Citrus Sinensis ID: 017873
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 365 | ||||||
| 224067834 | 358 | predicted protein [Populus trichocarpa] | 0.961 | 0.980 | 0.886 | 1e-177 | |
| 255541428 | 360 | arsenical pump-driving atpase, putative | 0.967 | 0.980 | 0.875 | 1e-176 | |
| 224127550 | 358 | predicted protein [Populus trichocarpa] | 0.961 | 0.980 | 0.863 | 1e-172 | |
| 449454494 | 355 | PREDICTED: ATPase ASNA1 homolog [Cucumis | 0.961 | 0.988 | 0.855 | 1e-172 | |
| 296089136 | 357 | unnamed protein product [Vitis vinifera] | 0.964 | 0.985 | 0.864 | 1e-171 | |
| 359489404 | 366 | PREDICTED: ATPase ASNA1 homolog [Vitis v | 0.964 | 0.961 | 0.864 | 1e-171 | |
| 388510106 | 356 | unknown [Lotus japonicus] | 0.958 | 0.983 | 0.849 | 1e-167 | |
| 18378897 | 353 | putative anion-transporting ATPase [Arab | 0.956 | 0.988 | 0.822 | 1e-164 | |
| 297842932 | 353 | hypothetical protein ARALYDRAFT_470088 [ | 0.956 | 0.988 | 0.82 | 1e-163 | |
| 217071738 | 358 | unknown [Medicago truncatula] | 0.956 | 0.974 | 0.825 | 1e-163 |
| >gi|224067834|ref|XP_002302556.1| predicted protein [Populus trichocarpa] gi|222844282|gb|EEE81829.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 627 bits (1616), Expect = e-177, Method: Compositional matrix adjust.
Identities = 312/352 (88%), Positives = 339/352 (96%), Gaps = 1/352 (0%)
Query: 13 EIPEGSVRNILEQDSLKWVFVGGKGGVGKTTCSSILSILLAEVRPSVLIISTDPAHNLSD 72
+IP+G+VRNIL+QD+LKWVFVGGKGGVGKTTCSSILSILLA+VR SVLIISTDPAHNLSD
Sbjct: 5 DIPDGTVRNILDQDTLKWVFVGGKGGVGKTTCSSILSILLAQVRSSVLIISTDPAHNLSD 64
Query: 73 AFQQRFTKTPTLVNGFSNLYAMEVDPSVE-EETGSTEGMDSLFSELANAIPGIDEAMSFA 131
AFQQRFTKTPTLVNGFSNLYAMEVDP+VE ++ G +EGMDSLFSELANAIPGIDEAMSFA
Sbjct: 65 AFQQRFTKTPTLVNGFSNLYAMEVDPNVENDDIGGSEGMDSLFSELANAIPGIDEAMSFA 124
Query: 132 EMLKLVQTMDYSCIVFDTAPTGHTLRLLQFPSTLEKGLDKMMSLKNKFGGMINQMTRLFG 191
EMLKLVQTMDYSCIVFDTAPTGHTLRLLQFPSTLEKGL K+MSLK+KFGG+I QMTRLFG
Sbjct: 125 EMLKLVQTMDYSCIVFDTAPTGHTLRLLQFPSTLEKGLQKVMSLKSKFGGLIGQMTRLFG 184
Query: 192 IDDEFGEDALLGRLEGMKDVIERVNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELTKF 251
IDDEFGEDA+LGRLEGMKDVIE+VNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELTKF
Sbjct: 185 IDDEFGEDAILGRLEGMKDVIEQVNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELTKF 244
Query: 252 EIDTHNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDDFHITKLPLLPEEVTGI 311
EIDTHNIIINQVLYD+EDVESKLL+ARMRMQQKYLDQFYMLYDDF+ITKLPLLP+EVTG+
Sbjct: 245 EIDTHNIIINQVLYDEEDVESKLLKARMRMQQKYLDQFYMLYDDFNITKLPLLPQEVTGV 304
Query: 312 EALKAFSQHFVTPYQPSTSRDTVEDLERRVSTLRQQLQEAEAELERLRKGKQ 363
EAL+A S HF +PYQPSTSR VEDLERR+STL+ QL+ AEAEL+RL+KGKQ
Sbjct: 305 EALRALSSHFTSPYQPSTSRSAVEDLERRISTLKLQLEHAEAELDRLQKGKQ 356
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255541428|ref|XP_002511778.1| arsenical pump-driving atpase, putative [Ricinus communis] gi|223548958|gb|EEF50447.1| arsenical pump-driving atpase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224127550|ref|XP_002320102.1| predicted protein [Populus trichocarpa] gi|222860875|gb|EEE98417.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449454494|ref|XP_004144989.1| PREDICTED: ATPase ASNA1 homolog [Cucumis sativus] gi|449472679|ref|XP_004153666.1| PREDICTED: ATPase ASNA1 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296089136|emb|CBI38839.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359489404|ref|XP_002278613.2| PREDICTED: ATPase ASNA1 homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388510106|gb|AFK43119.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|18378897|ref|NP_563640.1| putative anion-transporting ATPase [Arabidopsis thaliana] gi|30678203|ref|NP_849575.1| putative anion-transporting ATPase [Arabidopsis thaliana] gi|145323712|ref|NP_001077445.1| putative anion-transporting ATPase [Arabidopsis thaliana] gi|15293141|gb|AAK93681.1| putative arsA homolog hASNA-I [Arabidopsis thaliana] gi|21689765|gb|AAM67526.1| putative arsA-like protein hASNA-I [Arabidopsis thaliana] gi|332189227|gb|AEE27348.1| putative anion-transporting ATPase [Arabidopsis thaliana] gi|332189228|gb|AEE27349.1| putative anion-transporting ATPase [Arabidopsis thaliana] gi|332189230|gb|AEE27351.1| putative anion-transporting ATPase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297842932|ref|XP_002889347.1| hypothetical protein ARALYDRAFT_470088 [Arabidopsis lyrata subsp. lyrata] gi|297335189|gb|EFH65606.1| hypothetical protein ARALYDRAFT_470088 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|217071738|gb|ACJ84229.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 365 | ||||||
| TAIR|locus:2025467 | 353 | AT1G01910 [Arabidopsis thalian | 0.906 | 0.937 | 0.801 | 2.9e-142 | |
| FB|FBgn0033191 | 336 | CG1598 [Drosophila melanogaste | 0.863 | 0.937 | 0.535 | 2.3e-87 | |
| DICTYBASE|DDB_G0293528 | 329 | arsA "arsenite-translocating A | 0.852 | 0.945 | 0.520 | 1.1e-85 | |
| ZFIN|ZDB-GENE-040625-120 | 341 | asna1 "arsA arsenite transport | 0.852 | 0.912 | 0.520 | 3.8e-85 | |
| POMBASE|SPAC1142.06 | 329 | get3 "GET complex ATPase subun | 0.852 | 0.945 | 0.524 | 5.6e-84 | |
| UNIPROTKB|A5PJI5 | 348 | ASNA1 "ATPase ASNA1" [Bos taur | 0.863 | 0.905 | 0.507 | 1.2e-83 | |
| UNIPROTKB|O43681 | 348 | ASNA1 "ATPase ASNA1" [Homo sap | 0.863 | 0.905 | 0.507 | 1.2e-83 | |
| UNIPROTKB|F2Z5J4 | 348 | ASNA1 "Uncharacterized protein | 0.863 | 0.905 | 0.507 | 1.2e-83 | |
| MGI|MGI:1928379 | 348 | Asna1 "arsA arsenite transport | 0.863 | 0.905 | 0.507 | 1.2e-83 | |
| UNIPROTKB|G3V9T7 | 348 | Asna1 "ArsA arsenite transport | 0.863 | 0.905 | 0.507 | 1.2e-83 |
| TAIR|locus:2025467 AT1G01910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1391 (494.7 bits), Expect = 2.9e-142, P = 2.9e-142
Identities = 266/332 (80%), Positives = 301/332 (90%)
Query: 13 EIPEGSVRNILEQDSLKWVFXXXXXXXXXXXCSSILSILLAEVRPSVLIISTDPAHNLSD 72
++PE +V+NIL+Q+SLKWVF CSSIL+I LA VR SVLIISTDPAHNLSD
Sbjct: 4 DLPEATVQNILDQESLKWVFVGGKGGVGKTTCSSILAICLASVRSSVLIISTDPAHNLSD 63
Query: 73 AFQQRFTKTPTLVNGFSNLYAMEVDPSVE-EETGSTEGMDSLFSELANAIPGIDEAMSFA 131
AFQQRFTK+PTLV GFSNL+AMEVDP+VE ++ T+GMD LFS+LANAIPGIDEAMSFA
Sbjct: 64 AFQQRFTKSPTLVQGFSNLFAMEVDPTVETDDMAGTDGMDGLFSDLANAIPGIDEAMSFA 123
Query: 132 EMLKLVQTMDYSCIVFDTAPTGHTLRLLQFPSTLEKGLDKMMSLKNKFGGMINQMTRLFG 191
EMLKLVQTMDY+ IVFDTAPTGHTLRLLQFP+TLEKGL K+MSLK++FGG++ QM+R+FG
Sbjct: 124 EMLKLVQTMDYATIVFDTAPTGHTLRLLQFPATLEKGLSKLMSLKSRFGGLMTQMSRMFG 183
Query: 192 IDDEFGEDALLGRLEGMKDVIERVNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELTKF 251
++DEFGEDALLGRLEG+KDVIE+VN+QFKDPD+TTFVCVCIPEFLSLYETERLVQEL KF
Sbjct: 184 MEDEFGEDALLGRLEGLKDVIEQVNRQFKDPDMTTFVCVCIPEFLSLYETERLVQELAKF 243
Query: 252 EIDTHNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDDFHITKLPLLPEEVTGI 311
EIDTHNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDDF+ITKLPLLPEEVTG+
Sbjct: 244 EIDTHNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDDFNITKLPLLPEEVTGV 303
Query: 312 EALKAFSQHFVTPYQPSTSRDTVEDLERRVST 343
EALKAFS F+TPY P+TSR VE+LER+V T
Sbjct: 304 EALKAFSHKFLTPYHPTTSRSNVEELERKVHT 335
|
|
| FB|FBgn0033191 CG1598 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0293528 arsA "arsenite-translocating ATPase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040625-120 asna1 "arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1142.06 get3 "GET complex ATPase subunit Get3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5PJI5 ASNA1 "ATPase ASNA1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43681 ASNA1 "ATPase ASNA1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z5J4 ASNA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1928379 Asna1 "arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V9T7 Asna1 "ArsA arsenite transporter, ATP-binding, homolog 1 (Bacterial)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 365 | |||
| pfam02374 | 304 | pfam02374, ArsA_ATPase, Anion-transporting ATPase | 1e-123 | |
| TIGR00345 | 284 | TIGR00345, GET3_arsA_TRC40, transport-energizing A | 2e-82 | |
| COG0003 | 322 | COG0003, ArsA, Predicted ATPase involved in chromo | 1e-81 | |
| cd02035 | 217 | cd02035, ArsA, ArsA ATPase functionas as an efflux | 1e-50 | |
| TIGR04291 | 566 | TIGR04291, arsen_driv_ArsA, arsenical pump-driving | 1e-40 | |
| TIGR04291 | 566 | TIGR04291, arsen_driv_ArsA, arsenical pump-driving | 7e-14 | |
| COG1192 | 259 | COG1192, Soj, ATPases involved in chromosome parti | 1e-07 | |
| pfam01656 | 217 | pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide bi | 2e-06 | |
| cd01983 | 99 | cd01983, Fer4_NifH, The Fer4_NifH superfamily cont | 8e-06 | |
| cd02034 | 116 | cd02034, CooC, The accessory protein CooC, which c | 1e-05 | |
| pfam13614 | 145 | pfam13614, AAA_31, AAA domain | 4e-05 | |
| cd02042 | 104 | cd02042, ParA, ParA and ParB of Caulobacter cresce | 9e-05 | |
| cd02036 | 179 | cd02036, MinD, Bacterial cell division requires th | 1e-04 | |
| cd02038 | 139 | cd02038, FleN-like, FleN is a member of the Fer4_N | 2e-04 | |
| PRK13185 | 270 | PRK13185, chlL, protochlorophyllide reductase iron | 4e-04 | |
| cd02117 | 212 | cd02117, NifH_like, This family contains the NifH | 4e-04 | |
| cd02032 | 267 | cd02032, Bchl_like, This family of proteins contai | 4e-04 | |
| COG3640 | 255 | COG3640, CooC, CO dehydrogenase maturation factor | 9e-04 | |
| COG0455 | 262 | COG0455, flhG, Antiactivator of flagellar biosynth | 0.001 | |
| TIGR01281 | 268 | TIGR01281, DPOR_bchL, light-independent protochlor | 0.002 | |
| COG1348 | 278 | COG1348, NifH, Nitrogenase subunit NifH (ATPase) [ | 0.002 | |
| CHL00072 | 290 | CHL00072, chlL, photochlorophyllide reductase subu | 0.003 | |
| pfam00142 | 272 | pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster b | 0.004 |
| >gnl|CDD|217004 pfam02374, ArsA_ATPase, Anion-transporting ATPase | Back alignment and domain information |
|---|
Score = 355 bits (914), Expect = e-123
Identities = 133/304 (43%), Positives = 183/304 (60%), Gaps = 16/304 (5%)
Query: 28 LKWVFVGGKGGVGKTTCSSILSILLAEVRPSVLIISTDPAHNLSDAFQQRFTKTPTLVNG 87
++W+F GGKGGVGKTT S ++ L+E VL++STDPAH+LSD+F Q+F PT + G
Sbjct: 1 MRWIFFGGKGGVGKTTVSCATAVRLSEQGKKVLLVSTDPAHSLSDSFNQKFGHEPTKIKG 60
Query: 88 FSNLYAMEVDPSVEEE------------TGSTEGMDSLFSELANAIPGIDEAMSFAEMLK 135
NL AME+DP +E E + ++ + +E +++PGIDE SF E K
Sbjct: 61 VENLSAMEIDPQMELEEYRGEVQDPINAVLGLDMLEGILAEELSSLPGIDEIASFDEFKK 120
Query: 136 LVQTMDYSCIVFDTAPTGHTLRLLQFPSTLEKGLDKMMSLKNKFGGMINQMTRLFGIDDE 195
+ +Y ++FDTAPTGHTLRLL P+ L L+K++ LKN+ G + +
Sbjct: 121 YMDEGEYDVVIFDTAPTGHTLRLLSLPTVLSWYLEKIVKLKNQIGPLAKPFKGMGMGGSC 180
Query: 196 FGEDALLGRLEGMKDVIERVNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELTKFEIDT 255
E L LE K+ IE+ + DP+ T+F VCIPE +SLYETER +QEL K+ ID
Sbjct: 181 LPE--ALESLEETKEQIEKAREILSDPERTSFRLVCIPEKMSLYETERAIQELAKYGIDV 238
Query: 256 HNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDDFHITKLPLLPEEVTGIEALK 315
+I+NQVL E + AR +QQKYL + L+ D + KLPLLPEEV G+EAL+
Sbjct: 239 DAVIVNQVL--PETEQCPFCEARKEIQQKYLKEIEELFSDLPVAKLPLLPEEVVGLEALE 296
Query: 316 AFSQ 319
FSQ
Sbjct: 297 KFSQ 300
|
This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell. Length = 304 |
| >gnl|CDD|232932 TIGR00345, GET3_arsA_TRC40, transport-energizing ATPase, TRC40/GET3/ArsA family | Back alignment and domain information |
|---|
| >gnl|CDD|223082 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >gnl|CDD|213904 TIGR04291, arsen_driv_ArsA, arsenical pump-driving ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|213904 TIGR04291, arsen_driv_ArsA, arsenical pump-driving ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|224113 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|216631 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238991 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >gnl|CDD|222264 pfam13614, AAA_31, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|238997 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >gnl|CDD|238993 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >gnl|CDD|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|237293 PRK13185, chlL, protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239034 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >gnl|CDD|238989 cd02032, Bchl_like, This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >gnl|CDD|226166 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223531 COG0455, flhG, Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >gnl|CDD|130348 TIGR01281, DPOR_bchL, light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|224267 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|177011 CHL00072, chlL, photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >gnl|CDD|201032 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 365 | |||
| KOG2825 | 323 | consensus Putative arsenite-translocating ATPase [ | 100.0 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 100.0 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 100.0 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 100.0 | |
| TIGR00345 | 284 | arsA arsenite-activated ATPase (arsA). The N-termi | 100.0 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 99.96 | |
| KOG3022 | 300 | consensus Predicted ATPase, nucleotide-binding [Ce | 99.92 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 99.92 | |
| PRK11670 | 369 | antiporter inner membrane protein; Provisional | 99.91 | |
| COG0489 | 265 | Mrp ATPases involved in chromosome partitioning [C | 99.91 | |
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 99.9 | |
| TIGR01007 | 204 | eps_fam capsular exopolysaccharide family. This mo | 99.88 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 99.87 | |
| COG0455 | 262 | flhG Antiactivator of flagellar biosynthesis FleN, | 99.87 | |
| CHL00175 | 281 | minD septum-site determining protein; Validated | 99.87 | |
| TIGR03018 | 207 | pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t | 99.86 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 99.86 | |
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 99.86 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 99.86 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 99.85 | |
| COG2894 | 272 | MinD Septum formation inhibitor-activating ATPase | 99.84 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 99.84 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 99.84 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 99.84 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 99.84 | |
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 99.84 | |
| TIGR03453 | 387 | partition_RepA plasmid partitioning protein RepA. | 99.84 | |
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 99.83 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 99.83 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 99.83 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 99.83 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 99.83 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 99.82 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 99.82 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 99.82 | |
| PHA02519 | 387 | plasmid partition protein SopA; Reviewed | 99.82 | |
| PRK10818 | 270 | cell division inhibitor MinD; Provisional | 99.82 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 99.82 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 99.82 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 99.82 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 99.82 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 99.82 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 99.82 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 99.81 | |
| PRK10037 | 250 | cell division protein; Provisional | 99.8 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 99.79 | |
| COG1192 | 259 | Soj ATPases involved in chromosome partitioning [C | 99.79 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 99.79 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 99.78 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 99.77 | |
| cd02033 | 329 | BchX Chlorophyllide reductase converts chlorophyll | 99.75 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 99.73 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 99.72 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 99.71 | |
| PF07015 | 231 | VirC1: VirC1 protein; InterPro: IPR009744 This fam | 99.7 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 99.68 | |
| cd02038 | 139 | FleN-like FleN is a member of the Fer4_NifH superf | 99.66 | |
| PF00142 | 273 | Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot | 99.66 | |
| PF09140 | 261 | MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi | 99.65 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 99.64 | |
| COG1348 | 278 | NifH Nitrogenase subunit NifH (ATPase) [Inorganic | 99.57 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 99.47 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 99.4 | |
| PF13614 | 157 | AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ | 99.39 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 99.34 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 99.33 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 99.32 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 99.32 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 99.3 | |
| TIGR00347 | 166 | bioD dethiobiotin synthase. Dethiobiotin synthase | 99.29 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 99.27 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 99.24 | |
| PRK13768 | 253 | GTPase; Provisional | 99.24 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 99.2 | |
| COG4963 | 366 | CpaE Flp pilus assembly protein, ATPase CpaE [Intr | 99.17 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 99.16 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 99.09 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 99.08 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 99.04 | |
| PRK00090 | 222 | bioD dithiobiotin synthetase; Reviewed | 99.0 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 98.96 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 98.95 | |
| PF10609 | 81 | ParA: ParA/MinD ATPase like; InterPro: IPR019591 T | 98.94 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 98.92 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 98.91 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.87 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 98.84 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 98.77 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 98.75 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 98.74 | |
| cd03109 | 134 | DTBS Dethiobiotin synthetase (DTBS) is the penulti | 98.71 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 98.68 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 98.68 | |
| PRK01077 | 451 | cobyrinic acid a,c-diamide synthase; Validated | 98.62 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.59 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 98.5 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 98.46 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.44 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 98.41 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 98.39 | |
| PRK05632 | 684 | phosphate acetyltransferase; Reviewed | 98.36 | |
| PRK12374 | 231 | putative dithiobiotin synthetase; Provisional | 98.32 | |
| COG0132 | 223 | BioD Dethiobiotin synthetase [Coenzyme metabolism] | 98.32 | |
| PF13500 | 199 | AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R | 98.31 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 98.27 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.25 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 98.25 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 98.24 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.2 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 98.16 | |
| PRK00784 | 488 | cobyric acid synthase; Provisional | 98.09 | |
| COG1797 | 451 | CobB Cobyrinic acid a,c-diamide synthase [Coenzyme | 98.0 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.99 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.95 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.95 | |
| PRK06278 | 476 | cobyrinic acid a,c-diamide synthase; Validated | 97.94 | |
| KOG1534 | 273 | consensus Putative transcription factor FET5 [Tran | 97.92 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.92 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.91 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.89 | |
| TIGR00379 | 449 | cobB cobyrinic acid a,c-diamide synthase. This mod | 97.89 | |
| TIGR00313 | 475 | cobQ cobyric acid synthase CobQ. | 97.86 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.83 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 97.82 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 97.82 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 97.79 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 97.73 | |
| PRK13896 | 433 | cobyrinic acid a,c-diamide synthase; Provisional | 97.71 | |
| PRK13505 | 557 | formate--tetrahydrofolate ligase; Provisional | 97.7 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 97.69 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.68 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.65 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.65 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.65 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.63 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 97.6 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 97.59 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 97.53 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.49 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 97.48 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 97.48 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 97.48 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 97.46 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 97.45 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 97.42 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 97.4 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.39 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 97.37 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 97.37 | |
| PRK07667 | 193 | uridine kinase; Provisional | 97.35 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 97.34 | |
| cd00477 | 524 | FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca | 97.34 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 97.33 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 97.32 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 97.27 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 97.27 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.26 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 97.23 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 97.22 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 97.22 | |
| cd03113 | 255 | CTGs CTP synthetase (CTPs) is a two-domain protein | 97.17 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 97.17 | |
| PRK06696 | 223 | uridine kinase; Validated | 97.15 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.14 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.14 | |
| PRK13506 | 578 | formate--tetrahydrofolate ligase; Provisional | 97.13 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 97.1 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 97.1 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 97.09 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 97.06 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 97.03 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 97.0 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.99 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 96.99 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.98 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 96.98 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 96.96 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 96.94 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 96.93 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.91 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 96.91 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 96.9 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 96.9 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 96.88 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.88 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.86 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 96.84 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 96.84 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 96.82 | |
| PF13479 | 213 | AAA_24: AAA domain | 96.82 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 96.8 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 96.77 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 96.76 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 96.76 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 96.75 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 96.75 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.74 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 96.73 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.7 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 96.7 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 96.69 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 96.68 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.66 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 96.64 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 96.61 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.61 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 96.58 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 96.58 | |
| PRK06526 | 254 | transposase; Provisional | 96.56 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 96.53 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.53 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.52 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 96.5 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.48 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 96.45 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 96.43 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 96.42 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 96.41 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 96.4 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 96.38 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 96.37 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.37 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 96.37 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 96.36 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 96.33 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 96.33 | |
| PRK06749 | 428 | replicative DNA helicase; Provisional | 96.31 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 96.3 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.3 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 96.27 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.25 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 96.24 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 96.24 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 96.23 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 96.2 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 96.18 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 96.18 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.17 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 96.16 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 96.15 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 96.14 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 96.12 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.11 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 96.11 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 96.07 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.03 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 96.0 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 95.99 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 95.95 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 95.94 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 95.94 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.93 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 95.92 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.91 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 95.87 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 95.87 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 95.87 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 95.85 | |
| PRK08181 | 269 | transposase; Validated | 95.84 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 95.81 | |
| PF06418 | 276 | CTP_synth_N: CTP synthase N-terminus; InterPro: IP | 95.78 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 95.76 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 95.76 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 95.74 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 95.72 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 95.7 | |
| PF05729 | 166 | NACHT: NACHT domain | 95.69 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 95.66 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 95.65 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 95.6 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 95.57 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 95.56 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 95.54 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 95.52 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 95.52 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 95.51 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 95.51 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 95.45 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 95.44 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 95.44 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 95.44 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.41 | |
| PRK14495 | 452 | putative molybdopterin-guanine dinucleotide biosyn | 95.41 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.4 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 95.39 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 95.38 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 95.37 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.36 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 95.34 | |
| PRK06217 | 183 | hypothetical protein; Validated | 95.27 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 95.24 | |
| PRK07414 | 178 | cob(I)yrinic acid a,c-diamide adenosyltransferase; | 95.23 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.19 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 95.17 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 95.15 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 95.14 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 95.12 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 95.1 | |
| PF13173 | 128 | AAA_14: AAA domain | 95.07 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.06 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 95.02 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 95.02 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 95.01 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 95.0 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 94.98 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 94.98 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 94.92 | |
| PRK05380 | 533 | pyrG CTP synthetase; Validated | 94.91 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 94.86 | |
| COG0504 | 533 | PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide | 94.82 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 94.8 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 94.74 | |
| PLN02327 | 557 | CTP synthase | 94.72 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 94.68 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 94.67 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 94.67 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 94.67 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 94.67 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.65 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 94.64 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 94.61 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 94.6 | |
| TIGR00337 | 525 | PyrG CTP synthase. CTP synthase is involved in pyr | 94.57 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 94.5 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 94.48 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 94.46 | |
| PRK10490 | 895 | sensor protein KdpD; Provisional | 94.44 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 94.42 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 94.41 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 94.35 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 94.34 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 94.32 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 94.31 | |
| COG0305 | 435 | DnaB Replicative DNA helicase [DNA replication, re | 94.27 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 94.25 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 94.24 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 94.24 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 94.2 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 94.15 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 94.14 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 94.13 | |
| PRK00652 | 325 | lpxK tetraacyldisaccharide 4'-kinase; Reviewed | 94.13 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 94.08 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 94.06 | |
| COG2403 | 449 | Predicted GTPase [General function prediction only | 94.03 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 93.99 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 93.98 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 93.93 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 93.9 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 93.88 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 93.84 | |
| TIGR00682 | 311 | lpxK tetraacyldisaccharide 4'-kinase. Also called | 93.81 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 93.8 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 93.79 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 93.78 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 93.78 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.77 | |
| COG2109 | 198 | BtuR ATP:corrinoid adenosyltransferase [Coenzyme m | 93.71 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 93.68 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 93.65 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 93.65 | |
| PLN02924 | 220 | thymidylate kinase | 93.55 | |
| PRK01906 | 338 | tetraacyldisaccharide 4'-kinase; Provisional | 93.54 | |
| PRK03839 | 180 | putative kinase; Provisional | 93.45 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 93.45 | |
| PLN02348 | 395 | phosphoribulokinase | 93.38 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 93.38 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 93.37 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 93.33 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 93.32 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 93.26 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 93.23 | |
| PRK14491 | 597 | putative bifunctional molybdopterin-guanine dinucl | 93.22 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 93.21 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 93.21 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 93.21 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 93.17 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 93.16 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 93.16 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 93.04 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 93.03 | |
| PLN02200 | 234 | adenylate kinase family protein | 93.02 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 92.96 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 92.96 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 92.95 | |
| PF02606 | 326 | LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr | 92.94 | |
| KOG2749 | 415 | consensus mRNA cleavage and polyadenylation factor | 92.9 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 92.85 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 92.84 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 92.84 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 92.81 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 92.79 | |
| KOG3062 | 281 | consensus RNA polymerase II elongator associated p | 92.78 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 92.77 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 92.77 | |
| PRK13764 | 602 | ATPase; Provisional | 92.72 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 92.71 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 92.67 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 92.66 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 92.65 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 92.63 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 92.6 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 92.57 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 92.5 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 92.48 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 92.44 | |
| KOG3220 | 225 | consensus Similar to bacterial dephospho-CoA kinas | 92.42 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 92.3 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 92.27 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 92.25 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 92.23 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 92.16 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 92.15 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 92.12 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 92.1 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 92.08 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 91.98 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 91.88 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 91.88 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 91.78 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 91.77 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 91.73 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 91.7 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 91.7 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 91.69 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 91.67 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 91.59 | |
| PRK13695 | 174 | putative NTPase; Provisional | 91.57 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 91.57 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 91.52 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 91.52 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 91.52 | |
| PLN02422 | 232 | dephospho-CoA kinase | 91.49 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 91.42 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 91.41 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 91.33 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 91.31 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 91.26 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 91.24 | |
| KOG2878 | 282 | consensus Predicted kinase [General function predi | 91.23 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 91.22 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 91.2 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 91.19 | |
| PF01268 | 557 | FTHFS: Formate--tetrahydrofolate ligase; InterPro: | 91.18 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 91.14 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 91.13 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 91.13 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 91.1 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 91.1 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 91.08 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 91.07 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 91.07 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 91.05 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 91.05 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 90.99 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 90.97 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 90.97 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 90.91 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 90.91 | |
| CHL00071 | 409 | tufA elongation factor Tu | 90.89 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 90.87 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 90.79 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 90.78 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 90.78 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 90.74 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 90.71 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 90.61 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 90.6 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 90.49 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 90.44 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 90.43 | |
| TIGR03783 | 829 | Bac_Flav_CT_G Bacteroides conjugation system ATPas | 90.39 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 90.37 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 90.27 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 90.25 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 90.23 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 90.22 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 90.22 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 90.2 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 90.16 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 90.1 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 90.04 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 90.0 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 89.99 | |
| PRK13507 | 587 | formate--tetrahydrofolate ligase; Provisional | 89.97 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 89.93 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 89.85 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 89.85 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 89.81 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 89.76 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 89.71 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 89.7 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 89.69 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 89.69 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 89.66 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 89.64 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 89.63 | |
| PRK13976 | 209 | thymidylate kinase; Provisional | 89.62 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 89.51 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 89.49 |
| >KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.7e-58 Score=405.90 Aligned_cols=309 Identities=66% Similarity=1.047 Sum_probs=287.6
Q ss_pred hcchhhHHhhhcCCCeEEEEEeCCCCCcHHHHHHHHHHHHHHCCCCEEEEeCCCCCChhhHhhcccCCCceeecCcCCce
Q 017873 13 EIPEGSVRNILEQDSLKWVFVGGKGGVGKTTCSSILSILLAEVRPSVLIISTDPAHNLSDAFQQRFTKTPTLVNGFSNLY 92 (365)
Q Consensus 13 ~~~~~~l~~~~~~~~~~i~~~sgKGGvGKTT~aa~lA~~la~~G~rVLLiD~D~~~~l~~~~~~~~~~~~~~~~~~~~l~ 92 (365)
+-+.+++++++++...+++|++|||||||||+++.||..+|.-+.+||+|++||+||+++.|+.++...|+.+.|+.||.
T Consensus 4 dple~~l~nil~q~slKwifVGGKGGVGKTTcs~sLAvqla~~r~~vLiISTDPAHNlSDAF~qkftk~pt~V~Gf~nLf 83 (323)
T KOG2825|consen 4 DPLEATLQNILEQTSLKWIFVGGKGGVGKTTCSCSLAVQLAKVRESVLIISTDPAHNLSDAFSQKFTKTPTKVEGFENLF 83 (323)
T ss_pred CccchhHHHHhhcceeeEEEEcCcCCcCccchhhHHHHHHhccCCceEEeecCcccchHHHHHHHhcCCCccccChhhhe
Confidence 34566899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeecCccccc-cccc---c----cCc--cchhHHhhhcCCCHHHHHHHHHHHHHHHhCCCcEEEEcCCCChhHHHhhhch
Q 017873 93 AMEVDPSVEE-ETGS---T----EGM--DSLFSELANAIPGIDEAMSFAEMLKLVQTMDYSCIVFDTAPTGHTLRLLQFP 162 (365)
Q Consensus 93 ~~~~d~~~~~-~~~~---~----~~~--~~~~~~~~~~~pg~~~~~~l~~l~~~l~~~~yD~IiiDtpp~~~~l~~l~lp 162 (365)
+++|||+..+ ++.+ . .+. ..++.++....||.++.+.+.++++.++..+||+|||||+|++|++++|.+|
T Consensus 84 AMEIDp~~e~~~~~~m~~~~~~n~~~~g~g~l~e~~~~~Pgideamsfae~~klvk~~~F~~vVFDTAPTGHTLRlL~fP 163 (323)
T KOG2825|consen 84 AMEIDPNVEMGDMPEMFGNAANNEGSDGKGMLQELANAFPGIDEAMSFAEVMKLVKGMNFDVVVFDTAPTGHTLRLLQFP 163 (323)
T ss_pred eeecCCchhhhhhHHHhhcccccccccchhHHHHHHhcCCChhHHHhHHHHHHHhhccccceEEeccCCCcceehhhccc
Confidence 9999999776 2211 1 112 3456777888999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHhhhhhHHHHHhhhCCCCccchhHHHHHHHHHHHHHHHHHHHhcCCCceEEEEeecCCcchHHHHH
Q 017873 163 STLEKGLDKMMSLKNKFGGMINQMTRLFGIDDEFGEDALLGRLEGMKDVIERVNKQFKDPDLTTFVCVCIPEFLSLYETE 242 (365)
Q Consensus 163 ~~l~~~l~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~l~~~~~~~~~~~~~l~d~~~t~~~lVt~p~~~s~~et~ 242 (365)
..+...+.++.+++.+++|+++++.+++|.+ +.+.+++...++++++.++++++.++||+.|+|++|+.|+.+|+.||+
T Consensus 164 ~~lek~lgKl~~l~~k~~pm~sq~~sm~g~~-~~~~~~l~~kle~~~~~i~~vn~qFkdpd~TtFVcVcI~eflslyEte 242 (323)
T KOG2825|consen 164 TTLEKGLGKLLSLKNKIGPMLSQMGSMFGME-DAGADDLAGKLEELLEVIEKVNEQFKDPDCTTFVCVCIAEFLSLYETE 242 (323)
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHhhhhccc-cCCHHHHHHHHHHHHHHHHHHHHHcCCCCCceEEEEEHHHHHhHHHHH
Confidence 9999999999999999999999999999863 467889999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhCCCCcCeEEEcCccCCCCccchHHHHHHHHHHHHHHHHHHhhcCCCcEEEecCCCCCCCCHHHHHHHHHhhc
Q 017873 243 RLVQELTKFEIDTHNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDDFHITKLPLLPEEVTGIEALKAFSQHFV 322 (365)
Q Consensus 243 ~~~~~L~~~gi~v~~vVvN~~~~~~~~~~~~~~~~~~~~q~~~l~~i~~~~~~~~i~~vp~~~~e~~g~~~L~~l~~~l~ 322 (365)
|+++.|.++++++..||+|+.++|+.+..|+.|.+|+++|.+|+.+|.+.|.+.++.++|+.+.|++|.++|+.+++-++
T Consensus 243 RliqeL~k~~idthnIIVNQLL~~~~~~~ck~C~ar~k~Q~kyLdqi~elyedfhv~klPl~~~EvrG~~al~~fse~l~ 322 (323)
T KOG2825|consen 243 RLIQELAKQGIDTHNIIVNQLLFPDNEVSCKKCAARRKMQSKYLDQIEELYEDFHVVKLPLLPMEVRGVEALNFFSEILL 322 (323)
T ss_pred HHHHHHHhcCCcccceeeeeccCCCCccchHHHHHHHHHHHHHhhhHHHHHhhcceeecccchhhhcCHHHHHHHHHHhc
Confidence 99999999999999999999998886578999999999999999999999999999999999999999999999998764
|
|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >TIGR00345 arsA arsenite-activated ATPase (arsA) | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PRK11670 antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >TIGR01007 eps_fam capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >CHL00175 minD septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >TIGR03453 partition_RepA plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PHA02519 plasmid partition protein SopA; Reviewed | Back alignment and domain information |
|---|
| >PRK10818 cell division inhibitor MinD; Provisional | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family | Back alignment and domain information |
|---|
| >PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00347 bioD dethiobiotin synthase | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK00090 bioD dithiobiotin synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK01077 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK05632 phosphate acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK12374 putative dithiobiotin synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK00784 cobyric acid synthase; Provisional | Back alignment and domain information |
|---|
| >COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK06278 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >KOG1534 consensus Putative transcription factor FET5 [Transcription] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >TIGR00379 cobB cobyrinic acid a,c-diamide synthase | Back alignment and domain information |
|---|
| >TIGR00313 cobQ cobyric acid synthase CobQ | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK13896 cobyrinic acid a,c-diamide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK13505 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK13506 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK06749 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF06418 CTP_synth_N: CTP synthase N-terminus; InterPro: IPR017456 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism, catalysing the synthesis of CTP from UTP by amination of the pyrimidine ring at the 4-position [] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05380 pyrG CTP synthetase; Validated | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PLN02327 CTP synthase | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00337 PyrG CTP synthase | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK10490 sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >COG2403 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >TIGR00682 lpxK tetraacyldisaccharide 4'-kinase | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PRK01906 tetraacyldisaccharide 4'-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] | Back alignment and domain information |
|---|
| >KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2878 consensus Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PF01268 FTHFS: Formate--tetrahydrofolate ligase; InterPro: IPR000559 Formate--tetrahydrofolate ligase (6 | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13507 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 365 | ||||
| 2woo_A | 329 | Nucleotide-Free Form Of S. Pombe Get3 Length = 329 | 7e-93 | ||
| 3ibg_A | 348 | Crystal Structure Of Aspergillus Fumigatus Get3 Wit | 9e-88 | ||
| 3iqw_A | 334 | Amppnp Complex Of C. Therm. Get3 Length = 334 | 1e-82 | ||
| 3io3_A | 348 | Get3 With Adp From D. Hansenii In Closed Form Lengt | 3e-73 | ||
| 3sja_A | 362 | Crystal Structure Of S. Cerevisiae Get3 In The Open | 1e-69 | ||
| 3a36_A | 362 | Structural Insight Into The Membrane Insertion Of T | 1e-69 | ||
| 3idq_A | 369 | Crystal Structure Of S. Cerevisiae Get3 At 3.7 Angs | 2e-69 | ||
| 2woj_A | 354 | Adp-Alf4 Complex Of S. Cerevisiae Get3 Length = 354 | 2e-69 | ||
| 3vlc_A | 354 | Crystal Structure Of S. Cerevisiae Get3 In The Semi | 2e-69 | ||
| 3zq6_A | 324 | Adp-Alf4 Complex Of M. Therm. Trc40 Length = 324 | 3e-47 | ||
| 3ug6_A | 349 | Crystal Structure Of Get3 From Methanocaldococcus J | 7e-47 | ||
| 1f48_A | 589 | Crystal Structure Of The Escherichia Coli Arsenite- | 5e-15 |
| >pdb|2WOO|A Chain A, Nucleotide-Free Form Of S. Pombe Get3 Length = 329 | Back alignment and structure |
|
| >pdb|3IBG|A Chain A, Crystal Structure Of Aspergillus Fumigatus Get3 With Bound Adp Length = 348 | Back alignment and structure |
| >pdb|3IQW|A Chain A, Amppnp Complex Of C. Therm. Get3 Length = 334 | Back alignment and structure |
| >pdb|3IO3|A Chain A, Get3 With Adp From D. Hansenii In Closed Form Length = 348 | Back alignment and structure |
| >pdb|3SJA|A Chain A, Crystal Structure Of S. Cerevisiae Get3 In The Open State In Complex With Get1 Cytosolic Domain Length = 362 | Back alignment and structure |
| >pdb|3A36|A Chain A, Structural Insight Into The Membrane Insertion Of Tail- Anchored Proteins By Get3 Length = 362 | Back alignment and structure |
| >pdb|3IDQ|A Chain A, Crystal Structure Of S. Cerevisiae Get3 At 3.7 Angstrom Resolution Length = 369 | Back alignment and structure |
| >pdb|2WOJ|A Chain A, Adp-Alf4 Complex Of S. Cerevisiae Get3 Length = 354 | Back alignment and structure |
| >pdb|3VLC|A Chain A, Crystal Structure Of S. Cerevisiae Get3 In The Semi Open Conformation In Complex With Get1 Cytosolic Domain At 4.5 Angstrom Resolution Length = 354 | Back alignment and structure |
| >pdb|3ZQ6|A Chain A, Adp-Alf4 Complex Of M. Therm. Trc40 Length = 324 | Back alignment and structure |
| >pdb|3UG6|A Chain A, Crystal Structure Of Get3 From Methanocaldococcus Jannaschii Length = 349 | Back alignment and structure |
| >pdb|1F48|A Chain A, Crystal Structure Of The Escherichia Coli Arsenite-Translocating Atpase Length = 589 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 365 | |||
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 1e-132 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 1e-121 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 1e-118 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 1e-118 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 1e-115 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 1e-112 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 7e-93 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 1e-79 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 6e-80 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-19 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 3e-08 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 6e-08 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 1e-07 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 2e-07 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 2e-05 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 2e-04 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 4e-04 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 4e-04 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 6e-04 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 7e-04 |
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Length = 329 | Back alignment and structure |
|---|
Score = 380 bits (977), Expect = e-132
Identities = 177/327 (54%), Positives = 230/327 (70%), Gaps = 11/327 (3%)
Query: 12 LEIPEGSVRNILEQDSLKWVFVGGKGGVGKTTCSSILSILLAEVRPSVLIISTDPAHNLS 71
+ G++ N+LEQ SLKW+FVGGKGGVGKTT S L+I +++VR SVL+ISTDPAHNLS
Sbjct: 3 FDPLPGTLENLLEQTSLKWIFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPAHNLS 62
Query: 72 DAFQQRFTKTPTLVNGFSNLYAMEVDPSVE--------EETGSTEGMDSLFSELANAIPG 123
DAF +F K V GF NL AME+DP++ ++ + + +LA IPG
Sbjct: 63 DAFGTKFGKDARKVPGFDNLSAMEIDPNLSIQEMTEQADQQNPNNPLSGMMQDLAFTIPG 122
Query: 124 IDEAMSFAEMLKLVQTMDYSCIVFDTAPTGHTLRLLQFPSTLEKGLDKMMSLKNKFGGMI 183
IDEA++FAE+LK +++M++ C++FDTAPTGHTLR L FP+ LEK L K+ L ++FG MI
Sbjct: 123 IDEALAFAEILKQIKSMEFDCVIFDTAPTGHTLRFLNFPTVLEKALGKLGGLSSRFGPMI 182
Query: 184 NQMTRLFGIDDEFGEDALLGRLEGMKDVIERVNKQFKDPDLTTFVCVCIPEFLSLYETER 243
NQM + G++ E L G++E M+ I VNKQFK+PDLTTFVCVCI EFLSLYETER
Sbjct: 183 NQMGSIMGVNAN--EQDLFGKMESMRANISEVNKQFKNPDLTTFVCVCISEFLSLYETER 240
Query: 244 LVQELTKFEIDTHNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDDFHITKLPL 303
++QELT +EIDTHNI++NQ+L D AR +MQQKYL Q LY+DFH+ K+P
Sbjct: 241 MIQELTSYEIDTHNIVVNQLLLDPNT-TCPQCMARRKMQQKYLAQIEELYEDFHVVKVPQ 299
Query: 304 LPEEVTGIEALKAFSQHFVTPYQPSTS 330
+P EV G EALK+FS+ V PY TS
Sbjct: 300 VPAEVRGTEALKSFSEMLVKPYVYPTS 326
|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Length = 348 | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Length = 354 | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Length = 334 | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Length = 349 | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 324 | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Length = 374 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Length = 245 | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Length = 254 | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Length = 373 | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206 | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Length = 209 | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Length = 263 | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Length = 260 | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Length = 237 | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Length = 298 | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Length = 267 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 365 | |||
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 100.0 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 100.0 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 100.0 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 100.0 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 100.0 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 100.0 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 100.0 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 100.0 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 99.98 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 99.92 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 99.9 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 99.9 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 99.88 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 99.88 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 99.87 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 99.86 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 99.86 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 99.86 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 99.86 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 99.86 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 99.85 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 99.85 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 99.84 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 99.84 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 99.84 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 99.83 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 99.82 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 99.81 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 99.81 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 99.78 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 99.77 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 99.76 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 99.72 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 99.52 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 99.42 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 99.38 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 99.35 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 99.33 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 99.32 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 99.31 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 99.27 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 99.21 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 99.15 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 99.13 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 99.12 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 99.08 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 99.08 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 99.04 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 99.0 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 98.82 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.27 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 98.16 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 98.09 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 98.04 | |
| 3pzx_A | 557 | Formate--tetrahydrofolate ligase; HET: TOE; 2.20A | 97.92 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.9 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.88 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.78 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.68 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 97.62 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.61 | |
| 2obn_A | 349 | Hypothetical protein; structural genomics, joint c | 97.57 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 97.54 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 97.48 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.47 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 97.45 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.37 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 97.3 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 97.3 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 97.29 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.23 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 97.22 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.16 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.15 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 97.05 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 96.99 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 96.97 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.97 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.88 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 96.86 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 96.79 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 96.78 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.75 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 96.75 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.69 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.67 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.64 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 96.63 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.58 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 96.58 | |
| 1s1m_A | 545 | CTP synthase; CTP synthetase, UTP:ammonia ligase ( | 96.56 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.51 | |
| 1vco_A | 550 | CTP synthetase; tetramer, riken structural genomic | 96.47 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.46 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.45 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.45 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 96.34 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 96.26 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 96.25 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 96.25 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.21 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.17 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.17 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.14 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 96.14 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.08 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 96.08 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.04 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 96.02 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.99 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.99 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 95.98 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 95.97 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 95.92 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 95.91 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.84 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 95.83 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.77 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.75 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 95.71 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.7 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 95.7 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 95.68 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 95.66 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 95.58 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 95.57 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 95.49 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 95.44 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 95.33 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.31 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 95.31 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 95.29 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 95.27 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 95.27 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 95.25 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 95.16 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 95.15 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 95.13 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 95.08 | |
| 2vo1_A | 295 | CTP synthase 1; pyrimidine biosynthesis, glutamine | 95.04 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 95.01 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 95.0 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 94.95 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 94.95 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 94.9 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 94.85 | |
| 2c5m_A | 294 | CTP synthase; cytidine 5-prime triphosphate synthe | 94.84 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 94.83 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.82 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 94.8 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.67 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 94.65 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 94.64 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 94.62 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 94.6 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 94.59 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 94.5 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 94.47 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 94.46 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 94.44 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 94.43 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 94.37 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 94.36 | |
| 2g0t_A | 350 | Conserved hypothetical protein; structural genomic | 94.34 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 94.33 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 94.31 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 94.27 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 94.26 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 94.25 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 94.24 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 94.23 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 94.1 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 94.1 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 94.06 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 94.05 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 94.03 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 93.99 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 93.97 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 93.97 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 93.97 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.94 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.93 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 93.93 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 93.9 | |
| 3nva_A | 535 | CTP synthase; rossman fold, nucleotide binding, LI | 93.86 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 93.86 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 93.83 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 93.78 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.76 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 93.76 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 93.74 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 93.74 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 93.74 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 93.67 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 93.63 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 93.62 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 93.61 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 93.6 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 93.59 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 93.53 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 93.52 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 93.4 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 93.36 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 93.32 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 93.29 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 93.28 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 93.26 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 93.18 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 93.15 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 93.05 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 93.02 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.88 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 92.88 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 92.86 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 92.85 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 92.82 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 92.81 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 92.78 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 92.75 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 92.7 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 92.64 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 92.6 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 92.6 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 92.57 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 92.57 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 92.48 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 92.25 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 92.24 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 92.21 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 92.19 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 92.19 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 92.16 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 92.15 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 92.14 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 92.12 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 92.08 | |
| 3do6_A | 543 | Formate--tetrahydrofolate ligase; TM1766, putative | 92.07 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 92.05 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 92.04 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 91.92 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 91.91 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 91.87 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 91.86 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 91.82 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 91.8 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 91.79 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 91.67 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 91.65 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 91.53 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 91.52 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.47 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 91.4 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 91.36 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 91.26 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 91.26 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 91.26 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 91.24 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 91.21 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 91.18 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 91.18 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 91.15 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 91.09 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 91.05 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 90.75 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 90.59 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 90.52 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 90.45 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 90.4 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 90.31 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 90.23 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 90.22 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 90.17 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 90.11 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 90.1 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 90.0 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 89.91 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 89.9 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 89.81 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 89.75 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 89.67 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 89.61 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 89.55 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 89.49 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 89.46 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 89.45 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 89.38 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 89.36 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 89.31 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 89.2 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 89.19 | |
| 2l8b_A | 189 | Protein TRAI, DNA helicase I; RECD, hydrolase; NMR | 89.14 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 89.13 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 89.12 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 89.06 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 88.98 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 88.84 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 88.75 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 88.67 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 88.64 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 88.27 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 88.25 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 88.25 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 88.22 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 88.19 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 88.17 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 88.11 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 88.1 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 88.04 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 87.98 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 87.94 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 87.93 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 87.8 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 87.78 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 87.72 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 87.67 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 87.44 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 87.31 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 87.14 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 87.02 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 86.98 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 86.77 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 86.71 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 86.67 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 86.52 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 86.33 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 86.18 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 85.99 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 85.74 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 85.66 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 85.62 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 85.58 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 85.52 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 85.48 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 85.26 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 84.67 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 84.47 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 84.39 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 84.33 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 84.24 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 84.14 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 84.12 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 84.05 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 83.96 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 83.96 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 83.83 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 83.74 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 83.65 | |
| 3czq_A | 304 | Putative polyphosphate kinase 2; structural genomi | 83.37 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 83.1 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 83.04 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 82.9 | |
| 1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 82.74 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 82.61 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 82.56 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 82.53 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 82.35 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 82.3 | |
| 3rsc_A | 415 | CALG2; TDP, enediyne, structural genomics, PSI-2, | 82.27 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 82.23 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 82.07 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 82.04 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 82.03 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 81.95 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 81.94 | |
| 4ehx_A | 315 | Tetraacyldisaccharide 4'-kinase; membrane protein, | 81.75 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 81.75 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 81.73 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 81.46 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 81.35 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 81.07 | |
| 3oti_A | 398 | CALG3; calicheamicin, TDP, structural genomics, PS | 80.96 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 80.9 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 80.88 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 80.71 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 80.51 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 80.43 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 80.31 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 80.21 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 80.18 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 80.06 |
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.5e-55 Score=421.51 Aligned_cols=315 Identities=54% Similarity=0.879 Sum_probs=246.8
Q ss_pred cchhhHHhhhcCCCeEEEEEeCCCCCcHHHHHHHHHHHHHHCCCCEEEEeCCCCCChhhHhhcccCCCceeecCcCCcee
Q 017873 14 IPEGSVRNILEQDSLKWVFVGGKGGVGKTTCSSILSILLAEVRPSVLIISTDPAHNLSDAFQQRFTKTPTLVNGFSNLYA 93 (365)
Q Consensus 14 ~~~~~l~~~~~~~~~~i~~~sgKGGvGKTT~aa~lA~~la~~G~rVLLiD~D~~~~l~~~~~~~~~~~~~~~~~~~~l~~ 93 (365)
.++++|+.++++++++|+|+||||||||||+|+|+|.++|+.|+||+|||+||+++++++|+.+.+..++.+.+.+|+++
T Consensus 2 ~l~~~l~~~l~~~~~~i~~~sgkGGvGKTt~a~~lA~~la~~g~~vllid~D~~~~l~~~l~~~~~~~~~~v~~~~~L~~ 81 (334)
T 3iqw_A 2 SMEPTLQSILDQRSLRWIFVGGKGGVGKTTTSCSLAIQLAKVRRSVLLLSTDPAHNLSDAFSQKFGKEARLVEGFDNLYA 81 (334)
T ss_dssp CCCSSSHHHHHCTTCCEEEEECSTTSSHHHHHHHHHHHHTTSSSCEEEEECCSSCHHHHHHTSCCCSSCEECTTCSSEEE
T ss_pred CccccHHHHhcCCCeEEEEEeCCCCccHHHHHHHHHHHHHhCCCcEEEEECCCCCChhHHhccccCCCceeecCCCCcee
Confidence 47899999999999999999999999999999999999999999999999999999999999988888888888899999
Q ss_pred eecCccccc-ccccc---------cCccchhHHhhhcCCCHHHHHHHHHHHHHHHhCCCcEEEEcCCCChhHHHhhhchH
Q 017873 94 MEVDPSVEE-ETGST---------EGMDSLFSELANAIPGIDEAMSFAEMLKLVQTMDYSCIVFDTAPTGHTLRLLQFPS 163 (365)
Q Consensus 94 ~~~d~~~~~-~~~~~---------~~~~~~~~~~~~~~pg~~~~~~l~~l~~~l~~~~yD~IiiDtpp~~~~l~~l~lp~ 163 (365)
.++|+...+ ++... .++ .+..++....||+.+...+.++.+.+.+.+||||||||||+++++++|.+|+
T Consensus 82 ~~id~~~~~~~~~~~~~~~~~~~~~~l-~~~~~~~~~~Pg~~e~~~~~~~~~~~~~~~yD~VIiDtpPtg~tLrlL~lp~ 160 (334)
T 3iqw_A 82 MEIDPNGSMQDLLAGQTGDGDAGMGGV-GVMQDLAYAIPGIDEAMSFAEVLKQVNSLSYETIVFDTAPTGHTLRFLQFPT 160 (334)
T ss_dssp EECCC---------------------------------CCHHHHHHHHHHHHHHHTSSCSEEEEECCCHHHHHHHHTHHH
T ss_pred eecCHHHHHHHHHHHhhcccccccccc-hhhHHhhcCCCCHHHHHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHH
Confidence 999988766 22111 233 3444555567999999999999999987799999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhhhhhHHHHHhhhCC-CCccchhHHHHHHHHHHHHHHHHHHHhcCCCceEEEEeecCCcchHHHHH
Q 017873 164 TLEKGLDKMMSLKNKFGGMINQMTRLFGI-DDEFGEDALLGRLEGMKDVIERVNKQFKDPDLTTFVCVCIPEFLSLYETE 242 (365)
Q Consensus 164 ~l~~~l~~~~~~~~~~~~~~~~~~~~~g~-~~~~~~~~~~~~l~~~~~~~~~~~~~l~d~~~t~~~lVt~p~~~s~~et~ 242 (365)
.+.||+++++++.++++++++++.+.+|. +...+.+++++.++++++.++++++.|+||..|++++|++|+.+++.+++
T Consensus 161 ~l~~~l~~~~~~~~~~~~~~~~~~~~~g~~p~~~~~~~~~~~l~~~~~~~~~~~~~L~dp~~t~~vlVt~pe~~~~~ea~ 240 (334)
T 3iqw_A 161 VLEKALAKVSQLSGQYGSLLNGILGGSGTLPNGQTLSDVMEKLDSLRVTISEVNAQFKDERLTTFVCVCIPEFLSLYETE 240 (334)
T ss_dssp HC-----------------------------------CCHHHHHHHHHHHHHHHHHHTCTTTEEEEEEECSSHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhhcCCcccccHHHHHHHHHHHHHHHHHHHHHhhCCCCeeEEEEECCCccHHHHHH
Confidence 99999999999999999998888776653 11245677889999999999999999999999999999999999999999
Q ss_pred HHHHHHHhCCCCcCeEEEcCccCCCCccchHHHHHHHHHHHHHHHHHHhhcCC-CcEEEecCCCCCCCCHHHHHHHHHhh
Q 017873 243 RLVQELTKFEIDTHNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDD-FHITKLPLLPEEVTGIEALKAFSQHF 321 (365)
Q Consensus 243 ~~~~~L~~~gi~v~~vVvN~~~~~~~~~~~~~~~~~~~~q~~~l~~i~~~~~~-~~i~~vp~~~~e~~g~~~L~~l~~~l 321 (365)
++++.|+++|+++.|+|+|++.+|+....|++|++|+..|++++++|.+.|.+ .+++.+|+++.||.|+++|+.+++.|
T Consensus 241 r~~~~L~~~gi~v~gvVvN~~~~p~~~~~~~~~~~r~~~q~~~l~~i~~~~~~~~~~~~~pl~~~e~~G~~~L~~~~~~l 320 (334)
T 3iqw_A 241 RMIQELANYGIDTHCIVVNQLLFPKPGSDCEQCTARRRMQKKYLDQIEELYDEEFNVVKMPLLVEEVRGKERLEKFSEML 320 (334)
T ss_dssp HHHHHHHHTTCCEEEEEEEEECCCCTTCCCHHHHHHHHHHHHHHHHHHHHHTTTSEEEEEECCSSCCCHHHHHHHHHHHH
T ss_pred HHHHHHHHCCCCccEEEECCCcCcccCCcCHHHHHHHHHHHHHHHHHHHhccCCCCEEEecCCCCCCCCHHHHHHHHHHH
Confidence 99999999999999999999965654567999999999999999999999998 99999999999999999999999999
Q ss_pred cCCCCCCC
Q 017873 322 VTPYQPST 329 (365)
Q Consensus 322 ~~~~~~~~ 329 (365)
|+++.|-.
T Consensus 321 ~~~~~~~~ 328 (334)
T 3iqw_A 321 IKPFVPPE 328 (334)
T ss_dssp HSCCCCCC
T ss_pred cCCCCCcc
Confidence 99998755
|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3do6_A Formate--tetrahydrofolate ligase; TM1766, putative formyltetrahydrofolate synthetase, structural genomics; HET: MSE; 1.85A {Thermotoga maritima} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >4ehx_A Tetraacyldisaccharide 4'-kinase; membrane protein, lipid A, P-loop, P-loop containing nucleoside triphosphate hydrolase; HET: EPE; 1.90A {Aquifex aeolicus} PDB: 4ehy_A* 4ehw_A | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 365 | ||||
| d1ihua1 | 296 | c.37.1.10 (A:1-296) Arsenite-translocating ATPase | 4e-56 | |
| d1ihua2 | 279 | c.37.1.10 (A:308-586) Arsenite-translocating ATPas | 3e-47 | |
| d1cp2a_ | 269 | c.37.1.10 (A:) Nitrogenase iron protein {Clostridi | 2e-08 | |
| d2afhe1 | 289 | c.37.1.10 (E:1-289) Nitrogenase iron protein {Azot | 5e-08 | |
| d1hyqa_ | 232 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 1e-06 | |
| d1g3qa_ | 237 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 3e-06 | |
| d2i3ba1 | 189 | c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 | 0.004 |
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Arsenite-translocating ATPase ArsA species: Escherichia coli [TaxId: 562]
Score = 183 bits (465), Expect = 4e-56
Identities = 81/307 (26%), Positives = 116/307 (37%), Gaps = 34/307 (11%)
Query: 25 QDSLKWVFVGGKGGVGKTTCSSILSILLAEVRPSVLIISTDPAHNLSDAFQQRFTKTPTL 84
Q+ ++F GKGGVGKT+ S +I LAE VL++STDPA N+ F Q T
Sbjct: 5 QNIPPYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLVSTDPASNVGQVFSQTIGNTIQA 64
Query: 85 VNGFSNLYAMEVDPSVEEETGSTEGMDSLFSELANA-IPGIDEAMSFAEM---------- 133
+ L A+E+DP + +D + L + + I+E +S A
Sbjct: 65 IASVPGLSALEIDPQAAAQQYRARIVDPIKGVLPDDVVSSINEQLSGACTTEIAAFDEFT 124
Query: 134 ---LKLVQTMDYSCIVFDTAPTGHTLRLLQFPSTLEKGLDKMMSLKNKFGGMINQMTRLF 190
+ I+FDTAPTGHT+RLLQ P +D + G M
Sbjct: 125 GLLTDASLLTRFDHIIFDTAPTGHTIRLLQLPGAWSSFIDSNPEGASCLGPMAGL----- 179
Query: 191 GIDDEFGEDALLGRLEGMKDVIERVNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELTK 250
E ++ + DP T V V + +L E R EL
Sbjct: 180 ---------------EKQREQYAYAVEALSDPKRTRLVLVARLQKSTLQEVARTHLELAA 224
Query: 251 FEIDTHNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDDFHITKLPLLPEEVTG 310
+ ++IN VL E L A +Q+ L L L P + G
Sbjct: 225 IGLKNQYLVINGVLPKTEAANDTLAAAIWEREQEALANLPADLAGLPTDTLFLQPVNMVG 284
Query: 311 IEALKAF 317
+ AL
Sbjct: 285 VSALSRL 291
|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279 | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Length = 269 | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Length = 289 | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232 | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237 | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 365 | |||
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 100.0 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 100.0 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 99.88 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 99.86 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 99.85 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 99.85 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 99.69 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 99.0 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 98.95 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 98.9 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 98.88 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 98.88 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 98.32 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 98.14 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.82 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.7 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.65 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.58 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.56 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.56 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.49 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.46 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.43 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 97.31 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.04 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.0 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.95 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.92 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.9 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 96.86 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.83 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.65 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.61 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.61 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.49 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 96.34 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.32 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.29 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.21 | |
| d1vcoa2 | 272 | CTP synthase PyrG, N-terminal domain {Thermus ther | 96.2 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.18 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.12 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.12 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.04 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 96.01 | |
| d1s1ma2 | 266 | CTP synthase PyrG, N-terminal domain {Escherichia | 95.93 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 95.9 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.88 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.84 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 95.74 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.63 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 95.58 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.56 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 95.54 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 95.51 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 95.5 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.45 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.43 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 95.42 | |
| d2vo1a1 | 273 | CTP synthase PyrG, N-terminal domain {Human (Homo | 95.34 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 95.2 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.13 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.13 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 95.12 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 95.0 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.95 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.91 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 94.79 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 94.7 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 94.3 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 94.26 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.25 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 94.15 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 94.05 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.95 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 93.94 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 93.88 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.76 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.75 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.69 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 93.68 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 93.66 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 93.59 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 93.56 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 93.3 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 93.08 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 93.02 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 92.99 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 92.91 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 92.9 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 92.8 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 92.78 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 92.72 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 92.63 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 92.63 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 92.44 | |
| d1eg7a_ | 549 | Formyltetrahydrofolate synthetase {Moorella thermo | 92.38 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 92.17 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 91.98 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 91.97 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.91 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 91.46 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 91.46 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 91.45 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 91.38 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 91.35 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 91.05 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 91.03 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 90.94 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 90.73 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 90.58 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.56 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 90.54 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 90.47 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 90.45 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 90.36 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 89.81 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 89.26 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 89.22 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 89.18 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 89.03 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 89.01 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 88.59 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 88.57 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 88.07 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 88.03 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 87.98 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 87.77 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 87.68 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 87.63 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 87.61 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 87.48 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 87.38 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 87.34 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 87.01 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 86.91 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 86.83 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 86.82 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 86.75 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 86.49 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 86.43 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 85.74 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 85.5 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 85.15 | |
| d1e8ca3 | 234 | UDP-N-acetylmuramyl tripeptide synthetase MurE {Es | 84.98 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 84.96 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 84.84 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 84.51 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 84.35 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 83.76 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 83.26 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 82.99 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 82.96 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 81.85 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 80.88 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 80.29 |
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Arsenite-translocating ATPase ArsA species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=5.8e-43 Score=327.07 Aligned_cols=273 Identities=30% Similarity=0.413 Sum_probs=209.6
Q ss_pred CCeEEEEEeCCCCCcHHHHHHHHHHHHHHCCCCEEEEeCCCCCChhhHhhcccCCCceeecCcCCceeeecCccccc-cc
Q 017873 26 DSLKWVFVGGKGGVGKTTCSSILSILLAEVRPSVLIISTDPAHNLSDAFQQRFTKTPTLVNGFSNLYAMEVDPSVEE-ET 104 (365)
Q Consensus 26 ~~~~i~~~sgKGGvGKTT~aa~lA~~la~~G~rVLLiD~D~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~d~~~~~-~~ 104 (365)
++.+|+|+||||||||||+|+|+|.+||++|+|||+||+||++|+++.||.+.+..+....+.++++..++++.... ++
T Consensus 6 ~~p~~i~~sGKGGVGKTTvaa~lA~~lA~~G~rVLlvD~Dp~~~l~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 85 (296)
T d1ihua1 6 NIPPYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLVSTDPASNVGQVFSQTIGNTIQAIASVPGLSALEIDPQAAAQQY 85 (296)
T ss_dssp SCCSEEEEECSTTSSHHHHHHHHHHHHHHTTCCEEEEECCTTCCHHHHTTSCCCSSCEECTTSTTEEEEECCHHHHHHHH
T ss_pred CCCeEEEEECCCcChHHHHHHHHHHHHHHCCCCEEEEeCCCCCCHHHHhCCCCcccccccccccccchhccChhhHHHHH
Confidence 45678899999999999999999999999999999999999999999999998888888777889999998887665 11
Q ss_pred cc--ccC----c-cchhHHhhh--cCCCHHHHHHHHHHHHHHHh----CCCcEEEEcCCCChhHHHhhhchHHHHHHHHH
Q 017873 105 GS--TEG----M-DSLFSELAN--AIPGIDEAMSFAEMLKLVQT----MDYSCIVFDTAPTGHTLRLLQFPSTLEKGLDK 171 (365)
Q Consensus 105 ~~--~~~----~-~~~~~~~~~--~~pg~~~~~~l~~l~~~l~~----~~yD~IiiDtpp~~~~l~~l~lp~~l~~~l~~ 171 (365)
.. ..+ . ......... ..+.......+.++...+.. .+||||||||||++++++++.+|..+.+|+..
T Consensus 86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yD~iviD~pp~~~~l~~~~l~~~~~~~~~~ 165 (296)
T d1ihua1 86 RARIVDPIKGVLPDDVVSSINEQLSGACTTEIAAFDEFTGLLTDASLLTRFDHIIFDTAPTGHTIRLLQLPGAWSSFIDS 165 (296)
T ss_dssp HHHHHGGGTTTSCHHHHHHHHHHTSSHHHHHHHHHHHHHHHHHCTTHHHHCSEEEESSCCCHHHHHHHHCGGGGTCCC--
T ss_pred HhhccchhhhcccccchhhhHHhhhhhhhhhHHHHHHHHHHHHHhhhcccceEEEeccCCCchHHHHHhHHHHHHHHHhh
Confidence 10 000 1 011111111 11112222334444443322 26999999999999999999999999888665
Q ss_pred HHHHHHhhhhhHHHHHhhhCCCCccchhHHHHHHHHHHHHHHHHHHHhcCCCceEEEEeecCCcchHHHHHHHHHHHHhC
Q 017873 172 MMSLKNKFGGMINQMTRLFGIDDEFGEDALLGRLEGMKDVIERVNKQFKDPDLTTFVCVCIPEFLSLYETERLVQELTKF 251 (365)
Q Consensus 172 ~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~l~~~~~~~~~~~~~l~d~~~t~~~lVt~p~~~s~~et~~~~~~L~~~ 251 (365)
.......+.+. . .+..+.+.+..+.+.+.|+..|++++||+|+.+++.+++++++.+++.
T Consensus 166 ~~~~~~~~~~~-------~-------------~~~~~~~~~~~~~~~~~~~~~t~~~lVt~pe~~~~~~~~r~~~~l~~~ 225 (296)
T d1ihua1 166 NPEGASCLGPM-------A-------------GLEKQREQYAYAVEALSDPKRTRLVLVARLQKSTLQEVARTHLELAAI 225 (296)
T ss_dssp ----CCCCGGG-------G-------------GCCSCHHHHHHHHHHHHCTTTEEEEEEEESCHHHHHHHHHHHHHHHHH
T ss_pred ccchhhhcccc-------c-------------chhHHHHHHHHHHhhccCcccceeeEecCcchhHHHHHHHHHHHHHhc
Confidence 54333222111 1 122345667778888999999999999999999999999999999999
Q ss_pred CCCcCeEEEcCccCCCCccchHHHHHHHHHHHHHHHHHHhhcCCCcEEEecCCCCCCCCHHHHHHHH
Q 017873 252 EIDTHNIIINQVLYDDEDVESKLLRARMRMQQKYLDQFYMLYDDFHITKLPLLPEEVTGIEALKAFS 318 (365)
Q Consensus 252 gi~v~~vVvN~~~~~~~~~~~~~~~~~~~~q~~~l~~i~~~~~~~~i~~vp~~~~e~~g~~~L~~l~ 318 (365)
|+++.++|+||+.+..+...|.+|+++...|.++++++.+.|.+.++..+|+.+.|+.|+++|+++.
T Consensus 226 gi~~~~vVvN~v~p~~~~~~~~~~~~~~~~q~~~l~~i~~~~~~~~~~~vp~~~~e~~G~~aL~~l~ 292 (296)
T d1ihua1 226 GLKNQYLVINGVLPKTEAANDTLAAAIWEREQEALANLPADLAGLPTDTLFLQPVNMVGVSALSRLL 292 (296)
T ss_dssp TCCCEEEEEEEECCGGGGSSCHHHHHHHHHHHHHHHTCCHHHHTSCEEEEECCSSCCCSHHHHHHTT
T ss_pred CCCceEEEEcCCcCccCCCCCHHHHHHHHHHHHHHHHHHHHccCCceEEecCCCCCCcCHHHHHHHh
Confidence 9999999999995444445788999999999999999999999999999999999999999998873
|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|