Citrus Sinensis ID: 017904

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----

MEKLRRIVNEIAYAQDHAKLTPIQSSLIPLLSLASSLYGISLFLRHSFYRFGFFSKHRLPVPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYAGGDEVRMLERHLLERPAKIGKNCINPKVGSHLKSGKIGAVILDDGMQHWSLRRDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKRADIAVVHHADLISEQNLKDIELEMRDIKKSLSIFFTRMVPSYLFEVGNINSKIPLTAVCNANVLCVSAIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQARDIEMIKKKLEELEGKFNPKPIVVVTEKDYDRDPEILMHLEAYKVLVLCSKLQIIPCRGCTEDSFKLLLKELVDVK

ccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEccccEEEEccccccccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHcccccEEEccccHHHHHHHHHHcccccEEEEcccccccccccccEEEEEEcccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEEcccEEEccccccccccccccccEEEEEEEccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEcccccccccHHHccccccEEEEEEEEEEEEccccccHHHHHHHHHHHHHcc

cHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEccccccHHHHHHHHHHHHcccccEEEEccccccccHHEHEEccccccEEEcccHHHHHHHHHHHcccccEEEEccccHHHHHHccEEEEEEEcccccccccccccccccccHHHHccccEEEEccccccccccHHHHHHHHHHHccccccEEEEEcccHEEEccccccccccHHcccccEEEEEEccccHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHccccccEEEEEcEEEEEcccccccHHHHHHHHHHHHHcc

MEKLRRIVNEIAYaqdhakltpiqsslipLLSLASSLYGISLFLRhsfyrfgffskhrlpvpvisvgnltwggngktpMVEFLAHCladseispliltrgyaggdEVRMLERHLLerpakigkncinpkvgshlksgkIGAVILDDGMQHWSLRRDLEIVMvnglmpwgnrkllplgplreplmaLKRADIAVVHHADLISEQNLKDIELEMRDIKKSLSIFFTRMVPSylfevgninskipltAVCNANVLCVSAIGSANAFVQSLqklgpcsvnrldfndhhsfQARDIEMIKKKLEELegkfnpkpivvvtekdydrdpeiLMHLEAYKVLVLCsklqiipcrgctEDSFKLLLKELVDVK

MEKLRRIVNEIAyaqdhakltpIQSSLIPLLSLASSLYGISLFLRHSFYRFGFFSKHRLPVPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYAGGDEVRMLERHLLErpakigkncinpkvgshlkSGKIGAVILDDGMQHWSLRRDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKRADIAVVHHADliseqnlkdIELEMRDIKKSLSIFFTRMVPSYLFEVGNINSKIPLTAVCNANVLCVSAIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQARDIEMIKKKLEelegkfnpkpivvvtEKDYDRDPEILMHLEAYKVLVLCSKLQIIPCRGCTEDSFKLLLKELVDVK

MEKLRRIVNEIAYAQDHAKLTPIQsslipllslasslYGISLFLRHSFYRFGFFSKHRLPVPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYAGGDEVRMLERHLLERPAKIGKNCINPKVGSHLKSGKIGAVILDDGMQHWSLRRDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKRADIAVVHHADLISEQNLKDIELEMRDIKKSLSIFFTRMVPSYLFEVGNINSKIPLTAVCNANVLCVSAIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQARDIEMIkkkleeleGKFNPKPIVVVTEKDYDRDPEILMHLEAYKVLVLCSKLQIIPCRGCTEDSFKLLLKELVDVK

*****RIVNEIAYAQDHAKLTPIQSSLIPLLSLASSLYGISLFLRHSFYRFGFFSKHRLPVPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYAGGDEVRMLERHLLERPAKIGKNCINPKVGSHLKSGKIGAVILDDGMQHWSLRRDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKRADIAVVHHADLISEQNLKDIELEMRDIKKSLSIFFTRMVPSYLFEVGNINSKIPLTAVCNANVLCVSAIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQARDIEMIKKKLEELEGKFNPKPIVVVTEKDYDRDPEILMHLEAYKVLVLCSKLQIIPCRGCTEDSFKLLLKELV***

iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		364	2.2.26 [Sep-21-2011]
Q8LEA0		395	Probable tetraacyldisacch	yes	no	1.0	0.921	0.558	1e-121
B8CZC3		384	Tetraacyldisaccharide 4'-	yes	no	0.686	0.651	0.342	2e-34
Q2LVL1		374	Tetraacyldisaccharide 4'-	yes	no	0.818	0.796	0.313	8e-33
A0KLY1		333	Tetraacyldisaccharide 4'-	yes	no	0.703	0.768	0.319	5e-29
Q8EDF1		335	Tetraacyldisaccharide 4'-	yes	no	0.75	0.814	0.297	4e-27
B2KC48		374	Tetraacyldisaccharide 4'-	yes	no	0.829	0.807	0.290	5e-27
Q7UNW7		365	Tetraacyldisaccharide 4'-	yes	no	0.796	0.794	0.299	5e-27
A5F728		335	Tetraacyldisaccharide 4'-	yes	no	0.719	0.782	0.273	7e-27
C4L8W2		326	Tetraacyldisaccharide 4'-	yes	no	0.722	0.806	0.315	8e-27
A1RL20		337	Tetraacyldisaccharide 4'-	yes	no	0.728	0.786	0.295	1e-26

>sp\|Q8LEA0\|LPXK_ARATH Probable tetraacyldisaccharide 4'-kinase, mitochondrial OS=Arabidopsis thaliana GN=LPXK PE=2 SV=1	Back alignment and function desciption

 Score =  436 bits (1120), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/390 (55%), Positives = 277/390 (71%), Gaps = 26/390 (6%)

Query: 1   MEKLRRIVNEIAYAQDHAKLTPIQSSLIPLLSLASSLYGISLFLRHSFYRFGFFSKHRLP 60
           MEKLR++VNEIAY + H     +  SL+P L++ASSLYG++L +R S YR+    KHRLP
Sbjct: 1   MEKLRKVVNEIAYTRVHTNSPALHRSLVPFLTIASSLYGVALQIRRSLYRYSLLQKHRLP 60

Query: 61  VPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYAGGDEVRMLERHLLERPAK 120
           VPVISVGNL+WGGNGKTPMVE+++  L DS ++PLILTRGYAGGDEV+MLERHL   P K
Sbjct: 61  VPVISVGNLSWGGNGKTPMVEYISQFLVDSGLTPLILTRGYAGGDEVKMLERHLRGGPVK 120

Query: 121 IG---------------KNCINP-----------KVGSHLKSGKIGAVILDDGMQHWSLR 154
           IG                 C++            +      S KIG +ILDDGMQHWSL 
Sbjct: 121 IGVGANRAATAALFLDKYGCVDSSSLRSFFDLHERAQVWTISEKIGCIILDDGMQHWSLS 180

Query: 155 RDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKRADIAVVHHADLISEQNLKDIELEMRD 214
           RDLEIVM+NGL PWGN  L+P GPLREPL+AL+RAD+AVVHH DLI++Q+L+DIE  ++ 
Sbjct: 181 RDLEIVMLNGLNPWGNGHLMPHGPLREPLLALERADVAVVHHVDLITKQSLRDIENMIQG 240

Query: 215 IKKSLSIFFTRMVPSYLFEVGNINSKIPLTAVCNANVLCVSAIGSANAFVQSLQKLGPCS 274
            KKS+ IF+++MVP YLF+V N  S + L A+  A+VLCVSAIGSA+AFV+S++  G   
Sbjct: 241 FKKSIPIFYSKMVPKYLFDVKNARSHVALEALRCASVLCVSAIGSADAFVKSIEMTGAHY 300

Query: 275 VNRLDFNDHHSFQARDIEMIKKKLEELEGKFNPKPIVVVTEKDYDRDPEILMHLEAYKVL 334
           V+RLDF+DHH F+A D+E + ++ + LE K N KPI+VVTEKDYDRDPEIL  L++Y VL
Sbjct: 301 VDRLDFSDHHLFEAEDVETMSRRAKGLEHKSNCKPIIVVTEKDYDRDPEILKCLDSYTVL 360

Query: 335 VLCSKLQIIPCRGCTEDSFKLLLKELVDVK 364
           VLCS+LQI P      DSF   L + +  K
Sbjct: 361 VLCSELQITPILETDVDSFNYTLMKALAAK 390

Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell. Transfers the gamma-phosphate of ATP to the 4'-position of a tetraacyldisaccharide 1-phosphate intermediate (termed DS-1-P) to form tetraacyldisaccharide 1,4'-bis-phosphate (lipid IVA). Lipid A-like molecules in plants may serve as structural components of the outer membranes of mitochondria and/or chloroplasts, or may be involved in signal transduction or plant defense responses.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 1EC: 3EC: 0

>sp\|B8CZC3\|LPXK_HALOH Tetraacyldisaccharide 4'-kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=lpxK PE=3 SV=1	Back alignment and function description

>sp\|Q2LVL1\|LPXK_SYNAS Tetraacyldisaccharide 4'-kinase OS=Syntrophus aciditrophicus (strain SB) GN=lpxK PE=3 SV=1	Back alignment and function description

>sp\|A0KLY1\|LPXK_AERHH Tetraacyldisaccharide 4'-kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240) GN=lpxK PE=3 SV=1	Back alignment and function description

>sp\|Q8EDF1\|LPXK_SHEON Tetraacyldisaccharide 4'-kinase OS=Shewanella oneidensis (strain MR-1) GN=lpxK PE=3 SV=1	Back alignment and function description

>sp\|B2KC48\|LPXK_ELUMP Tetraacyldisaccharide 4'-kinase OS=Elusimicrobium minutum (strain Pei191) GN=lpxK PE=3 SV=1	Back alignment and function description

>sp\|Q7UNW7\|LPXK_RHOBA Tetraacyldisaccharide 4'-kinase OS=Rhodopirellula baltica (strain SH1) GN=lpxK PE=3 SV=1	Back alignment and function description

>sp\|A5F728\|LPXK_VIBC3 Tetraacyldisaccharide 4'-kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395) GN=lpxK PE=3 SV=2	Back alignment and function description

>sp\|C4L8W2\|LPXK_TOLAT Tetraacyldisaccharide 4'-kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lpxK PE=3 SV=1	Back alignment and function description

>sp\|A1RL20\|LPXK_SHESW Tetraacyldisaccharide 4'-kinase OS=Shewanella sp. (strain W3-18-1) GN=lpxK PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		364
224126331		392	predicted protein [Populus trichocarpa]	1.0	0.928	0.652	1e-145
297737452		401	unnamed protein product [Vitis vinifera]	1.0	0.907	0.623	1e-137
225460937		464	PREDICTED: tetraacyldisaccharide 4'-kina	0.991	0.778	0.625	1e-135
356527062		399	PREDICTED: tetraacyldisaccharide 4'-kina	0.986	0.899	0.604	1e-129
357459711		400	Tetraacyldisaccharide 4'-kinase [Medicag	1.0	0.91	0.569	1e-124
449444208		463	PREDICTED: tetraacyldisaccharide 4'-kina	0.997	0.784	0.573	1e-123
449517597		431	PREDICTED: tetraacyldisaccharide 4'-kina	0.997	0.842	0.571	1e-122
297834992		395	tetraacyldisaccharide 4'-kinase family p	1.0	0.921	0.574	1e-122
18402635		395	tetraacyldisaccharide 4'-kinase family p	1.0	0.921	0.558	1e-119
334185496		363	tetraacyldisaccharide 4'-kinase family p	0.791	0.793	0.556	8e-95

>gi\|224126331\|ref\|XP_002319812.1\| predicted protein [Populus trichocarpa] gi\|222858188\|gb\|EEE95735.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/391 (65%), Positives = 301/391 (76%), Gaps = 27/391 (6%)

Query: 1   MEKLRRIVNEIAYAQDHAKLTPIQSSLIPLLSLASSLYGISLFLRHSFYRFGFFSKHRLP 60
           MEKLRR+V EIAY QD+ KL+ +  SLIP+LSLASSLY + L +RH  Y FGFFSKHRLP
Sbjct: 1   MEKLRRVVKEIAYVQDYTKLSTLHQSLIPILSLASSLYRVVLSIRHYLYHFGFFSKHRLP 60

Query: 61  VPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYAGGDEVRMLERHLLERPAK 120
           VPVISVGNLTWGGNGKTPMVEF++  LADS ISPLILTRGYAGGDE RML RHL  R  K
Sbjct: 61  VPVISVGNLTWGGNGKTPMVEFISSWLADSGISPLILTRGYAGGDEARMLTRHLRGRAVK 120

Query: 121 IGKNC---------------INP------------KVGSHLKSGKIGAVILDDGMQHWSL 153
           IG                  ++P            K GS + S K+G V+LDDGMQHWSL
Sbjct: 121 IGVGANRAATAACFFKRHGYVDPRDYLVEGKWHEQKEGSRINSRKVGVVVLDDGMQHWSL 180

Query: 154 RRDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKRADIAVVHHADLISEQNLKDIELEMR 213
           +RD+EIVMVNGL PWGN ++LPLGPLREPL AL RAD+AV+HHA+L+SE NL+DI+L M+
Sbjct: 181 QRDIEIVMVNGLTPWGNHQILPLGPLREPLKALGRADVAVIHHANLVSEHNLRDIKLMMQ 240

Query: 214 DIKKSLSIFFTRMVPSYLFEVGNINSKIPLTAVCNANVLCVSAIGSANAFVQSLQKLGPC 273
           ++KKSL IFFTRM P++ FEVGNIN++ PL  +CN  VLCVSAIGSANAFVQ ++K+G  
Sbjct: 241 EVKKSLPIFFTRMSPTHFFEVGNINTRTPLDILCNGVVLCVSAIGSANAFVQGIKKMGTL 300

Query: 274 SVNRLDFNDHHSFQARDIEMIKKKLEELEGKFNPKPIVVVTEKDYDRDPEILMHLEAYKV 333
            V+RLDF+DHHS Q  DIE+I+ KL+ELE KF   P+VV+TEKDYDRDPEIL HL  YKV
Sbjct: 301 YVDRLDFSDHHSLQDTDIEIIRMKLKELEDKFGSMPVVVITEKDYDRDPEILRHLSPYKV 360

Query: 334 LVLCSKLQIIPCRGCTEDSFKLLLKELVDVK 364
           + LCS+LQIIPCRG  +D FK LLKELV+VK
Sbjct: 361 MALCSELQIIPCRGNGDDDFKKLLKELVEVK 391

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297737452\|emb\|CBI26653.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225460937\|ref\|XP_002277963.1\| PREDICTED: tetraacyldisaccharide 4'-kinase-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356527062\|ref\|XP_003532133.1\| PREDICTED: tetraacyldisaccharide 4'-kinase-like [Glycine max]	Back alignment and taxonomy information

>gi\|357459711\|ref\|XP_003600136.1\| Tetraacyldisaccharide 4'-kinase [Medicago truncatula] gi\|355489184\|gb\|AES70387.1\| Tetraacyldisaccharide 4'-kinase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449444208\|ref\|XP_004139867.1\| PREDICTED: tetraacyldisaccharide 4'-kinase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449517597\|ref\|XP_004165832.1\| PREDICTED: tetraacyldisaccharide 4'-kinase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297834992\|ref\|XP_002885378.1\| tetraacyldisaccharide 4'-kinase family protein [Arabidopsis lyrata subsp. lyrata] gi\|297331218\|gb\|EFH61637.1\| tetraacyldisaccharide 4'-kinase family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|18402635\|ref\|NP_566663.1\| tetraacyldisaccharide 4'-kinase family protein [Arabidopsis thaliana] gi\|21553672\|gb\|AAM62765.1\| unknown [Arabidopsis thaliana] gi\|332642864\|gb\|AEE76385.1\| tetraacyldisaccharide 4'-kinase family protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334185496\|ref\|NP_001189941.1\| tetraacyldisaccharide 4'-kinase family protein [Arabidopsis thaliana] gi\|332642865\|gb\|AEE76386.1\| tetraacyldisaccharide 4'-kinase family protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		364
TAIR\|locus:2085765		395	LpxK "AT3G20480" [Arabidopsis	0.629	0.579	0.593	4e-106
UNIPROTKB\|Q9KQX0		336	lpxK "Tetraacyldisaccharide 4'	0.431	0.467	0.339	5.1e-26
TIGR_CMR\|VC_1877		336	VC_1877 "tetraacyldisaccharide	0.431	0.467	0.339	5.1e-26
TIGR_CMR\|SO_2801		335	SO_2801 "tetraacyldisaccharide	0.447	0.486	0.363	5.6e-25
TIGR_CMR\|CPS_2126		343	CPS_2126 "tetraacyldisaccharid	0.640	0.679	0.320	1.1e-21
TIGR_CMR\|GSU_2258		353	GSU_2258 "tetraacyldisaccharid	0.675	0.696	0.291	8.3e-18
TIGR_CMR\|CBU_0857		325	CBU_0857 "tetraacyldisaccharid	0.604	0.676	0.298	1.2e-17
TIGR_CMR\|SPO_3445		333	SPO_3445 "tetraacyldisaccharid	0.456	0.498	0.348	1.9e-15
UNIPROTKB\|P27300		328	lpxK [Escherichia coli K-12 (t	0.277	0.307	0.309	2e-06

TAIR\|locus:2085765 LpxK "AT3G20480" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 688 (247.2 bits), Expect = 4.0e-106, Sum P(2) = 4.0e-106
 Identities = 136/229 (59%), Positives = 171/229 (74%)

Query:   136 SGKIGAVILDDGMQHWSLRRDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKRADIAVVH 195
             S KIG +ILDDGMQHWSL RDLEIVM+NGL PWGN  L+P GPLREPL+AL+RAD+AVVH
Sbjct:   162 SEKIGCIILDDGMQHWSLSRDLEIVMLNGLNPWGNGHLMPHGPLREPLLALERADVAVVH 221

Query:   196 HADLISEQNLKDIELEMRDIKKSLSIFFTRMVPSYLFEVGNINSKIPLTAVCNANVLCVS 255
             H DLI++Q+L+DIE  ++  KKS+ IF+++MVP YLF+V N  S + L A+  A+VLCVS
Sbjct:   222 HVDLITKQSLRDIENMIQGFKKSIPIFYSKMVPKYLFDVKNARSHVALEALRCASVLCVS 281

Query:   256 AIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQARDIEMIXXXXXXXXGKFNPKPIVVVTE 315
             AIGSA+AFV+S++  G   V+RLDF+DHH F+A D+E +         K N KPI+VVTE
Sbjct:   282 AIGSADAFVKSIEMTGAHYVDRLDFSDHHLFEAEDVETMSRRAKGLEHKSNCKPIIVVTE 341

Query:   316 KDYDRDPEILMHLEAYKVLVLCSKLQIIPCRGCTEDSFKLLLKELVDVK 364
             KDYDRDPEIL  L++Y VLVLCS+LQI P      DSF   L + +  K
Sbjct:   342 KDYDRDPEILKCLDSYTVLVLCSELQITPILETDVDSFNYTLMKALAAK 390

GO:0009029 "tetraacyldisaccharide 4'-kinase activity" evidence=ISS;IMP

GO:0009245 "lipid A biosynthetic process" evidence=ISS

GO:0016020 "membrane" evidence=ISS

GO:0005739 "mitochondrion" evidence=IDA

GO:2001289 "lipid X metabolic process" evidence=IMP

GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA

UNIPROTKB\|Q9KQX0 lpxK "Tetraacyldisaccharide 4'-kinase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_1877 VC_1877 "tetraacyldisaccharide 4`-kinase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_2801 SO_2801 "tetraacyldisaccharide 4-kinase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_2126 CPS_2126 "tetraacyldisaccharide 4'-kinase" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_2258 GSU_2258 "tetraacyldisaccharide 4'-kinase" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_0857 CBU_0857 "tetraacyldisaccharide 4'-kinase" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|SPO_3445 SPO_3445 "tetraacyldisaccharide 4'-kinase" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

UNIPROTKB\|P27300 lpxK [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8LEA0	LPXK_ARATH	2, ., 7, ., 1, ., 1, 3, 0	0.5589	1.0	0.9215	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.7.1	0.766
3rd Layer	2.7.1.130	0.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.XIII.2878.1	hypothetical protein (392 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	eugene3.00160899	hypothetical protein (446 aa)	•	•	•	•	0.892
	gw1.IV.2364.1	hypothetical protein (234 aa)	•	•		•	0.885
	estExt_fgenesh4_pg.C_LG_VI0968	hypothetical protein (365 aa)	•	•		•	0.884
	gw1.X.6418.1	hypothetical protein (277 aa)	•	•		•	0.855
	eugene3.01070060	CMP-KDO synthetase (288 aa)	•	•		•	0.701
	fgenesh4_pg.C_LG_XI000980	CMP-KDO synthetase (293 aa)	•	•		•	0.698
	estExt_fgenesh4_pg.C_LG_II0575	SubName- Full=Putative uncharacterized protein; (291 aa)	•	•		•	0.566
	estExt_fgenesh4_pg.C_LG_V1151	3-deoxy-D-manno-oct-2-ulosonate-8-phosphate synthase (EC-2.5.1.55) (290 aa)	•	•		•	0.564
	gw1.XIV.3578.1	hypothetical protein (120 aa)		•		•	0.544
	estExt_Genewise1_v1.C_LG_V1283	hypothetical protein (341 aa)	•	•			0.524

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		364
pfam02606		318	pfam02606, LpxK, Tetraacyldisaccharide-1-P 4'-kina	6e-72
PRK00652		325	PRK00652, lpxK, tetraacyldisaccharide 4'-kinase; R	3e-49
COG1663		336	COG1663, LpxK, Tetraacyldisaccharide-1-P 4'-kinase	9e-47
TIGR00682		311	TIGR00682, lpxK, tetraacyldisaccharide 4'-kinase	9e-34
PRK01906		338	PRK01906, PRK01906, tetraacyldisaccharide 4'-kinas	4e-30

>gnl\|CDD\|217138 pfam02606, LpxK, Tetraacyldisaccharide-1-P 4'-kinase	Back alignment and domain information

 Score =  226 bits (578), Expect = 6e-72
 Identities = 118/353 (33%), Positives = 169/353 (47%), Gaps = 54/353 (15%)

Query: 27  LIPLLSLASSLYGISLFLRHSFYRFGFFSKHRLPVPVISVGNLTWGGNGKTPMVEFLAHC 86
           L  LL   S LYG+   LR + YR G    +RLPVPVI VGN+T GG GKTP+V  LA  
Sbjct: 1   LALLLLPLSLLYGLIAALRRALYRRGILKSYRLPVPVIVVGNITVGGTGKTPLVIALAEL 60

Query: 87  LADSEISPLILTRGYAG-----------------GDEVRMLERHLLERPAKIGKNCINPK 129
           L    + P +L+RGY G                 GDE  +L R     P  +G +     
Sbjct: 61  LRARGLRPGVLSRGYGGKSKGPVLVDPGSSAAEVGDEPLLLARR-TPVPVVVGPD--RAA 117

Query: 130 VGSHL-KSGKIGAVILDDGMQHWSLRRDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKR 188
               L ++     +ILDDG QH+ L RDLEIV+V+G   +GN +LLP GPLREPL  LKR
Sbjct: 118 AARALLEAHGADVIILDDGFQHYRLARDLEIVVVDGARGFGNGRLLPAGPLREPLSRLKR 177

Query: 189 ADIAVVHHADLISEQNLKDIELEMRDIKKSLSIFFTRMVPSYLFEVGNINSKIPLTAVCN 248
           AD AV+ +    ++  + +             +   R+ PS    + +   + PL     
Sbjct: 178 AD-AVILNGGEAADPEIAEA-----------PVLRARLEPSAAVNLAD-GERRPLAGK-- 222

Query: 249 ANVLCVSAIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQARDIEMIKKKLEELEGKFNPK 308
             VL  + IG+   F  +L+ LG   V  L F DHH F A D+  ++ + +E        
Sbjct: 223 -RVLAFAGIGNPQRFFDTLRALGLEVVATLAFPDHHPFTAADLAFLEAEAKE-------- 273

Query: 309 PIVVVTEKDYDRDPEILMHLEAYKVLVLCSKLQIIPCRGCTEDSFKLLLKELV 361
           P +V TEKD  +      +L   ++ VL  + ++       ED+ + LL + +
Sbjct: 274 PGLVTTEKDAVKLRG--DNLFDERLWVLPVEAEL-------EDALRELLLKKL 317

This family consists of tetraacyldisaccharide-1-P 4'-kinase also known as Lipid-A 4'-kinase or Lipid A biosynthesis protein LpxK, EC:2.7.1.130. This enzyme catalyzes the reaction: ATP + 2,3-bis(3-hydroxytetradecanoyl)-D -glucosaminyl-(beta-D-1,6)-2, 3-bis(3-hydroxytetradecanoyl)-D-glu cosam inyl beta-phosphate <=> ADP + 2,3,2',3'-tetrakis(3-hydroxytetradecanoyl)-D- glucosaminyl-1,6-beta-D-glucosamine 1,4'-bisphosphate. This enzyme is involved in the synthesis of lipid A portion of the bacterial lipopolysaccharide layer (LPS). The family contains a P-loop motif at the N terminus. Length = 318

>gnl\|CDD\|234808 PRK00652, lpxK, tetraacyldisaccharide 4'-kinase; Reviewed	Back alignment and domain information

>gnl\|CDD\|224577 COG1663, LpxK, Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|233090 TIGR00682, lpxK, tetraacyldisaccharide 4'-kinase	Back alignment and domain information

>gnl\|CDD\|179349 PRK01906, PRK01906, tetraacyldisaccharide 4'-kinase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		364
PF02606		326	LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr	100.0
PRK01906		338	tetraacyldisaccharide 4'-kinase; Provisional	100.0
PRK00652		325	lpxK tetraacyldisaccharide 4'-kinase; Reviewed	100.0
TIGR00682		311	lpxK tetraacyldisaccharide 4'-kinase. Also called	100.0
COG1663		336	LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env	100.0
PF02492		178	cobW: CobW/HypB/UreG, nucleotide-binding domain; I	99.54
COG0523		323	Putative GTPases (G3E family) [General function pr	99.49
COG2403		449	Predicted GTPase [General function prediction only	99.46
PRK11537		318	putative GTP-binding protein YjiA; Provisional	99.33
KOG2743		391	consensus Cobalamin synthesis protein [Coenzyme tr	99.31
TIGR02475		341	CobW cobalamin biosynthesis protein CobW. A broade	99.3
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	99.19
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	98.85
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	98.75
TIGR00101		199	ureG urease accessory protein UreG. This model rep	98.56
cd03112		158	CobW_like The function of this protein family is u	98.52
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	98.39
PRK09435		332	membrane ATPase/protein kinase; Provisional	98.31
PRK00771		437	signal recognition particle protein Srp54; Provisi	98.3
cd03114		148	ArgK-like The function of this protein family is u	98.11
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	98.0
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	97.9
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	97.83
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	97.8
PRK14974		336	cell division protein FtsY; Provisional	97.76
PRK13768		253	GTPase; Provisional	97.68
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	97.67
PRK10416		318	signal recognition particle-docking protein FtsY;	97.62
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	97.57
PRK14494		229	putative molybdopterin-guanine dinucleotide biosyn	97.53
TIGR00064		272	ftsY signal recognition particle-docking protein F	97.48
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	97.42
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	97.4
KOG0780		483	consensus Signal recognition particle, subunit Srp	97.38
PHA02519		387	plasmid partition protein SopA; Reviewed	97.33
PHA02518		211	ParA-like protein; Provisional	97.33
PF01656		195	CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai	97.27
PRK10867		433	signal recognition particle protein; Provisional	97.27
PRK13849		231	putative crown gall tumor protein VirC1; Provision	97.24
PRK13869		405	plasmid-partitioning protein RepA; Provisional	97.23
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	97.19
TIGR01007		204	eps_fam capsular exopolysaccharide family. This mo	97.18
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	97.16
PRK13705		388	plasmid-partitioning protein SopA; Provisional	97.15
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	97.14
TIGR00959		428	ffh signal recognition particle protein. This mode	97.08
cd02038		139	FleN-like FleN is a member of the Fer4_NifH superf	97.06
TIGR03371		246	cellulose_yhjQ cellulose synthase operon protein Y	97.04
PRK10037		250	cell division protein; Provisional	97.01
cd02036		179	MinD Bacterial cell division requires the formatio	97.0
TIGR03018		207	pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t	96.97
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	96.96
COG1192		259	Soj ATPases involved in chromosome partitioning [C	96.94
TIGR03453		387	partition_RepA plasmid partitioning protein RepA.	96.93
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	96.9
TIGR01968		261	minD_bact septum site-determining protein MinD. Th	96.88
cd02037		169	MRP-like MRP (Multiple Resistance and pH adaptatio	96.87
TIGR01969		251	minD_arch cell division ATPase MinD, archaeal. Thi	96.86
cd03111		106	CpaE_like This protein family consists of proteins	96.86
COG1763		161	MobB Molybdopterin-guanine dinucleotide biosynthes	96.86
PF07015		231	VirC1: VirC1 protein; InterPro: IPR009744 This fam	96.84
cd03115		173	SRP The signal recognition particle (SRP) mediates	96.81
cd02042		104	ParA ParA and ParB of Caulobacter crescentus belon	96.81
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	96.79
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	96.76
COG1341		398	Predicted GTPase or GTP-binding protein [General f	96.75
PRK10818		270	cell division inhibitor MinD; Provisional	96.71
cd02040		270	NifH NifH gene encodes component II (iron protein)	96.71
PRK14493		274	putative bifunctional molybdopterin-guanine dinucl	96.7
PF09140		261	MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi	96.68
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	96.68
cd02117		212	NifH_like This family contains the NifH (iron prot	96.66
COG3367		339	Uncharacterized conserved protein [Function unknow	96.61
PRK13185		270	chlL protochlorophyllide reductase iron-sulfur ATP	96.61
PRK14495		452	putative molybdopterin-guanine dinucleotide biosyn	96.56
PF06564		243	YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p	96.51
PRK13235		274	nifH nitrogenase reductase; Reviewed	96.48
TIGR01281		268	DPOR_bchL light-independent protochlorophyllide re	96.48
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	96.42
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	96.37
cd02032		267	Bchl_like This family of proteins contains bchL an	96.36
cd03116		159	MobB Molybdenum is an essential trace element in t	96.33
PRK14491		597	putative bifunctional molybdopterin-guanine dinucl	96.28
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	96.27
PRK13231		264	nitrogenase reductase-like protein; Reviewed	96.26
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	96.26
CHL00175		281	minD septum-site determining protein; Validated	96.15
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	96.14
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	96.05
PRK13230		279	nitrogenase reductase-like protein; Reviewed	96.03
TIGR01287		275	nifH nitrogenase iron protein. This model describe	95.99
PRK00089		292	era GTPase Era; Reviewed	95.95
PRK13233		275	nifH nitrogenase reductase; Reviewed	95.91
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	95.9
PRK07667		193	uridine kinase; Provisional	95.9
PRK06696		223	uridine kinase; Validated	95.78
PRK11670		369	antiporter inner membrane protein; Provisional	95.72
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	95.69
TIGR03815		322	CpaE_hom_Actino helicase/secretion neighborhood Cp	95.67
CHL00072		290	chlL photochlorophyllide reductase subunit L	95.64
PRK13236		296	nitrogenase reductase; Reviewed	95.58
PRK13232		273	nifH nitrogenase reductase; Reviewed	95.47
TIGR03029		274	EpsG chain length determinant protein tyrosine kin	95.3
PRK13234		295	nifH nitrogenase reductase; Reviewed	95.29
COG2894		272	MinD Septum formation inhibitor-activating ATPase	95.22
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	95.22
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	95.07
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	95.05
cd02034		116	CooC The accessory protein CooC, which contains a	95.0
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	94.91
PRK05439		311	pantothenate kinase; Provisional	94.91
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	94.89
PF02374		305	ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_	94.89
TIGR00347		166	bioD dethiobiotin synthase. Dethiobiotin synthase	94.85
TIGR02016		296	BchX chlorophyllide reductase iron protein subunit	94.84
cd02033		329	BchX Chlorophyllide reductase converts chlorophyll	94.83
cd00881		189	GTP_translation_factor GTP translation factor fami	94.71
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	94.59
cd00550		254	ArsA_ATPase Oxyanion-translocating ATPase (ArsA).	94.54
PRK06921		266	hypothetical protein; Provisional	94.46
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	94.45
TIGR03172		232	probable selenium-dependent hydroxylase accessory	94.44
PRK07933		213	thymidylate kinase; Validated	94.43
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	94.35
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	94.29
PRK15453		290	phosphoribulokinase; Provisional	94.11
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	94.06
PRK13886		241	conjugal transfer protein TraL; Provisional	94.0
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	93.98
PTZ00301		210	uridine kinase; Provisional	93.98
PRK15494		339	era GTPase Era; Provisional	93.92
PRK14490		369	putative bifunctional molybdopterin-guanine dinucl	93.88
cd02029		277	PRK_like Phosphoribulokinase-like (PRK-like) is a	93.87
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	93.76
cd02035		217	ArsA ArsA ATPase functionas as an efflux pump loca	93.68
PRK07952		244	DNA replication protein DnaC; Validated	93.67
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	93.64
PF02223		186	Thymidylate_kin: Thymidylate kinase; InterPro: IPR	93.59
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	93.49
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	93.42
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	93.4
PRK08116		268	hypothetical protein; Validated	93.36
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	93.36
PF13245		76	AAA_19: Part of AAA domain	93.34
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	93.09
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	93.03
PRK00698		205	tmk thymidylate kinase; Validated	92.99
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	92.96
KOG0781		587	consensus Signal recognition particle receptor, al	92.96
COG1159		298	Era GTPase [General function prediction only]	92.89
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	92.89
PRK00889		175	adenylylsulfate kinase; Provisional	92.87
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	92.79
COG3854		308	SpoIIIAA ncharacterized protein conserved in bacte	92.77
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	92.65
PF13614		157	AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ	92.6
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	92.52
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	92.52
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	92.52
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	92.51
KOG1805		1100	consensus DNA replication helicase [Replication, r	92.51
COG0003		322	ArsA Predicted ATPase involved in chromosome parti	92.5
PRK05480		209	uridine/cytidine kinase; Provisional	92.39
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	92.23
COG1084		346	Predicted GTPase [General function prediction only	92.15
PRK06761		282	hypothetical protein; Provisional	92.12
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	91.99
PRK01077		451	cobyrinic acid a,c-diamide synthase; Validated	91.92
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	91.86
PRK12377		248	putative replication protein; Provisional	91.66
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	91.65
TIGR03575		340	selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti	91.52
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	91.51
PRK05541		176	adenylylsulfate kinase; Provisional	91.45
PLN02924		220	thymidylate kinase	91.45
PRK08939		306	primosomal protein DnaI; Reviewed	91.38
smart00382		148	AAA ATPases associated with a variety of cellular	91.34
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	91.29
cd03109		134	DTBS Dethiobiotin synthetase (DTBS) is the penulti	91.28
COG0125		208	Tmk Thymidylate kinase [Nucleotide transport and m	91.28
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	91.27
PRK08727		233	hypothetical protein; Validated	91.2
PRK08233		182	hypothetical protein; Provisional	91.16
PRK06526		254	transposase; Provisional	91.13
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	91.08
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	91.06
PRK08903		227	DnaA regulatory inactivator Hda; Validated	90.95
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	90.86
PLN03046		460	D-glycerate 3-kinase; Provisional	90.84
PF05729		166	NACHT: NACHT domain	90.83
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	90.83
PRK08118		167	topology modulation protein; Reviewed	90.75
PF02367		123	UPF0079: Uncharacterised P-loop hydrolase UPF0079;	90.71
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	90.68
cd03110		179	Fer4_NifH_child This protein family's function is	90.58
PRK13973		213	thymidylate kinase; Provisional	90.56
PRK00049		396	elongation factor Tu; Reviewed	90.52
PLN02796		347	D-glycerate 3-kinase	90.47
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	90.34
PLN03127		447	Elongation factor Tu; Provisional	90.34
PRK04296		190	thymidine kinase; Provisional	90.34
PRK06762		166	hypothetical protein; Provisional	90.3
PRK10536		262	hypothetical protein; Provisional	90.28
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	90.25
PRK00093		435	GTP-binding protein Der; Reviewed	90.23
PRK10646		153	ADP-binding protein; Provisional	90.23
PRK13896		433	cobyrinic acid a,c-diamide synthase; Provisional	90.22
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	90.2
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	90.19
COG1149		284	MinD superfamily P-loop ATPase containing an inser	90.15
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	90.09
cd01394		218	radB RadB. The archaeal protein radB shares simila	89.96
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	89.94
PRK06835		329	DNA replication protein DnaC; Validated	89.82
PRK13976		209	thymidylate kinase; Provisional	89.73
COG3172		187	NadR Predicted ATPase/kinase involved in NAD metab	89.71
PRK05642		234	DNA replication initiation factor; Validated	89.66
PRK05339		269	PEP synthetase regulatory protein; Provisional	89.64
PRK11823		446	DNA repair protein RadA; Provisional	89.62
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	89.57
COG0455		262	flhG Antiactivator of flagellar biosynthesis FleN,	89.4
COG0489		265	Mrp ATPases involved in chromosome partitioning [C	89.29
PRK12736		394	elongation factor Tu; Reviewed	89.23
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	89.23
KOG3022		300	consensus Predicted ATPase, nucleotide-binding [Ce	89.08
PF00004		132	AAA: ATPase family associated with various cellula	88.94
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	88.92
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	88.44
PHA00547		337	hypothetical protein	88.42
PRK12735		396	elongation factor Tu; Reviewed	88.36
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	88.32
PRK09183		259	transposase/IS protein; Provisional	88.29
PRK07261		171	topology modulation protein; Provisional	88.28
PRK08181		269	transposase; Validated	88.25
PF03618		255	Kinase-PPPase: Kinase/pyrophosphorylase; InterPro:	88.24
TIGR00235		207	udk uridine kinase. Model contains a number of lon	88.13
TIGR01499		397	folC folylpolyglutamate synthase/dihydrofolate syn	88.04
TIGR02237		209	recomb_radB DNA repair and recombination protein R	87.69
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	87.6
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	87.59
COG1100		219	GTPase SAR1 and related small G proteins [General	87.51
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	87.45
TIGR01085		464	murE UDP-N-acetylmuramyl-tripeptide synthetase. A	87.25
PRK03846		198	adenylylsulfate kinase; Provisional	87.2
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	87.0
PRK14093		479	UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminop	86.86
COG0802		149	Predicted ATPase or kinase [General function predi	86.86
PRK11519		719	tyrosine kinase; Provisional	86.76
PRK08533		230	flagellar accessory protein FlaH; Reviewed	86.74
PRK00090		222	bioD dithiobiotin synthetase; Reviewed	86.69
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	86.65
PRK13695		174	putative NTPase; Provisional	86.54
COG1484		254	DnaC DNA replication protein [DNA replication, rec	86.53
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	86.44
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	86.26
PRK06067		234	flagellar accessory protein FlaH; Validated	86.25
PRK05973		237	replicative DNA helicase; Provisional	86.23
PRK06893		229	DNA replication initiation factor; Validated	86.22
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	86.14
PRK08084		235	DNA replication initiation factor; Provisional	86.08
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	85.96
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	85.79
PRK14016		727	cyanophycin synthetase; Provisional	85.79
COG4107		258	PhnK ABC-type phosphonate transport system, ATPase	85.69
COG1797		451	CobB Cobyrinic acid a,c-diamide synthase [Coenzyme	85.53
PF12846		304	AAA_10: AAA-like domain	85.51
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	85.34
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	85.28
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	85.28
TIGR00455		184	apsK adenylylsulfate kinase (apsK). Important resi	85.24
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	85.17
PRK10865		857	protein disaggregation chaperone; Provisional	85.04
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	84.81
CHL00181		287	cbbX CbbX; Provisional	84.74
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	84.69
PF13500		199	AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R	84.55
cd00983		325	recA RecA is a bacterial enzyme which has roles in	84.54
TIGR00379		449	cobB cobyrinic acid a,c-diamide synthase. This mod	84.52
cd02030		219	NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO	84.46
PRK06547		172	hypothetical protein; Provisional	84.31
PRK00139		460	murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-d	84.3
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	84.29
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	84.27
PRK12374		231	putative dithiobiotin synthetase; Provisional	84.16
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	84.13
PTZ00141		446	elongation factor 1- alpha; Provisional	84.11
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.02
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	83.99
PRK06851		367	hypothetical protein; Provisional	83.87
PRK12422		445	chromosomal replication initiation protein; Provis	83.85
KOG3877		393	consensus NADH:ubiquinone oxidoreductase, NDUFA10/	83.68
PRK06217		183	hypothetical protein; Validated	83.68
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	83.56
PRK10846		416	bifunctional folylpolyglutamate synthase/ dihydrof	83.51
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.49
PRK01390		460	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.47
KOG0063		592	consensus RNAse L inhibitor, ABC superfamily [RNA	83.34
TIGR02068		864	cya_phycin_syn cyanophycin synthetase. Cyanophycin	83.01
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	82.89
PRK13946		184	shikimate kinase; Provisional	82.56
PLN02913		510	dihydrofolate synthetase	82.55
cd01673		193	dNK Deoxyribonucleoside kinase (dNK) catalyzes the	82.47
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	82.17
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	82.05
PRK04220		301	2-phosphoglycerate kinase; Provisional	81.95
TIGR00376		637	DNA helicase, putative. The gene product may repre	81.91
PRK00784		488	cobyric acid synthase; Provisional	81.88
PHA00729		226	NTP-binding motif containing protein	81.86
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	81.82
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	81.59
PRK00683		418	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	81.49
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	81.47
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	81.46
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	81.27
PF01591		222	6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130	81.22
PLN03126		478	Elongation factor Tu; Provisional	81.18
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	81.1
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	81.07
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	81.06
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	81.01
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	80.9
PF10412		386	TrwB_AAD_bind: Type IV secretion-system coupling p	80.85
COG0285		427	FolC Folylpolyglutamate synthase [Coenzyme metabol	80.84
PRK07414		178	cob(I)yrinic acid a,c-diamide adenosyltransferase;	80.83
KOG2825		323	consensus Putative arsenite-translocating ATPase [	80.65
PRK13947		171	shikimate kinase; Provisional	80.5
PF00142		273	Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot	80.42
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	80.35
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	80.33
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	80.31
PRK00131		175	aroK shikimate kinase; Reviewed	80.27
PRK14022		481	UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine l	80.27
PRK02006		498	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	80.13

>PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability []	Back alignment and domain information

Probab=100.00  E-value=2.1e-87  Score=656.91  Aligned_cols=306  Identities=39%  Similarity=0.593  Sum_probs=264.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhHhcCCCccCCCCCcEEEEcCcccCCCCchHHHHHHHHHHHhCCCceEEEecCCCC---
Q 017904           27 LIPLLSLASSLYGISLFLRHSFYRFGFFSKHRLPVPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYAG---  103 (364)
Q Consensus        27 L~~lL~plS~lY~~~~~~R~~~y~~gi~~~~~~~vPVIsVGNltvGGtGKTP~v~~L~~~L~~~g~kvaIlsRGYg~---  103 (364)
                      |+++|+|||+||++++++||++|++|+++++++|+|||||||||+|||||||+|+||+++|+++|++|+|||||||+   
T Consensus         1 ~~~lL~PlS~lY~~~~~~R~~~y~~g~~~~~~~~vpVIsVGNltvGGTGKTP~v~~L~~~L~~~G~~~~IlSRGYg~~~~   80 (326)
T PF02606_consen    1 WRWLLWPLSLLYGLIVSLRNFLYDRGLLKSYRLPVPVISVGNLTVGGTGKTPLVIWLARLLQARGYRPAILSRGYGRKSK   80 (326)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHhcCCcccCCCCCcEEEEcccccCCCCchHHHHHHHHHHHhcCCceEEEcCCCCCCCC
Confidence            35689999999999999999999999999999999999999999999999999999999999999999999999996   


Q ss_pred             ---------------CchHHHHHHHhCCCCEEEeccccchhHH-HhhhcCCCCEEEEcCCCCCccccCceeEEEEeCCCC
Q 017904          104 ---------------GDEVRMLERHLLERPAKIGKNCINPKVG-SHLKSGKIGAVILDDGMQHWSLRRDLEIVMVNGLMP  167 (364)
Q Consensus       104 ---------------GDE~~lla~~~~~~~v~v~~~~~~~~~~-~~~~~~~~dviIlDDgfQh~~L~rdl~Ivl~Da~~~  167 (364)
                                     ||||+|+|+++| ++|.|+.++.  .+. .++.+.++|||||||||||++|+||+||||+|+.+|
T Consensus        81 ~~~~~v~~~~~~~~~GDEp~lla~~~~-~~V~V~~dR~--~~~~~~~~~~~~dviilDDGfQh~~L~rDl~Ivl~D~~~~  157 (326)
T PF02606_consen   81 GEPILVSDGSDAEEVGDEPLLLARKLP-VPVIVGPDRV--AAARAALKEFPADVIILDDGFQHRRLKRDLDIVLVDADRP  157 (326)
T ss_pred             CCeEEEeCCCChhhhcCHHHHHHHhcC-CcEEEeCcHH--HHHHHHHHHCCCCEEEEcCCcccccccCCcEEEEEeCCCC
Confidence                           899999999999 9999887643  333 344555699999999999999999999999999999


Q ss_pred             CCCCccccCCCCCCchhhhccccEEEEcCCcchhhhhhHHHHHHHHhhccCCcEEEEEEecceeEeecCCCCcccccccC
Q 017904          168 WGNRKLLPLGPLREPLMALKRADIAVVHHADLISEQNLKDIELEMRDIKKSLSIFFTRMVPSYLFEVGNINSKIPLTAVC  247 (364)
Q Consensus       168 ~gn~~~lPaG~LREp~~~L~rAd~ivvtk~d~~~~~~~~~i~~~l~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~  247 (364)
                      |||+++||+|+||||+++|+|||+||+|+.+.......+.+       .++.|+|++++.+..+.++..    .+..+++
T Consensus       158 ~gng~lLPaG~LREp~~~l~rAD~vi~~~~~~~~~~~~~~~-------~~~~p~~~~~~~~~~~~~~~~----~~~~~l~  226 (326)
T PF02606_consen  158 FGNGFLLPAGPLREPLSALKRADAVIVTGCDASDPAIEKAI-------RPGKPIFSARLKPEGLRNLNT----GSIEPLK  226 (326)
T ss_pred             CcCCccCCCCcccCChhHhCcccEEEEcCCCcchhHHHHhh-------hcCCceEEEEEEecccccccc----cchhhcc
Confidence            99999999999999999999999999998665433221111       158999999999987755432    2334589


Q ss_pred             CCeEEEEecCCChHHHHHHHHHhCCcccccccCCCCCCCCHHHHHHHHHHHHhhhcCCCCCCeEEecccCcccChhHHhh
Q 017904          248 NANVLCVSAIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQARDIEMIKKKLEELEGKFNPKPIVVVTEKDYDRDPEILMH  327 (364)
Q Consensus       248 ~~~v~a~sGIg~P~~F~~~L~~~G~~~~~~~~f~DHh~yt~~dl~~l~~~~~~~~~~~~~~~~ivtTEKDaVKl~~~~~~  327 (364)
                      |++++||||||||++|+++|+++|+++++++.|||||.||++|++.+.+.+++.      . .|||||||||||+.....
T Consensus       227 ~~~v~a~sGIg~P~~F~~~L~~~G~~~~~~~~f~DHh~yt~~dl~~l~~~a~~~------~-~iltTeKDaVKl~~~~~~  299 (326)
T PF02606_consen  227 GKPVLAFSGIGNPERFFDTLESLGIEVVGTLAFPDHHRYTEQDLEKLEAEAKAA------G-IILTTEKDAVKLPDFAQE  299 (326)
T ss_pred             CCeeEEEEEcCChHHHHHHHHHcCCeEEEeeECCCCCCCCHHHHHHHHHhhccc------c-eEEecHHHHhhChhhhhh
Confidence            999999999999999999999999999999999999999999999999987753      1 699999999999864331


Q ss_pred             hccceEEEEeeEEEEeccCCCChHHHHHHHHHhh
Q 017904          328 LEAYKVLVLCSKLQIIPCRGCTEDSFKLLLKELV  361 (364)
Q Consensus       328 ~~~~~~~~l~~~l~~~~~~~~~~~~l~~~l~~~~  361 (364)
                       .+.++|+++++++|.       +.|.+.|.+.+
T Consensus       300 -~~~~~~~l~i~~~~~-------~~~~~~l~~~l  325 (326)
T PF02606_consen  300 -NGLKIWVLPIELEFE-------EEFEEFLLKKL  325 (326)
T ss_pred             -cCCeEEEEEEEEEEC-------HHHHHHHHHhh
Confidence             124599999999883       57888887765

This enzyme is involved in the synthesis of lipid A portion of the bacterial lipopolysaccharide layer (LPS).; GO: 0005524 ATP binding, 0009029 tetraacyldisaccharide 4'-kinase activity, 0009245 lipid A biosynthetic process

>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional	Back alignment and domain information

>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed	Back alignment and domain information

>TIGR00682 lpxK tetraacyldisaccharide 4'-kinase	Back alignment and domain information

>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt	Back alignment and domain information

>COG0523 Putative GTPases (G3E family) [General function prediction only]	Back alignment and domain information

>COG2403 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK11537 putative GTP-binding protein YjiA; Provisional	Back alignment and domain information

>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism]	Back alignment and domain information

>TIGR02475 CobW cobalamin biosynthesis protein CobW	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>TIGR00101 ureG urease accessory protein UreG	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PHA02519 plasmid partition protein SopA; Reviewed	Back alignment and domain information

>PHA02518 ParA-like protein; Provisional	Back alignment and domain information

>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK13849 putative crown gall tumor protein VirC1; Provisional	Back alignment and domain information

>PRK13869 plasmid-partitioning protein RepA; Provisional	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>TIGR01007 eps_fam capsular exopolysaccharide family	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK13705 plasmid-partitioning protein SopA; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily	Back alignment and domain information

>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ	Back alignment and domain information

>PRK10037 cell division protein; Provisional	Back alignment and domain information

>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell	Back alignment and domain information

>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR03453 partition_RepA plasmid partitioning protein RepA	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR01968 minD_bact septum site-determining protein MinD	Back alignment and domain information

>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily	Back alignment and domain information

>TIGR01969 minD_arch cell division ATPase MinD, archaeal	Back alignment and domain information

>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster	Back alignment and domain information

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>PRK10818 cell division inhibitor MinD; Provisional	Back alignment and domain information

>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase	Back alignment and domain information

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional	Back alignment and domain information

>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase	Back alignment and domain information

>COG3367 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional	Back alignment and domain information

>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional	Back alignment and domain information

>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon	Back alignment and domain information

>PRK13235 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>cd02032 Bchl_like This family of proteins contains bchL and chlL	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK13231 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>CHL00175 minD septum-site determining protein; Validated	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK13230 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>TIGR01287 nifH nitrogenase iron protein	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>PRK13233 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PRK11670 antiporter inner membrane protein; Provisional	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein	Back alignment and domain information

>CHL00072 chlL photochlorophyllide reductase subunit L	Back alignment and domain information

>PRK13236 nitrogenase reductase; Reviewed	Back alignment and domain information

>PRK13232 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG	Back alignment and domain information

>PRK13234 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B	Back alignment and domain information

>TIGR00347 bioD dethiobiotin synthase	Back alignment and domain information

>TIGR02016 BchX chlorophyllide reductase iron protein subunit X	Back alignment and domain information

>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA)	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC	Back alignment and domain information

>PRK07933 thymidylate kinase; Validated	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>PRK13886 conjugal transfer protein TraL; Provisional	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional	Back alignment and domain information

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK00698 tmk thymidylate kinase; Validated	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK06761 hypothetical protein; Provisional	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>PRK01077 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PLN02924 thymidylate kinase	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms	Back alignment and domain information

>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>PLN03046 D-glycerate 3-kinase; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>cd03110 Fer4_NifH_child This protein family's function is unkown	Back alignment and domain information

>PRK13973 thymidylate kinase; Provisional	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK10646 ADP-binding protein; Provisional	Back alignment and domain information

>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK13976 thymidylate kinase; Provisional	Back alignment and domain information

>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK05339 PEP synthetase regulatory protein; Provisional	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility]	Back alignment and domain information

>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PHA00547 hypothetical protein	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF03618 Kinase-PPPase: Kinase/pyrophosphorylase; InterPro: IPR005177 This entry represents a family of uncharacterised proteins which are predicted to function as phosphotransferases	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>TIGR01499 folC folylpolyglutamate synthase/dihydrofolate synthase	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetase	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK14093 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase; Provisional	Back alignment and domain information

>COG0802 Predicted ATPase or kinase [General function prediction only]	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK00090 bioD dithiobiotin synthetase; Reviewed	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK14016 cyanophycin synthetase; Provisional	Back alignment and domain information

>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>TIGR00455 apsK adenylylsulfate kinase (apsK)	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR00379 cobB cobyrinic acid a,c-diamide synthase	Back alignment and domain information

>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK)	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>PRK12374 putative dithiobiotin synthetase; Provisional	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion]	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PRK10846 bifunctional folylpolyglutamate synthase/ dihydrofolate synthase; Provisional	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR02068 cya_phycin_syn cyanophycin synthetase	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>PLN02913 dihydrofolate synthetase	Back alignment and domain information

>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs)	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PRK00784 cobyric acid synthase; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein	Back alignment and domain information

>COG0285 FolC Folylpolyglutamate synthase [Coenzyme metabolism]	Back alignment and domain information

>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated	Back alignment and domain information

>KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PRK14022 UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase; Provisional	Back alignment and domain information

>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		364
4ehx_A		315	Crystal Structure Of Lpxk From Aquifex Aeolicus At		5e-15
4ehw_A		317	Crystal Structure Of Lpxk From Aquifex Aeolicus At		6e-15

>pdb|4EHX|A Chain A, Crystal Structure Of Lpxk From Aquifex Aeolicus At 1.9 Angstrom Resolution Length = 315

Back alignment and structure

Iteration: 1

Score = 78.6 bits (192), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 79/272 (29%), Positives = 117/272 (43%), Gaps = 53/272 (19%) Query: 44 LRHSFYRFGFFSKHRLPVPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYA- 102 R++ Y GF +LPVPVISVGNL+ GG+GKT V +LA L D + IL+RGY Sbjct: 19 FRNTLYDKGFLKIKKLPVPVISVGNLSVGGSGKTSFVMYLADLLKDKRVC--ILSRGYKR 76 Query: 103 --------------------GGDEVRMLERHLLERPAKIGKNCINPKVGSHLKSGKIG-- 140 GDE ++ + L ++ G L K+ Sbjct: 77 KSKGTLIVSEYGNLKVSWEEAGDEPYLMAKLLPHVSVVASEDRYK---GGLLALEKLSPE 133 Query: 141 AVILDDGMQHWSLRRDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKRADIAVVHHADLI 200 ILDDG QH L RDL I+++ +LLP G LREPL ++RAD V+ + Sbjct: 134 VFILDDGFQHRKLHRDLNILLLKKKD--LKDRLLPAGNLREPLKEIRRADALVLTY---- 187 Query: 201 SEQNLKDIELEMRDIKKSLSIFFT-----RMVPSYLFEVGNINSKIPLTAVCNANVLCVS 255 Q ++ E FFT +M + + + ++P + V+ S Sbjct: 188 --QEVEPFE------------FFTGKPTFKMFREFCCLLNSDFEEVPFDILKEREVIAFS 233 Query: 256 AIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQ 287 +G F + L+ LG + F DH+ + Sbjct: 234 GLGDNGQFRKVLKNLGIKVKEFMSFPDHYDYS 265

PyMOL of 4ehx

>pdb|4EHW|A Chain A, Crystal Structure Of Lpxk From Aquifex Aeolicus At 2.3 Angstrom Resolution Length = 317

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		364
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-06

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 47.2 bits (111), Expect = 7e-06
 Identities = 54/357 (15%), Positives = 104/357 (29%), Gaps = 85/357 (23%)

Query: 22  PIQSSLIPLL--SLASSLY-GISLFLRHSFYRFGFFSKHR--L----PVPVISV-GNLTW 71
             Q S++  +       LY    +F +++  R   + K R  L    P   + + G    
Sbjct: 102 QRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDG---V 158

Query: 72  GGNGKTPMVEFLAHCLADSEISPLI------LTRGYAGGDEVRMLERHLLERPAKIGKN- 124
            G+GKT +           ++   +      L        E  +    L +   +I  N 
Sbjct: 159 LGSGKTWVA---LDVCLSYKVQCKMDFKIFWLNLKNCNSPETVL--EMLQKLLYQIDPNW 213

Query: 125 CINPKVGSHLKSGKIGAVI--LDDGMQHWSLRRDLEIVM--VNGLMPWGNRKLLPLGPLR 180
                  S++K  +I ++   L   ++       L +V+  V       N K      L 
Sbjct: 214 TSRSDHSSNIKL-RIHSIQAELRRLLKSKPYENCL-LVLLNV-----Q-NAKAWNAFNLS 265

Query: 181 EPLMALKRADIAVVHHADLISEQNLKDIELEMRDI----KKSLSIFFTRMVPSYLFEVGN 236
             ++   R    V    D +S      I L+   +     +  S+        YL     
Sbjct: 266 CKILLTTR-FKQV---TDFLSAATTTHISLDHHSMTLTPDEVKSLL-----LKYL---DC 313

Query: 237 INSKIPLTAVCNANVLCVSAIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQARDIEMIKK 296
               +P       N   +S I      ++         +   D   H +       +I+ 
Sbjct: 314 RPQDLPREV-LTTNPRRLSIIA---ESIRD-------GLATWDNWKHVNCDKLT-TIIES 361

Query: 297 KLEELEGK-----------FNPK----PIVVV----TEKDYDRDPEILMHLEAYKVL 334
            L  LE             F P     P +++     +        ++  L  Y ++
Sbjct: 362 SLNVLEPAEYRKMFDRLSVF-PPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLV 417

PyMOL of 1vt4

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		364
4ehx_A		315	Tetraacyldisaccharide 4'-kinase; membrane protein,	100.0
2wsm_A		221	Hydrogenase expression/formation protein (HYPB); m	98.45
3p32_A		355	Probable GTPase RV1496/MT1543; structural genomics	98.16
1nij_A		318	Hypothetical protein YJIA; structural genomics, P-	98.09
2hf9_A		226	Probable hydrogenase nickel incorporation protein	98.04
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	98.04
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	97.83
2www_A		349	Methylmalonic aciduria type A protein, mitochondri	97.61
2j37_W		504	Signal recognition particle 54 kDa protein (SRP54)	97.55
2xxa_A		433	Signal recognition particle protein; protein trans	97.27
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	97.24
4dzz_A		206	Plasmid partitioning protein PARF; deviant walker	97.18
2p67_A		341	LAO/AO transport system kinase; ARGK, structural G	96.99
3q9l_A		260	Septum site-determining protein MIND; ATPase, bact	96.94
2r8r_A		228	Sensor protein; KDPD, PFAM02702, MCSG, structural	96.79
1g3q_A		237	MIND ATPase, cell division inhibitor; alpha-beta-a	96.74
2afh_E		289	Nitrogenase iron protein 1; nitrogen fixation, iro	96.74
3cwq_A		209	Para family chromosome partitioning protein; alpha	96.73
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	96.73
3k9g_A		267	PF-32 protein; ssgcid, SBRI, decode biostructures,	96.72
1cp2_A		269	CP2, nitrogenase iron protein; oxidoreductase; 1.9	96.71
1byi_A		224	Dethiobiotin synthase; biotin synthesis, cyclo-lig	96.7
2ffh_A		425	Protein (FFH); SRP54, signal recognition particle,	96.67
2ph1_A		262	Nucleotide-binding protein; alpha-beta protein, st	96.65
2xj4_A		286	MIPZ; replication, cell division, ATPase, WACA; 1.	96.62
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	96.61
1wcv_1		257	SOJ, segregation protein; ATPase, bacterial, chrom	96.61
3ea0_A		245	ATPase, para family; alpha-beta-alpha sandwich, st	96.61
2v3c_C		432	SRP54, signal recognition 54 kDa protein; nucleoti	96.57
1hyq_A		263	MIND, cell division inhibitor (MIND-1); MINC, FTSZ	96.49
2oze_A		298	ORF delta'; para, walker type atpases, DNA segrega	96.44
3end_A		307	Light-independent protochlorophyllide reductase ir	96.44
1np6_A		174	Molybdopterin-guanine dinucleotide biosynthesis pr	96.37
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	96.33
1yrb_A		262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	96.21
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	96.15
3pg5_A		361	Uncharacterized protein; structural genomics, PSI-	96.14
3bfv_A		271	CAPA1, CAPB2, membrane protein CAPA1, protein tyro	96.13
3ez2_A		398	Plasmid partition protein A; type IA, DNA binding,	96.03
3fkq_A		373	NTRC-like two-domain protein; RER070207001320, str	95.98
3la6_A		286	Tyrosine-protein kinase WZC; P-loop protein, nucle	95.85
3cio_A		299	ETK, tyrosine-protein kinase ETK; WZC, escherichia	95.83
3fwy_A		314	Light-independent protochlorophyllide reductase I	95.82
3kjh_A		254	CO dehydrogenase/acetyl-COA synthase complex, acce	95.76
3ez9_A		403	Para; DNA binding, winged-HTH, partition, biosynth	95.66
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	95.61
3ug7_A		349	Arsenical pump-driving ATPase; tail-anchored, memb	95.58
2qm8_A		337	GTPase/ATPase; G protein, G3E, metallochaperone, c	95.55
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	95.47
3zq6_A		324	Putative arsenical pump-driving ATPase; tail-ancho	95.26
3iqw_A		334	Tail-anchored protein targeting factor GET3; ATPas	95.22
2woo_A		329	ATPase GET3; tail-anchored, membrane protein, targ	95.02
3io3_A		348	DEHA2D07832P; chaperone, membrane traffic, ATPase;	94.67
2z0h_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	94.58
3iev_A		308	GTP-binding protein ERA; ERA, GTPase, KH domain, a	94.46
2woj_A		354	ATPase GET3; tail-anchored, membrane protein, targ	94.14
1ihu_A		589	Arsenical pump-driving ATPase; aluminum fluoride,	94.08
3nrs_A		437	Dihydrofolate:folylpolyglutamate synthetase; struc	93.96
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	93.94
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	93.88
2yhs_A		503	FTSY, cell division protein FTSY; cell cycle, prot	93.52
1nn5_A		215	Similar to deoxythymidylate kinase (thymidylate K;	93.52
2wwf_A		212	Thymidilate kinase, putative; transferase, malaria	93.48
1gtv_A		214	TMK, thymidylate kinase; transferase, transferase	93.37
2pbr_A		195	DTMP kinase, thymidylate kinase; transferase, nucl	93.36
3igf_A		374	ALL4481 protein; two-domained protein consisting o	93.27
2yvu_A		186	Probable adenylyl-sulfate kinase; transferase, str	93.17
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	92.82
3lv8_A		236	DTMP kinase, thymidylate kinase; structural genomi	92.74
3a4m_A		260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	92.64
3hjn_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	92.44
3of5_A		228	Dethiobiotin synthetase; structural genomics, cent	92.33
3qxc_A		242	Dethiobiotin synthetase; DTBS, structural genomics	92.14
3fgn_A		251	Dethiobiotin synthetase; biotin biosynthesis, BIOD	91.67
3bos_A		242	Putative DNA replication factor; P-loop containing	91.63
4edh_A		213	DTMP kinase, thymidylate kinase; structural genomi	91.42
1kht_A		192	Adenylate kinase; phosphotransferase, signaling pr	91.13
1xx6_A		191	Thymidine kinase; NESG, northeast structural genom	91.01
2qgz_A		308	Helicase loader, putative primosome component; str	90.75
2pez_A		179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	90.73
4tmk_A		213	Protein (thymidylate kinase); ATP:DTMP phosphotran	90.6
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	90.48
2v54_A		204	DTMP kinase, thymidylate kinase; nucleotide biosyn	90.43
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	90.43
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	90.4
1ihu_A		589	Arsenical pump-driving ATPase; aluminum fluoride,	90.32
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	90.32
3j2k_7		439	ERF3, eukaryotic polypeptide chain release factor	90.26
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	89.91
3ld9_A		223	DTMP kinase, thymidylate kinase; ssgcid, NIH, niai	89.89
3tqc_A		321	Pantothenate kinase; biosynthesis of cofactors, pr	89.88
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	89.74
1w78_A		422	FOLC bifunctional protein; DHFS, dihydrofolate syn	89.72
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	89.55
2plr_A		213	DTMP kinase, probable thymidylate kinase; TMP-bind	89.48
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	89.44
1jbw_A		428	Folylpolyglutamate synthase; FPGS folate AMPPCP te	89.41
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	89.33
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	89.32
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	89.25
1a7j_A		290	Phosphoribulokinase; transferase, calvin cycle; 2.	89.09
3p26_A		483	Elongation factor 1 alpha-like protein; GTP/GDP bi	89.03
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	89.03
2f1r_A		171	Molybdopterin-guanine dinucleotide biosynthesis pr	88.9
2orv_A		234	Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2	88.85
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	88.65
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	88.59
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	88.32
4hlc_A		205	DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri	87.97
2cdn_A		201	Adenylate kinase; phosphoryl transfer, associative	87.88
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	87.73
3v9p_A		227	DTMP kinase, thymidylate kinase; ssgcid, STRU geno	87.6
1m7g_A		211	Adenylylsulfate kinase; APS kinase, transferase, s	87.51
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	87.44
2og2_A		359	Putative signal recognition particle receptor; nuc	87.42
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	87.36
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	86.93
1e2k_A		331	Thymidine kinase; transferase, antiviral drug, enz	86.59
2vos_A		487	Folylpolyglutamate synthase protein FOLC; ligase,	86.52
1osn_A		341	Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra	86.37
4b3f_X		646	DNA-binding protein smubp-2; hydrolase, helicase;	86.35
1j6u_A		469	UDP-N-acetylmuramate-alanine ligase MURC; structur	86.34
1e8c_A		498	UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diami	86.08
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	86.07
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	86.07
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	86.0
4eaq_A		229	DTMP kinase, thymidylate kinase; structural genomi	85.87
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	85.81
2chg_A		226	Replication factor C small subunit; DNA-binding pr	85.64
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	85.54
1u94_A		356	RECA protein, recombinase A; homologous recombinat	85.41
3mca_A		592	HBS1, elongation factor 1 alpha-like protein; prot	85.4
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	85.27
2x5o_A		439	UDP-N-acetylmuramoylalanine--D-glutamate ligase; A	85.02
1o5z_A		442	Folylpolyglutamate synthase/dihydrofolate synthas;	84.94
3t61_A		202	Gluconokinase; PSI-biology, structural genomics, p	84.58
1ega_A		301	Protein (GTP-binding protein ERA); GTPase, RNA-bin	84.57
1tev_A		196	UMP-CMP kinase; ploop, NMP binding region, LID reg	84.53
1qf9_A		194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	84.48
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	84.43
2ce2_X		166	GTPase HRAS; signaling protein, guanine nucleotide	84.34
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	84.32
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	84.27
1of1_A		376	Thymidine kinase; transferase, antiviral drug, enz	84.18
2j9r_A		214	Thymidine kinase; TK1, DNK, lasso, transferase, AT	84.17
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	84.09
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	84.01
2wtz_A		535	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-di	83.99
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	83.85
1jwy_B		315	Dynamin A GTPase domain; dynamin, GTPase, GDP, myo	83.8
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	83.75
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	83.3
2qt1_A		207	Nicotinamide riboside kinase 1; non-protein kinase	83.29
3eag_A		326	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME	83.27
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	83.06
1w36_D		608	RECD, exodeoxyribonuclease V alpha chain; recombin	83.02
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	83.0
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	82.98
3fb4_A		216	Adenylate kinase; psychrophIle, phosphotransferase	82.74
1p6x_A		334	Thymidine kinase; P-loop, LID, transferase; HET: T	82.64
2c95_A		196	Adenylate kinase 1; transferase, AP4A, nucleotide	82.52
4a0g_A		831	Adenosylmethionine-8-amino-7-oxononanoate aminotra	82.3
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	82.19
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	82.16
3con_A		190	GTPase NRAS; structural genomics consortium, SGC,	81.95
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	81.85
3cm0_A		186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	81.8
1wb1_A		482	Translation elongation factor SELB; selenocysteine	81.73
1p3d_A		475	UDP-N-acetylmuramate--alanine ligase; alpha/beta p	81.66
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	81.47
1xp8_A		366	RECA protein, recombinase A; recombination, radior	81.38
2ocp_A		241	DGK, deoxyguanosine kinase; protein-nucleotide com	81.26
3lk7_A		451	UDP-N-acetylmuramoylalanine--D-glutamate ligase; a	81.22
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	81.22
2bwj_A		199	Adenylate kinase 5; phosphoryl transfer reaction,	81.19
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	81.19
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	81.17
2if2_A		204	Dephospho-COA kinase; alpha-beta protein, structur	80.87
3dl0_A		216	Adenylate kinase; phosphotransferase, zinc coordin	80.84
2vli_A		183	Antibiotic resistance protein; transferase, tunica	80.37
2f00_A		491	UDP-N-acetylmuramate--L-alanine ligase; amide bond	80.36
2cvh_A		220	DNA repair and recombination protein RADB; filamen	80.06

>4ehx_A Tetraacyldisaccharide 4'-kinase; membrane protein, lipid A, P-loop, P-loop containing nucleoside triphosphate hydrolase; HET: EPE; 1.90A {Aquifex aeolicus} PDB: 4ehy_A* 4ehw_A	Back alignment and structure

Probab=100.00  E-value=3.6e-82  Score=616.70  Aligned_cols=290  Identities=31%  Similarity=0.430  Sum_probs=242.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhHhcCCCccCCCCCcEEEEcCcccCCCCchHHHHHHHHHHHhCCCceEEEecCCCC---
Q 017904           27 LIPLLSLASSLYGISLFLRHSFYRFGFFSKHRLPVPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYAG---  103 (364)
Q Consensus        27 L~~lL~plS~lY~~~~~~R~~~y~~gi~~~~~~~vPVIsVGNltvGGtGKTP~v~~L~~~L~~~g~kvaIlsRGYg~---  103 (364)
                      |+.+|+||||||++++++||++|++|+++++++|+|||||||||+|||||||+++||+++|+  +++++|||||||+   
T Consensus         2 L~~~L~PlS~ly~~i~~~R~~ly~~~~~k~~~~~vPVI~VGNitvGGTGKTP~vi~L~~~L~--~~~~~ilsRGYg~~~~   79 (315)
T 4ehx_A            2 LRSSLLPFSYLYEKIINFRNTLYDKGFLKIKKLPVPVISVGNLSVGGSGKTSFVMYLADLLK--DKRVCILSRGYKRKSK   79 (315)
T ss_dssp             CGGGGHHHHHHHHHHHHHHHHHHHTTCSCCBCCSSCEEEEEESBSSCCSHHHHHHHHHHHTT--TSCEEEEECCCSCSSC
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhccccccccCCCCEEEECCEEeCCCChHHHHHHHHHHHh--hcCceEEeeccccccc
Confidence            56789999999999999999999999999999999999999999999999999999999996  4589999999985   


Q ss_pred             ------------------CchHHHHHHHhCCCCEEEeccccchhHHH-hhhcCCCCEEEEcCCCCCccccCceeEEEEeC
Q 017904          104 ------------------GDEVRMLERHLLERPAKIGKNCINPKVGS-HLKSGKIGAVILDDGMQHWSLRRDLEIVMVNG  164 (364)
Q Consensus       104 ------------------GDE~~lla~~~~~~~v~v~~~~~~~~~~~-~~~~~~~dviIlDDgfQh~~L~rdl~Ivl~Da  164 (364)
                                        ||||+|+|+++|+++|+|+.++  ..+.. ++++.++|+|||||||||++|+||++|||+|+
T Consensus        80 ~~~~v~~~~~~~~~~~~~GDEp~lla~~~~~~~v~v~~~R--~~~~~~~~~~~~~dviIlDDGfQh~~l~rDl~Ivv~d~  157 (315)
T 4ehx_A           80 GTLIVSEYGNLKVSWEEAGDEPYLMAKLLPHVSVVASEDR--YKGGLLALEKLSPEVFILDDGFQHRKLHRDLNILLLKK  157 (315)
T ss_dssp             SEEEEEETTEECSCHHHHCHHHHHHHHHCTTSEEEEESSH--HHHHHHHHHHHCCSEEEEETCTTCTTBCCSEEEEEEEH
T ss_pred             CceEEeecccccCCcccccCHHHHHHHhCCCceEEEecch--HHHHHHHhhccCCcEEEecCccccccccccceEEEeee
Confidence                              8999999999999988887753  33333 34556899999999999999999999999994


Q ss_pred             CCCCCCCccccCCCCCCchhhhccccEEEEcCCcchhhhhhHHHHHHHHhhccCCcEEEEEEecceeEeecCCCCccccc
Q 017904          165 LMPWGNRKLLPLGPLREPLMALKRADIAVVHHADLISEQNLKDIELEMRDIKKSLSIFFTRMVPSYLFEVGNINSKIPLT  244 (364)
Q Consensus       165 ~~~~gn~~~lPaG~LREp~~~L~rAd~ivvtk~d~~~~~~~~~i~~~l~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~  244 (364)
                        ++||+++||+||||||+++|+|||+||+|+.+....           +.....+.+........+.  ....+..+++
T Consensus       158 --~~gng~lLPaGpLREp~~~l~raD~iii~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~  222 (315)
T 4ehx_A          158 --KDLKDRLLPAGNLREPLKEIRRADALVLTYQEVEPF-----------EFFTGKPTFKMFREFCCLL--NSDFEEVPFD  222 (315)
T ss_dssp             --HHHTCCBTTTSSBSSCGGGGGGCSEEEEECTTTSCC-----------CCCCSSCEEEEEEEEEEEE--CTTSCEECGG
T ss_pred             --eccCCeecccccccCChhHhhhccEEEEecCCcchh-----------hHhhccchhhhcchhhhhh--cccccccchh
Confidence              579999999999999999999999999998543211           1123456665544433332  2233344667


Q ss_pred             ccCCCeEEEEecCCChHHHHHHHHHhCCcccccccCCCCCCCCHHHHHHHHHHHHhhhcCCCCCCeEEecccCcccChhH
Q 017904          245 AVCNANVLCVSAIGSANAFVQSLQKLGPCSVNRLDFNDHHSFQARDIEMIKKKLEELEGKFNPKPIVVVTEKDYDRDPEI  324 (364)
Q Consensus       245 ~~~~~~v~a~sGIg~P~~F~~~L~~~G~~~~~~~~f~DHh~yt~~dl~~l~~~~~~~~~~~~~~~~ivtTEKDaVKl~~~  324 (364)
                      .++|++++||||||||++|+++|+++|+++++++.|||||.||+.+++              .+..|||||||||||+. 
T Consensus       223 ~~~~~~v~a~aGIgnP~~F~~~L~~~g~~i~~~~~fpDHh~fs~~~~~--------------~~~~iltTEKDaVKl~~-  287 (315)
T 4ehx_A          223 ILKEREVIAFSGLGDNGQFRKVLKNLGIKVKEFMSFPDHYDYSDFTPE--------------EGEIYLTTPKDLIKLQG-  287 (315)
T ss_dssp             GGTTCCEEEEESSTHHHHHHHHHHHHTCCEEEEEECCTTCCCSSCCCC--------------TTCCEEECHHHHTTCTT-
T ss_pred             hhhhhhhhhhhhcCCcHHHHHHHHHcCCceeeeEecCChhhhchhhhc--------------cCCeEEECchhhhhCcC-
Confidence            789999999999999999999999999999999999999999965543              23579999999999864 


Q ss_pred             HhhhccceEEEEeeEEEEeccCCCChHHHHHHHHHh
Q 017904          325 LMHLEAYKVLVLCSKLQIIPCRGCTEDSFKLLLKEL  360 (364)
Q Consensus       325 ~~~~~~~~~~~l~~~l~~~~~~~~~~~~l~~~l~~~  360 (364)
                         +  .++|++++++++.     +++.|.++|+++
T Consensus       288 ---~--~~i~~l~i~~~i~-----~e~~l~~~i~ki  313 (315)
T 4ehx_A          288 ---Y--ENVFALNFKVKLE-----REEKLKKLIYRI  313 (315)
T ss_dssp             ---C--TTEEEEEEEEEET-----THHHHHHHHHHT
T ss_pred             ---c--CCCEEEEEEEEEC-----ChHHHHHHHHHh
Confidence               2  3589999999984     677888888765

PyMOL of 4ehx

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}	Back alignment and structure

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*	Back alignment and structure

>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}	Back alignment and structure

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A*	Back alignment and structure

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10	Back alignment and structure

>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A*	Back alignment and structure

>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV}	Back alignment and structure

>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A*	Back alignment and structure

>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A	Back alignment and structure

>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP}	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A	Back alignment and structure

>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10	Back alignment and structure

>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A	Back alignment and structure

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A	Back alignment and structure

>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A*	Back alignment and structure

>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A	Back alignment and structure

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A*	Back alignment and structure

>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum}	Back alignment and structure

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B	Back alignment and structure

>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10	Back alignment and structure

>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes}	Back alignment and structure

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A	Back alignment and structure

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae}	Back alignment and structure

>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A*	Back alignment and structure

>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A	Back alignment and structure

>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale}	Back alignment and structure

>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli}	Back alignment and structure

>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli}	Back alignment and structure

>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2}	Back alignment and structure

>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A*	Back alignment and structure

>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A*	Back alignment and structure

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid}	Back alignment and structure

>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A*	Back alignment and structure

>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe}	Back alignment and structure

>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii}	Back alignment and structure

>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A*	Back alignment and structure

>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A*	Back alignment and structure

>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A*	Back alignment and structure

>3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* 3pyz_A* 3qcz_A*	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A	Back alignment and structure

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*	Back alignment and structure

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*	Back alignment and structure

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*	Back alignment and structure

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}	Back alignment and structure

>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP}	Back alignment and structure

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A*	Back alignment and structure

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*	Back alignment and structure

>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima}	Back alignment and structure

>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp}	Back alignment and structure

>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A	Back alignment and structure

>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A*	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A*	Back alignment and structure

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A	Back alignment and structure

>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*	Back alignment and structure

>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A*	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A*	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus}	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis}	Back alignment and structure

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A*	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6	Back alignment and structure

>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A*	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}	Back alignment and structure

>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A*	Back alignment and structure

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ...	Back alignment and structure

>2vos_A Folylpolyglutamate synthase protein FOLC; ligase, peptidoglycan synthesis, cell division; HET: ADP; 2.0A {Mycobacterium tuberculosis} PDB: 2vor_A*	Back alignment and structure

>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1	Back alignment and structure

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A	Back alignment and structure

>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1	Back alignment and structure

>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe}	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*	Back alignment and structure

>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A*	Back alignment and structure

>1o5z_A Folylpolyglutamate synthase/dihydrofolate synthas; TM0166, structural genomics, JC protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2	Back alignment and structure

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X	Back alignment and structure

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1	Back alignment and structure

>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A*	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, C shape; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} PDB: 2xja_A*	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}	Back alignment and structure

>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B*	Back alignment and structure

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}	Back alignment and structure

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*	Back alignment and structure

>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58}	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}	Back alignment and structure

>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A*	Back alignment and structure

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A	Back alignment and structure

>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A*	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}	Back alignment and structure

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}	Back alignment and structure

>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A*	Back alignment and structure

>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A*	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae}	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A	Back alignment and structure

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}	Back alignment and structure

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*	Back alignment and structure

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}	Back alignment and structure

>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli}	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		364
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	99.45
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	98.42
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	98.25
d1ls1a2		207	GTPase domain of the signal sequence recognition p	97.98
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	97.93
d1vmaa2		213	GTPase domain of the signal recognition particle r	97.76
d1okkd2		207	GTPase domain of the signal recognition particle r	97.71
d1j8yf2		211	GTPase domain of the signal sequence recognition p	97.65
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	97.61
d2qy9a2		211	GTPase domain of the signal recognition particle r	97.59
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	97.57
d1g3qa_		237	Cell division regulator MinD {Archaeon Pyrococcus	97.0
d1hyqa_		232	Cell division regulator MinD {Archaeon Archaeoglob	96.97
d1ihua1		296	Arsenite-translocating ATPase ArsA {Escherichia co	96.57
d1cp2a_		269	Nitrogenase iron protein {Clostridium pasteurianum	96.53
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	96.4
d1byia_		224	Dethiobiotin synthetase {Escherichia coli [TaxId:	96.31
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	96.26
d2afhe1		289	Nitrogenase iron protein {Azotobacter vinelandii [	96.19
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	96.19
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	95.79
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	95.75
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	95.54
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	95.46
d1a7ja_		288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	95.43
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	95.39
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	94.79
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	94.69
d2jfga3		204	UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase	93.56
d1g7sa4		227	Initiation factor IF2/eIF5b, N-terminal (G) domain	93.36
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	92.71
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	92.63
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	92.41
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	92.17
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	91.69
d1e8ca3		234	UDP-N-acetylmuramyl tripeptide synthetase MurE {Es	91.65
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	91.25
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	91.09
d1o5za2		296	Folylpolyglutamate synthetase {Thermotoga maritima	90.71
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	90.6
d1osna_		331	Thymidine kinase {Varicella-zoster virus [TaxId: 1	90.58
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	90.57
d2gc6a2		296	Folylpolyglutamate synthetase {Lactobacillus casei	90.12
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	89.91
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	89.84
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	89.6
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	89.51
d1htwa_		158	Hypothetical protein HI0065 {Haemophilus influenza	89.49
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	89.37
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	89.26
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	89.23
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	89.11
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	88.61
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	88.53
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	88.35
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	88.31
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	88.28
d1gg4a4		214	UDP-murNac-tripeptide D-alanyl-D-alanine-adding en	88.08
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	88.0
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	87.94
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	87.55
d1svsa1		195	Transducin (alpha subunit) {Rat (Rattus norvegicus	87.12
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	86.92
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	86.85
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	86.63
d1p3da3		215	UDP-N-acetylmuramate-alanine ligase MurC {Haemophi	86.43
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	85.81
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	85.41
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	85.35
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	84.88
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	84.49
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	84.44
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	84.15
d1tmka_		214	Thymidylate kinase {Baker's yeast (Saccharomyces c	83.98
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	83.88
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	83.3
d1j6ua3		207	UDP-N-acetylmuramate-alanine ligase MurC {Thermoto	83.11
d2atva1		168	Ras-like estrogen-regulated growth inhibitor, RERG	82.84
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	82.7
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	82.66
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	82.65
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	82.63
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	82.43
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	81.93
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	81.82
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	81.51
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	81.31
d1p6xa_		333	Thymidine kinase {Equine herpesvirus type 4 [TaxId	80.91
d1zcba2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	80.82
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	80.65
d2akab1		299	Dynamin G domain {Rat (Rattus norvegicus) [TaxId:	80.45
d2bcjq2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	80.32
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	80.25
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	80.1

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Hypothetical protein YjiA, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=99.45  E-value=2.4e-15  Score=136.52  Aligned_cols=156  Identities=12%  Similarity=0.166  Sum_probs=98.8

Q ss_pred             CCcEEEEcCcccCCCCchHHHHHHHHHHHhCCCceEEEecCCCC--CchHHH------HHHHhCCCCEEEeccccchhHH
Q 017904           60 PVPVISVGNLTWGGNGKTPMVEFLAHCLADSEISPLILTRGYAG--GDEVRM------LERHLLERPAKIGKNCINPKVG  131 (364)
Q Consensus        60 ~vPVIsVGNltvGGtGKTP~v~~L~~~L~~~g~kvaIlsRGYg~--GDE~~l------la~~~~~~~v~v~~~~~~~~~~  131 (364)
                      |+||+.|+++  .|+||||++.++++.  .+|.|+|||.|.||.  -|+..+      ..+...||.|+...+.......
T Consensus         2 ~iPv~iitGF--LGaGKTTll~~lL~~--~~~~riaVI~Ne~g~~~iD~~~~~~~~~~~~el~~gcicc~~~~~~~~~l~   77 (222)
T d1nija1           2 PIAVTLLTGF--LGAGKTTLLRHILNE--QHGYKIAVIENEFGEVSVDDQLIGDRATQIKTLTNGCICCSRSNELEDALL   77 (222)
T ss_dssp             CEEEEEEEES--SSSSCHHHHHHHHHS--CCCCCEEEECSSCCSCCEEEEEECTTSCEEEEETTSCEEECTTSCHHHHHH
T ss_pred             CCCEEEEeeC--CCCCHHHHHHHHHhc--CCCCcEEEEEecccchhhhhhhhcccccceEEecCCcceeccchhHHHHHH
Confidence            7899999998  799999999998875  468999999999984  111100      1111234433111000000011


Q ss_pred             Hhh-----hcCCCCEEEEc-CCCCCc---------------cccCceeEEEEeCCCCCCCCccccCCCCCCchhhhcccc
Q 017904          132 SHL-----KSGKIGAVILD-DGMQHW---------------SLRRDLEIVMVNGLMPWGNRKLLPLGPLREPLMALKRAD  190 (364)
Q Consensus       132 ~~~-----~~~~~dviIlD-DgfQh~---------------~L~rdl~Ivl~Da~~~~gn~~~lPaG~LREp~~~L~rAd  190 (364)
                      ..+     ...++|.|++| =|.-|+               ...-|--|+|+|+.+...  ..   ....+...|++.||
T Consensus        78 ~~~~~~~~~~~~~d~iiIE~sG~~~p~~l~~~~~~~~~~~~~~~l~~vi~vVDa~~~~~--~~---~~~~~~~~Qi~~AD  152 (222)
T d1nija1          78 DLLDNLDKGNIQFDRLVIECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADE--QM---NQFTIAQSQVGYAD  152 (222)
T ss_dssp             HHHHHHHHTSCCCSEEEEEEETTCCHHHHHHHHHHSHHHHHHEEEEEEEEEEETTTHHH--HH---HHCHHHHHHHHTCS
T ss_pred             HHHHHHhhccCCcceeEEeecccchhhHHHHHHHhhhcccccccccchhhhhhhhhhhh--hh---hhhHHHHHHHHhCC
Confidence            111     13468999999 244332               122233488999987321  11   11123456899999


Q ss_pred             EEEEcCCcchhhhhhHHHHHHHHhhccCCcEEEEEE
Q 017904          191 IAVVHHADLISEQNLKDIELEMRDIKKSLSIFFTRM  226 (364)
Q Consensus       191 ~ivvtk~d~~~~~~~~~i~~~l~~~~~~~~i~~~~~  226 (364)
                      +||+||+|++++  .+.+++.++.+||.++|+.+.+
T Consensus       153 ~ivlNK~Dl~~~--~~~~~~~l~~lNP~a~Ii~~~~  186 (222)
T d1nija1         153 RILLTKTDVAGE--AEKLHERLARINARAPVYTVTH  186 (222)
T ss_dssp             EEEEECTTTCSC--THHHHHHHHHHCSSSCEEECCS
T ss_pred             cccccccccccH--HHHHHHHHHHHhCCCeEEEeeC
Confidence            999999998864  5678999999999999976554

PyMOL of d1nija1

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}	Back information, alignment and structure

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure