDLEVKSNDLGSGKALVENSIRKMSKPETEKESCVIDMKCSAGGGKGFRENPDGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAKNITGVGDYRFMEEWNERRFIASSSASERGGCWRGQPFCNFLMACLVIAFVLPWFFRVNMF
*****************VNCVISENSRYSVNRVALDTVAAANSVEAVSIGGGIDD**************VEAQEVVINHDTCTSRVI***************************************************************************VGDVVVPVIVINSN*******************************************VID****************GERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAKNITGVGDYRFMEEWNERRFIASSSASERGGCWRGQPFCNFLMACLVIAFVLPWFFRVN**
****************************************ANSVEA*S************************************************************************************************************************************************************************************************RVCRICHLGSE*************NLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAKNITGVGDYRFM*******************CWRGQPFCNFLMACLVIAFVLPWFFRVNMF
************DNLSQVNCVISENSRYSVNRVALDTVAAANSVEAVSIGGGIDDFGSKTDDPGSSRALVEAQEVVINHDTCTSRVIGENSSNPVDGVSLETVAVRNSEQNTGFTEENGRLGLKIDKMVSSGAVVNAPETC********************HVGDVVVPVIVINSNQTACSGGENRDLEVKSNDLGSGKALVENSIR************VIDMKCSAGGGKGFRENPDGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAKNITGVGDYRFMEEWNERRFIASSSASERGGCWRGQPFCNFLMACLVIAFVLPWFFRVNMF
**********NDDNLSQVNCVISENSRYSVNRVALDTVAAANSVEAVSIGGGIDDFGS******SSRALVEAQEVVINHDTCTSRVIGENSSNPVDGVSLETVAVRNSEQNTGF*EENGRLGLKIDKMVSSGAVVNAPETC*********************VGDVVVPVIVINSN*************************VENSIRKMSKPET**ESCVIDMKCSAGG**GFRENPDGERVCRICHLGSEQ**********TVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAKNITGVGDYRFMEEWN**************GCWRGQPFCNFLMACLVIAFVLPWFFRVNMF
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQETQKSNRNDDNLSQVNCVISENSRYSVNRVALDTVAAANSVEAVSIGGGIDDFGSKTDDPGSSRALVEAQEVVINHDTCTSRVIGENSSNPVDGVSLETVAVRNSEQNTGFTEENGRLGLKIDKMVSSGAVVNAPETCNGQGTDERRQTDPESSGNSSHVGDVVVPVIVINSNQTACSGGENRDLEVKSNDLGSGKALVENSIRKMSKPETEKESCVIDMKCSAGGGKGFRENPDGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAKNITGVGDYRFMEEWNERRFIASSSASERGGCWRGQPFCNFLMACLVIAFVLPWFFRVNMF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
255562454436 hypothetical protein RCOM_1250150 [Ricin 0.917 0.768 0.445 5e-65
356512517310 PREDICTED: uncharacterized protein LOC10 0.517 0.609 0.6 1e-61
356509896289 PREDICTED: uncharacterized protein LOC10 0.594 0.750 0.548 5e-61
255639416254 unknown [Glycine max] 0.580 0.834 0.554 6e-61
224116820378 predicted protein [Populus trichocarpa] 0.942 0.910 0.436 2e-56
357519001310 hypothetical protein MTR_8g086550 [Medic 0.569 0.670 0.529 9e-56
449508581274 PREDICTED: uncharacterized protein LOC10 0.520 0.693 0.592 2e-55
357475447310 hypothetical protein MTR_4g086500 [Medic 0.6 0.706 0.483 8e-55
297740525219 unnamed protein product [Vitis vinifera] 0.358 0.598 0.733 4e-51
388497614146 unknown [Medicago truncatula] 0.386 0.965 0.655 5e-50
>gi|255562454|ref|XP_002522233.1| hypothetical protein RCOM_1250150 [Ricinus communis] gi|223538486|gb|EEF40091.1| hypothetical protein RCOM_1250150 [Ricinus communis] Back     alignment and taxonomy information
 Score =  254 bits (649), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 166/373 (44%), Positives = 219/373 (58%), Gaps = 38/373 (10%)

Query: 1   MDQETQKSNRNDDNLSQVNCVISENS----RYSVNRVALDTVAAANSVEAVSIGGGIDDF 56
           MD++  +   N  +  QVN   + N+      S +RV  +     N  ++VS GG I   
Sbjct: 1   MDKKCDEKKTNVGSFCQVNQGTNRNTTGETSNSDHRVVSENSVVLNPEDSVSAGGEIRAL 60

Query: 57  GSKTDDPGSSRALVEAQEVVINHDTCTSRVIGE--------NSSNPVDGVSLETVAVRNS 108
            +  +  GS+   V+       H+      I E        NSS  V+ V LE + V NS
Sbjct: 61  DANVNGLGSTMTAVD-------HEASGGMGIREPLDQGTSGNSSYLVNEVVLERMIVINS 113

Query: 109 EQNTGFTEENGRLGLKIDKMVSSGAVVNAPETC---NGQGTDERRQT---DPESSGNSSH 162
            +    + E+  +G+ ID +  +G V +        N +  D+  Q    DP  S N   
Sbjct: 114 GEIVSISGEHKHIGINIDDLGLTGIVSDQKTWVTRGNAETVDKVGQVSHQDPSISSN--- 170

Query: 163 VGDVVV-PVIVINSNQTACSGGENRDLEVKSNDLGSGKALVENSIRKMSKPETEKESCVI 221
             DVVV  VI++NS +     G N  LE+K  +LG GK +V+ S +K+  P  EK+SCVI
Sbjct: 171 --DVVVETVILVNSEENPSISGGNDHLEIKGRELGPGKVMVDKSKKKV--PRGEKQSCVI 226

Query: 222 DMKCSAGGGKGFRENPDGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAH 281
           D+KC   G  GF++  DGE VCRICHL SE + ETTAT S+ + LIQLGCGCKDELG+AH
Sbjct: 227 DVKCGEVG-SGFKD-CDGESVCRICHLSSEVMQETTATNSS-MELIQLGCGCKDELGIAH 283

Query: 282 SDCAEAWFKLKGNRLCEICGQSAKNITGVGDYRFMEEWNERRFIASSSASER--GGCWRG 339
           + CAEAWFKLKGNR+CEICG++AKN+TGV D RFMEEWNERR I+++S+S    GGCWRG
Sbjct: 284 AYCAEAWFKLKGNRICEICGETAKNVTGVRDNRFMEEWNERRIISTNSSSPEGGGGCWRG 343

Query: 340 QPFCNFLMACLVI 352
           QPFCNFLMACL I
Sbjct: 344 QPFCNFLMACLKI 356

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356512517|ref|XP_003524965.1| PREDICTED: uncharacterized protein LOC100791129 [Glycine max] Back     alignment and taxonomy information
>gi|356509896|ref|XP_003523678.1| PREDICTED: uncharacterized protein LOC100776373 [Glycine max] Back     alignment and taxonomy information
>gi|255639416|gb|ACU20003.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224116820|ref|XP_002317402.1| predicted protein [Populus trichocarpa] gi|222860467|gb|EEE98014.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357519001|ref|XP_003629789.1| hypothetical protein MTR_8g086550 [Medicago truncatula] gi|355523811|gb|AET04265.1| hypothetical protein MTR_8g086550 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449508581|ref|XP_004163353.1| PREDICTED: uncharacterized protein LOC101232122 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357475447|ref|XP_003608009.1| hypothetical protein MTR_4g086500 [Medicago truncatula] gi|355509064|gb|AES90206.1| hypothetical protein MTR_4g086500 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297740525|emb|CBI30707.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388497614|gb|AFK36873.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
TAIR|locus:2040949222 AT2G34200 [Arabidopsis thalian 0.315 0.518 0.491 9.4e-27
TAIR|locus:2166399204 AT5G05830 [Arabidopsis thalian 0.484 0.867 0.345 3.3e-24
TAIR|locus:2154523231 AT5G59000 "AT5G59000" [Arabido 0.257 0.406 0.479 1e-23
TAIR|locus:2150084206 AT5G01070 [Arabidopsis thalian 0.361 0.640 0.385 7e-22
TAIR|locus:2065620207 AT2G37950 [Arabidopsis thalian 0.315 0.555 0.406 3e-21
TAIR|locus:2175158 494 AT5G60580 [Arabidopsis thalian 0.306 0.226 0.341 4.3e-09
TAIR|locus:2160619 367 SHA1 "shoot apical meristem ar 0.271 0.269 0.366 5.6e-07
TAIR|locus:505006592 370 AT5G08750 [Arabidopsis thalian 0.230 0.227 0.358 1.6e-06
TAIR|locus:2075064 491 AT3G09760 [Arabidopsis thalian 0.180 0.134 0.355 4.5e-06
TAIR|locus:2144890411 AT5G18760 "AT5G18760" [Arabido 0.295 0.262 0.297 5.5e-06
TAIR|locus:2040949 AT2G34200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 301 (111.0 bits), Expect = 9.4e-27, P = 9.4e-27
 Identities = 61/124 (49%), Positives = 79/124 (63%)

Query:   239 GERVCRICHLGSEQLLETTAT-ASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLC 297
             GER+CRICH GS+Q  E +    S +  LI++GC CK+ELG+AH  CAEAWFKL+GN +C
Sbjct:    98 GERICRICHFGSDQSPEASGDDKSVSPELIEIGCKCKNELGLAHFHCAEAWFKLRGNSVC 157

Query:   298 EICGQSAKNITGVGDYRFMEEWNERRFIASSSASERGGCWRGQPFCNFLMACLVIAFVLP 357
             EICG +AKN+T     R ME+W+  R         RG   RGQ  C F++  L I  +L 
Sbjct:   158 EICGCTAKNVT----VRLMEDWSGERDNTLDGRRRRG---RGQSCCIFMVFLLTI-LLLH 209

Query:   358 WFFR 361
             WFF+
Sbjct:   210 WFFK 213
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0016020 "membrane" evidence=IDA
TAIR|locus:2166399 AT5G05830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154523 AT5G59000 "AT5G59000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150084 AT5G01070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065620 AT2G37950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160619 SHA1 "shoot apical meristem arrest 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006592 AT5G08750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075064 AT3G09760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144890 AT5G18760 "AT5G18760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 2e-10
pfam1290647 pfam12906, RINGv, RING-variant domain 2e-09
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 55.4 bits (134), Expect = 2e-10
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 11/60 (18%)

Query: 242 VCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICG 301
           +CRICH   ++              +   C CK  L   H +C E W    GN+ CEIC 
Sbjct: 1   ICRICHDEGDEGDP-----------LVSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
PHA02825162 LAP/PHD finger-like protein; Provisional 99.73
PHA02862156 5L protein; Provisional 99.64
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.61
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.58
KOG3053 293 consensus Uncharacterized conserved protein [Funct 99.56
KOG1609 323 consensus Protein involved in mRNA turnover and st 99.51
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.32
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.61
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.96
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.82
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.68
PHA02929238 N1R/p28-like protein; Provisional 96.53
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.49
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.31
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.07
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 95.93
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.81
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.62
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 95.51
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 95.44
PHA02926242 zinc finger-like protein; Provisional 95.32
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 95.16
smart0050463 Ubox Modified RING finger domain. Modified RING fi 94.63
COG52191525 Uncharacterized conserved protein, contains RING Z 93.88
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 93.61
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 91.58
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 91.34
KOG149384 consensus Anaphase-promoting complex (APC), subuni 90.03
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 89.98
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 89.2
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 88.59
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 87.24
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 85.73
PF1463444 zf-RING_5: zinc-RING finger domain 85.72
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 83.22
PLN02189 1040 cellulose synthase 82.94
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 82.66
COG5175 480 MOT2 Transcriptional repressor [Transcription] 81.75
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 80.02
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information 
Probab=99.73  E-value=2.7e-18  Score=154.06  Aligned_cols=100  Identities=21%  Similarity=0.503  Sum_probs=73.3

Q ss_pred             CCCCCCceeEcccCCcccccccccccCCCccccccccCcCccccccHHHHHHHHHHhCCccccccccccccccccCchhh
Q 017863          236 NPDGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAKNITGVGDYRF  315 (365)
Q Consensus       236 s~e~E~~CRICh~~~e~~~e~~~~~~~s~~LI~lPC~CKGSLkyVH~~CLe~W~k~Kgn~~CEICk~~y~nV~~~~~~~f  315 (365)
                      ....++.||||+++.+              .+..||+|+|+++|||++||++|+..+++..||+|+++|.....   .+.
T Consensus         4 ~s~~~~~CRIC~~~~~--------------~~~~PC~CkGs~k~VH~sCL~rWi~~s~~~~CeiC~~~Y~i~~~---~kp   66 (162)
T PHA02825          4 VSLMDKCCWICKDEYD--------------VVTNYCNCKNENKIVHKECLEEWINTSKNKSCKICNGPYNIKKN---YKK   66 (162)
T ss_pred             cCCCCCeeEecCCCCC--------------CccCCcccCCCchHHHHHHHHHHHhcCCCCcccccCCeEEEEEe---cCC
Confidence            3456899999997743              13469999999999999999999999999999999999976653   233


Q ss_pred             HHHHhhhhhccCCCcccccceeeccchHHHHHHHHHHHHHhhheeeecc
Q 017863          316 MEEWNERRFIASSSASERGGCWRGQPFCNFLMACLVIAFVLPWFFRVNM  364 (365)
Q Consensus       316 leeW~~~rf~~s~~~~~~rrfW~g~~fcNFLLAcmViAFVi~WlF~f~v  364 (365)
                      +.+|.+..          +.|  ..+...+.+.|++.+.+---|.+||+
T Consensus        67 l~~W~~~~----------~dc--~~~~l~~~llcl~~~~i~~~l~~~~i  103 (162)
T PHA02825         67 CTKWRCSF----------RDC--HDSAIVNSLLCLIVGGITYLLVSFNI  103 (162)
T ss_pred             CccccccC----------cch--hhHHHHHHHHHHHHhhhhheeeehhh
Confidence            56887542          111  23555677777777776555556654

>PHA02862 5L protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 2e-12
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 60.5 bits (147), Expect = 2e-12
 Identities = 17/66 (25%), Positives = 21/66 (31%), Gaps = 13/66 (19%)

Query: 237 PDGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRL 296
            +   VC IC+                       CGC  EL   H  C   W  +  N  
Sbjct: 3   DEDVPVCWICNEELGNERFR-------------ACGCTGELENVHRSCLSTWLTISRNTA 49

Query: 297 CEICGQ 302
           C+ICG 
Sbjct: 50  CQICGV 55
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.7
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.58
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.21
2ect_A78 Ring finger protein 126; metal binding protein, st 98.09
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.02
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.88
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.87
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.8
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.79
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.77
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.77
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.67
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.67
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.66
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.66
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.66
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.63
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.61
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.58
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.57
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.52
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.5
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.49
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.42
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.4
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.37
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.37
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.28
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.23
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.21
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.18
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.1
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.93
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 96.78
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 96.75
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 96.72
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 96.68
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 96.68
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.52
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.49
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 96.48
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.44
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.4
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.23
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.97
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 95.94
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 95.91
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 95.7
3nw0_A238 Non-structural maintenance of chromosomes element 95.38
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.32
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 95.16
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.02
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 94.88
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.77
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 94.53
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 94.39
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 94.19
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 93.93
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 93.89
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 93.73
2f42_A179 STIP1 homology and U-box containing protein 1; cha 93.44
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 93.07
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 93.03
2ea5_A68 Cell growth regulator with ring finger domain prot 92.77
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 91.13
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 88.96
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 88.12
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 81.35
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 81.31
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.70  E-value=5.6e-18  Score=127.42  Aligned_cols=55  Identities=31%  Similarity=0.747  Sum_probs=48.2

Q ss_pred             CCCCceeEcccCCcccccccccccCCCccccccccCcCccccccHHHHHHHHHHhCCccccccccccc
Q 017863          238 DGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAK  305 (365)
Q Consensus       238 e~E~~CRICh~~~e~~~e~~~~~~~s~~LI~lPC~CKGSLkyVH~~CLe~W~k~Kgn~~CEICk~~y~  305 (365)
                      +++..||||+.+.+            ++++ +||+|+|+++|||+.||++|++.+++.+||+|+++|.
T Consensus         4 ~~~~~CrIC~~~~~------------~~l~-~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~   58 (60)
T 1vyx_A            4 EDVPVCWICNEELG------------NERF-RACGCTGELENVHRSCLSTWLTISRNTACQICGVVYN   58 (60)
T ss_dssp             CSCCEETTTTEECS------------CCCC-CSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCC
T ss_pred             CCCCEeEEeecCCC------------Ccee-cCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeee
Confidence            46789999998632            3354 6999999999999999999999999999999999995
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.004
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 33.3 bits (75), Expect = 0.004
 Identities = 18/65 (27%), Positives = 22/65 (33%), Gaps = 13/65 (20%)

Query: 238 DGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLC 297
           +   VC IC+                 N     CGC  EL   H  C   W  +  N  C
Sbjct: 4   EDVPVCWICN-------------EELGNERFRACGCTGELENVHRSCLSTWLTISRNTAC 50

Query: 298 EICGQ 302
           +ICG 
Sbjct: 51  QICGV 55

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.44
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.9
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.76
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.71
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.68
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.54
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.43
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.62
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 96.4
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 95.96
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 95.89
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 95.32
d2c2la280 STIP1 homology and U box-containing protein 1, STU 94.55
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 94.4
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 91.97
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 89.93
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 85.86
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.44  E-value=2.7e-14  Score=104.31  Aligned_cols=55  Identities=31%  Similarity=0.747  Sum_probs=47.8

Q ss_pred             CCCCceeEcccCCcccccccccccCCCccccccccCcCccccccHHHHHHHHHHhCCccccccccccc
Q 017863          238 DGERVCRICHLGSEQLLETTATASTTVNLIQLGCGCKDELGVAHSDCAEAWFKLKGNRLCEICGQSAK  305 (365)
Q Consensus       238 e~E~~CRICh~~~e~~~e~~~~~~~s~~LI~lPC~CKGSLkyVH~~CLe~W~k~Kgn~~CEICk~~y~  305 (365)
                      ++..+|+||++..+            .+++ .||.|+|..+++|+.||++|+..+++.+|++|+++|+
T Consensus         4 ed~~~C~IC~~~~~------------~~~~-~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~   58 (60)
T d1vyxa_           4 EDVPVCWICNEELG------------NERF-RACGCTGELENVHRSCLSTWLTISRNTACQICGVVYN   58 (60)
T ss_dssp             CSCCEETTTTEECS------------CCCC-CSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCC
T ss_pred             CCCCCCccCCccCC------------Ccee-EecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeee
Confidence            46789999998653            2334 5999999999999999999999999999999999995
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure