Citrus Sinensis ID: 018020

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MATESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFSRLVANIKNGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEIKW
ccccccccEEEEEEEHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHccccccccccccHHHHHccccccEEEEccccccHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHcccEEEEEEcHHHccHHHHHHHHHHcccccccEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEEEccccccccccEEEEEEEEcccccEEEEEEEccccccEEEEEEEccEEEEEccccccccccccEEEEccccEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEc
ccccccccEEEEEEcHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHcccccccEEcccHHHHHccccccEEEEEccccHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHccccEEEEEEEEEEcccccccccccccEccccHccccHHHHccccHHHHHHHHHcccccEEEEEEEccccccccccccEEEEEEccccEEEEEEEEEEcccccEEEEEEcccEEEEcccccccccccEEEEEccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEc
MATESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKAtnfakannfppdakvygsyeallddkdidavylplptsmHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEEngvqlmdgtmwvhnprtaqmkefvsdpqrfgqlrtmhscfsfagdaeflkndirvkpdldglgalgdagwYGIRSILWandyelpktviamhgpvlneAGVILSCGaslhwddgrvatFSCSFLANMTMDitatgtngslqlhdFIIPfreeeasyftntrcffndlvtgwvplpsehvvttdipqeacMVREFSRLVANIkngskpeqkwpiisrkTQLIIDAVKTSIergfepieikw
MATESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKAtnfakannfppdaKVYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFSRLVAnikngskpeqkwpiisrktqLIIDAVKTsiergfepieikw
MATESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPdldglgalgdagWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFSRLVANIKNGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEIKW
*******AIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFSRLVANIKNGSKPEQKWPIISRKTQLIIDAVKTSIERGF*******
*****QA***FGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFSRLVANIKNGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEIKW
MATESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFSRLVANIKNGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEIKW
******AAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFSRLVANIKNGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEIKW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFSRLVANIKNGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEIKW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query362 2.2.26 [Sep-21-2011]
Q9SZ83362 Uncharacterized oxidoredu yes no 0.988 0.988 0.686 1e-152
P49305334 Uncharacterized oxidoredu no no 0.883 0.958 0.298 1e-23
Q6DF30330 Trans-1,2-dihydrobenzene- yes no 0.679 0.745 0.297 2e-20
Q642M9334 Trans-1,2-dihydrobenzene- yes no 0.820 0.889 0.274 1e-19
Q6DKE0330 Trans-1,2-dihydrobenzene- N/A no 0.665 0.730 0.283 5e-19
Q148L6335 Trans-1,2-dihydrobenzene- yes no 0.676 0.731 0.276 3e-17
Q9TV69335 Trans-1,2-dihydrobenzene- yes no 0.676 0.731 0.261 2e-16
Q9DBB8333 Trans-1,2-dihydrobenzene- yes no 0.696 0.756 0.267 3e-16
Q9TV68335 Trans-1,2-dihydrobenzene- yes no 0.676 0.731 0.272 4e-15
Q7JK39334 Trans-1,2-dihydrobenzene- N/A no 0.671 0.727 0.267 5e-15
>sp|Q9SZ83|Y4967_ARATH Uncharacterized oxidoreductase At4g09670 OS=Arabidopsis thaliana GN=At4g09670 PE=1 SV=1 Back     alignment and function desciption
 Score =  536 bits (1382), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 248/361 (68%), Positives = 305/361 (84%), Gaps = 3/361 (0%)

Query: 1   MATESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAK 60
           MATE+Q  IR G++G ADIARK+SRAI LAPNA +S VASRSLEKA  FA ANN+P   K
Sbjct: 1   MATETQ--IRIGVMGCADIARKVSRAIHLAPNATISGVASRSLEKAKAFATANNYPESTK 58

Query: 61  VYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNAC 120
           ++GSYE+LL+D +IDA+Y+PLPTS+HV+WAI  A+K KH+L+EKP+A+NV EFD I++AC
Sbjct: 59  IHGSYESLLEDPEIDALYVPLPTSLHVEWAIKAAEKGKHILLEKPVAMNVTEFDKIVDAC 118

Query: 121 EENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPD 180
           E NGVQ+MDGTMWVHNPRTA +KEF+SD +RFGQL+T+ SCFSFAGD +FLKNDIRVKP 
Sbjct: 119 EANGVQIMDGTMWVHNPRTALLKEFLSDSERFGQLKTVQSCFSFAGDEDFLKNDIRVKPG 178

Query: 181 LDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVAT 240
           LDGLGALGDAGWY IR+ L AN++ELPKTV A  G VLNEAGVILSCGASL W+DGR AT
Sbjct: 179 LDGLGALGDAGWYAIRATLLANNFELPKTVTAFPGAVLNEAGVILSCGASLSWEDGRTAT 238

Query: 241 FSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEH 300
             CSFLAN+TM+ITA GT G+L++HDFIIP++E EAS+ T+T+ +FNDLVT WV  PSEH
Sbjct: 239 IYCSFLANLTMEITAIGTKGTLRVHDFIIPYKETEASFTTSTKAWFNDLVTAWVSPPSEH 298

Query: 301 VVTTDIPQEACMVREFSRLVANIK-NGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIE 359
            V T++PQEACMVREF+RLV  IK NG+KP+  WP ISRKTQL++DAVK S+++ ++ I 
Sbjct: 299 TVKTELPQEACMVREFARLVGEIKNNGAKPDGYWPSISRKTQLVVDAVKESVDKNYQQIS 358

Query: 360 I 360
           +
Sbjct: 359 L 359

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|P49305|YMO1_RHIML Uncharacterized oxidoreductase ORF334 OS=Rhizobium meliloti PE=3 SV=1 Back     alignment and function description
>sp|Q6DF30|DHDH_XENTR Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus tropicalis GN=dhdh PE=2 SV=1 Back     alignment and function description
>sp|Q642M9|DHDH_DANRE Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Danio rerio GN=dhdh PE=2 SV=2 Back     alignment and function description
>sp|Q6DKE0|DHDH_XENLA Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus laevis GN=dhdh PE=2 SV=1 Back     alignment and function description
>sp|Q148L6|DHDH_BOVIN Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Bos taurus GN=DHDH PE=2 SV=1 Back     alignment and function description
>sp|Q9TV69|DHDH_PIG Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Sus scrofa GN=DHDH PE=1 SV=1 Back     alignment and function description
>sp|Q9DBB8|DHDH_MOUSE Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Mus musculus GN=Dhdh PE=2 SV=1 Back     alignment and function description
>sp|Q9TV68|DHDH_CANFA Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Canis familiaris GN=DHDH PE=1 SV=1 Back     alignment and function description
>sp|Q7JK39|DHDH_MACFU Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Macaca fuscata fuscata GN=DHDH PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
224082534358 predicted protein [Populus trichocarpa] 0.983 0.994 0.756 1e-161
224082536358 predicted protein [Populus trichocarpa] 0.983 0.994 0.747 1e-160
255572367360 oxidoreductase, putative [Ricinus commun 0.983 0.988 0.719 1e-152
147858660358 hypothetical protein VITISV_013812 [Viti 0.983 0.994 0.691 1e-151
449446357359 PREDICTED: uncharacterized oxidoreductas 0.969 0.977 0.719 1e-150
15233990362 uncharacterized oxidoreductase [Arabidop 0.988 0.988 0.686 1e-150
297813401362 oxidoreductase family protein [Arabidops 0.988 0.988 0.681 1e-149
225468829358 PREDICTED: uncharacterized oxidoreductas 0.983 0.994 0.680 1e-147
356499161361 PREDICTED: uncharacterized oxidoreductas 0.975 0.977 0.703 1e-147
225463145347 PREDICTED: uncharacterized oxidoreductas 0.953 0.994 0.677 1e-145
>gi|224082534|ref|XP_002306732.1| predicted protein [Populus trichocarpa] gi|222856181|gb|EEE93728.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 270/357 (75%), Positives = 313/357 (87%), Gaps = 1/357 (0%)

Query: 5   SQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGS 64
           ++  IRFGIIG ADIARKLSRAITLAPNA LSAVASRSL+KA+ FAKANNFPP AK+YGS
Sbjct: 2   AEKPIRFGIIGCADIARKLSRAITLAPNAELSAVASRSLDKASAFAKANNFPPSAKIYGS 61

Query: 65  YEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENG 124
           YE LLDD +IDAVY+PLPTS+HVKWA  VAQKKKH+L+EKP+ LNV E D I+ ACE NG
Sbjct: 62  YEDLLDDPEIDAVYVPLPTSLHVKWACLVAQKKKHILLEKPVGLNVTELDKIVEACEANG 121

Query: 125 VQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGL 184
           VQ+MDGTMW+HNPRT +MKEF++D +RFG+L+ MHSCF+FAGD +FLKNDIRVK DLD L
Sbjct: 122 VQIMDGTMWIHNPRTHKMKEFLNDKERFGELKNMHSCFTFAGDEDFLKNDIRVKSDLDAL 181

Query: 185 GALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCS 244
           GALGDAGWYGIRSILWA DYELPKTV A+ GPVLNEAGVILSCGA+LHW+DG+VATF CS
Sbjct: 182 GALGDAGWYGIRSILWAVDYELPKTVTALPGPVLNEAGVILSCGAALHWEDGKVATFHCS 241

Query: 245 FLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTT 304
           FLA++TMDITA GT G+L L+DFIIPF E+EAS+ T ++  F DLVTGWVPLPS+H VTT
Sbjct: 242 FLAHLTMDITAIGTAGTLHLNDFIIPFGEKEASFTTVSKSGFTDLVTGWVPLPSQHTVTT 301

Query: 305 DIPQEACMVREFSRLVANIK-NGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEI 360
           D+PQEACMV EF+RLV NIK NG+KP+ KWP ISRKTQLI+DAV TSI +G +P+EI
Sbjct: 302 DLPQEACMVTEFARLVGNIKANGAKPDPKWPSISRKTQLILDAVTTSIAQGSKPVEI 358

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224082536|ref|XP_002306733.1| predicted protein [Populus trichocarpa] gi|222856182|gb|EEE93729.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255572367|ref|XP_002527122.1| oxidoreductase, putative [Ricinus communis] gi|223533545|gb|EEF35285.1| oxidoreductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147858660|emb|CAN80430.1| hypothetical protein VITISV_013812 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449446357|ref|XP_004140938.1| PREDICTED: uncharacterized oxidoreductase At4g09670-like [Cucumis sativus] gi|449494087|ref|XP_004159443.1| PREDICTED: uncharacterized oxidoreductase At4g09670-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15233990|ref|NP_192705.1| uncharacterized oxidoreductase [Arabidopsis thaliana] gi|73921136|sp|Q9SZ83.1|Y4967_ARATH RecName: Full=Uncharacterized oxidoreductase At4g09670 gi|4538897|emb|CAB39634.1| AX110P-like protein [Arabidopsis thaliana] gi|7267662|emb|CAB78090.1| AX110P-like protein [Arabidopsis thaliana] gi|21554042|gb|AAM63123.1| AX110P-like protein [Arabidopsis thaliana] gi|26983872|gb|AAN86188.1| putative AX110P protein [Arabidopsis thaliana] gi|332657379|gb|AEE82779.1| uncharacterized oxidoreductase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297813401|ref|XP_002874584.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297320421|gb|EFH50843.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225468829|ref|XP_002265072.1| PREDICTED: uncharacterized oxidoreductase At4g09670-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356499161|ref|XP_003518411.1| PREDICTED: uncharacterized oxidoreductase At4g09670-like [Glycine max] Back     alignment and taxonomy information
>gi|225463145|ref|XP_002266918.1| PREDICTED: uncharacterized oxidoreductase At4g09670 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
TAIR|locus:2118440362 AT4G09670 [Arabidopsis thalian 0.988 0.988 0.656 5.7e-130
TAIR|locus:2009086352 AT1G34200 [Arabidopsis thalian 0.953 0.980 0.541 3e-101
TAIR|locus:2013805364 AT1G66130 [Arabidopsis thalian 0.966 0.961 0.394 5.6e-68
TIGR_CMR|SPO_0865330 SPO_0865 "oxidoreductase, Gfo/ 0.453 0.496 0.366 5.5e-22
FB|FBgn0031418335 CG3609 [Drosophila melanogaste 0.690 0.746 0.287 5.8e-17
ASPGD|ASPL0000010504416 AN3524 [Emericella nidulans (t 0.306 0.266 0.4 2.1e-16
ZFIN|ZDB-GENE-040426-2180334 dhdhl "dihydrodiol dehydrogena 0.671 0.727 0.290 6.7e-16
UNIPROTKB|G4NB69426 MGG_11542 "Uncharacterized pro 0.430 0.366 0.347 1.2e-15
ZFIN|ZDB-GENE-040927-25347 zgc:101723 "zgc:101723" [Danio 0.676 0.706 0.273 2.1e-15
ASPGD|ASPL0000075159408 AN8642 [Emericella nidulans (t 0.414 0.367 0.301 6.7e-14
TAIR|locus:2118440 AT4G09670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1275 (453.9 bits), Expect = 5.7e-130, P = 5.7e-130
 Identities = 237/361 (65%), Positives = 294/361 (81%)

Query:     1 MATESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAK 60
             MATE+Q  IR G++G ADIARK+SRAI LAPNA +S VASRSLEKA  FA ANN+P   K
Sbjct:     1 MATETQ--IRIGVMGCADIARKVSRAIHLAPNATISGVASRSLEKAKAFATANNYPESTK 58

Query:    61 VYGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNAC 120
             ++GSYE+LL+D +IDA+Y+PLPTS+HV+WAI  A+K KH+L+EKP+A+NV EFD I++AC
Sbjct:    59 IHGSYESLLEDPEIDALYVPLPTSLHVEWAIKAAEKGKHILLEKPVAMNVTEFDKIVDAC 118

Query:   121 EENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPX 180
             E NGVQ+MDGTMWVHNPRTA +KEF+SD +RFGQL+T+ SCFSFAGD +FLKNDIRVKP 
Sbjct:   119 EANGVQIMDGTMWVHNPRTALLKEFLSDSERFGQLKTVQSCFSFAGDEDFLKNDIRVKPG 178

Query:   181 XXXXXXXXXXXWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVAT 240
                        WY IR+ L AN++ELPKTV A  G VLNEAGVILSCGASL W+DGR AT
Sbjct:   179 LDGLGALGDAGWYAIRATLLANNFELPKTVTAFPGAVLNEAGVILSCGASLSWEDGRTAT 238

Query:   241 FSCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEH 300
               CSFLAN+TM+ITA GT G+L++HDFIIP++E EAS+ T+T+ +FNDLVT WV  PSEH
Sbjct:   239 IYCSFLANLTMEITAIGTKGTLRVHDFIIPYKETEASFTTSTKAWFNDLVTAWVSPPSEH 298

Query:   301 VVTTDIPQEACMVREFSRLVANIKN-GSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIE 359
              V T++PQEACMVREF+RLV  IKN G+KP+  WP ISRKTQL++DAVK S+++ ++ I 
Sbjct:   299 TVKTELPQEACMVREFARLVGEIKNNGAKPDGYWPSISRKTQLVVDAVKESVDKNYQQIS 358

Query:   360 I 360
             +
Sbjct:   359 L 359
GO:0000166 "nucleotide binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2009086 AT1G34200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013805 AT1G66130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0865 SPO_0865 "oxidoreductase, Gfo/Idh/MocA family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
FB|FBgn0031418 CG3609 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000010504 AN3524 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2180 dhdhl "dihydrodiol dehydrogenase (dimeric), like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G4NB69 MGG_11542 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040927-25 zgc:101723 "zgc:101723" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000075159 AN8642 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SZ83Y4967_ARATH1, ., -, ., -, ., -0.68690.98890.9889yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
COG0673342 COG0673, MviM, Predicted dehydrogenases and relate 4e-44
pfam01408120 pfam01408, GFO_IDH_MocA, Oxidoreductase family, NA 9e-29
pfam02894111 pfam02894, GFO_IDH_MocA_C, Oxidoreductase family, 2e-04
PRK13304265 PRK13304, PRK13304, L-aspartate dehydrogenase; Rev 0.001
PRK11579346 PRK11579, PRK11579, putative oxidoreductase; Provi 0.001
>gnl|CDD|223745 COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information 
 Score =  155 bits (392), Expect = 4e-44
 Identities = 94/354 (26%), Positives = 141/354 (39%), Gaps = 26/354 (7%)

Query: 9   IRFGIIGAADIARK--LSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYE 66
           IR GIIGA  IA K  L     L     L AV  R  E+A  FA+        K Y   E
Sbjct: 4   IRVGIIGAGGIAGKAHLPALAALGGGLELVAVVDRDPERAEAFAEEFGIA---KAYTDLE 60

Query: 67  ALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQ 126
            LL D DIDAVY+  P ++H + A++  +  KH+L EKP+AL + E + ++    + GV+
Sbjct: 61  ELLADPDIDAVYIATPNALHAELALAALEAGKHVLCEKPLALTLEEAEELVELARKAGVK 120

Query: 127 LMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGLGA 186
           LM G     +P    +KE + D    G++ ++ + FS            R      G GA
Sbjct: 121 LMVGFNRRFDPAVQALKELI-DSGALGEVVSVQASFSRDRPNPPPPPWWRFDRADGG-GA 178

Query: 187 LGDAGWYGIRSILWANDYELPKTVIA-MHGPVLNEAGVILSCGASLHWDDGRVATFSCSF 245
           L D G + +  + +      P +V A        EAGV  S  A L +++G +A    S 
Sbjct: 179 LLDLGIHDLDLLRFLLGSPEPVSVSAKARNSPPGEAGVDDSASAILRFENGVLAVSWASR 238

Query: 246 LANMTMDITAT--GTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVT 303
            A    D+     GT GSL++ D          +          D+  G   L     V 
Sbjct: 239 TAAGGYDVRLEVYGTKGSLEVDDG-------NPTGELLDGRIGLDVRGGDGELLL---VP 288

Query: 304 TDIPQEACMVREFSRLVAN-IKNGSKPEQKWPIISRKTQLIIDAVKTSIERGFE 356
                    +  F+  +    +     E      + K   + +A   S + G  
Sbjct: 289 RRGNPYEGELEAFADAIRGGGEPLVSGED-----ALKALRLAEAAYESAKEGRT 337

Length = 342
>gnl|CDD|201778 pfam01408, GFO_IDH_MocA, Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>gnl|CDD|217272 pfam02894, GFO_IDH_MocA_C, Oxidoreductase family, C-terminal alpha/beta domain Back     alignment and domain information
>gnl|CDD|237343 PRK13304, PRK13304, L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|183212 PRK11579, PRK11579, putative oxidoreductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 362
PRK11579346 putative oxidoreductase; Provisional 100.0
COG0673342 MviM Predicted dehydrogenases and related proteins 100.0
PRK10206344 putative oxidoreductase; Provisional 100.0
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 100.0
KOG2742367 consensus Predicted oxidoreductase [General functi 99.98
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 99.97
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 99.96
PRK13302271 putative L-aspartate dehydrogenase; Provisional 99.89
PRK13303265 L-aspartate dehydrogenase; Provisional 99.84
PRK08300302 acetaldehyde dehydrogenase; Validated 99.82
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 99.82
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 99.82
PRK13304265 L-aspartate dehydrogenase; Reviewed 99.81
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 99.81
PRK06349426 homoserine dehydrogenase; Provisional 99.8
PRK06270341 homoserine dehydrogenase; Provisional 99.78
PRK00048257 dihydrodipicolinate reductase; Provisional 99.77
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 99.72
TIGR00036266 dapB dihydrodipicolinate reductase. 99.7
PRK05447385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 99.67
PF02894115 GFO_IDH_MocA_C: Oxidoreductase family, C-terminal 99.3
PF08635142 ox_reductase_C: Putative oxidoreductase C terminal 99.3
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 99.24
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 99.2
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 99.17
COG4693361 PchG Oxidoreductase (NAD-binding), involved in sid 99.15
PRK13301267 putative L-aspartate dehydrogenase; Provisional 99.12
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 99.1
PRK08374336 homoserine dehydrogenase; Provisional 99.08
PRK08618325 ornithine cyclodeaminase; Validated 99.04
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.01
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 98.99
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 98.98
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 98.97
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 98.96
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.96
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 98.89
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 98.85
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 98.79
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 98.78
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.73
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 98.73
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 98.7
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.7
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 98.69
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 98.68
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 98.67
PRK06392326 homoserine dehydrogenase; Provisional 98.66
PRK06046326 alanine dehydrogenase; Validated 98.65
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 98.61
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 98.6
KOG0409327 consensus Predicted dehydrogenase [General functio 98.6
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 98.6
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 98.57
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 98.57
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 98.53
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 98.52
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 98.52
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 98.51
COG3804350 Uncharacterized conserved protein related to dihyd 98.5
PRK07680273 late competence protein ComER; Validated 98.47
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 98.46
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 98.46
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 98.46
PLN02696454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 98.45
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 98.44
PRK06813346 homoserine dehydrogenase; Validated 98.43
PLN02700377 homoserine dehydrogenase family protein 98.43
PRK08291330 ectoine utilization protein EutC; Validated 98.41
PLN02775286 Probable dihydrodipicolinate reductase 98.37
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 98.36
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 98.34
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 98.33
PRK07340304 ornithine cyclodeaminase; Validated 98.33
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.3
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 98.29
KOG0455364 consensus Homoserine dehydrogenase [Amino acid tra 98.28
PRK15059292 tartronate semialdehyde reductase; Provisional 98.27
PRK06141314 ornithine cyclodeaminase; Validated 98.26
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 98.26
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 98.26
COG2344211 AT-rich DNA-binding protein [General function pred 98.26
PRK09436819 thrA bifunctional aspartokinase I/homoserine dehyd 98.25
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 98.22
PLN02256304 arogenate dehydrogenase 98.21
PLN02712667 arogenate dehydrogenase 98.2
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 98.19
PRK07502307 cyclohexadienyl dehydrogenase; Validated 98.18
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 98.18
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 98.16
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 98.16
PLN02688266 pyrroline-5-carboxylate reductase 98.14
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 98.12
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 98.12
PLN02858 1378 fructose-bisphosphate aldolase 98.1
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.09
COG0743385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 98.08
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 98.07
PRK08507275 prephenate dehydrogenase; Validated 98.07
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.05
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 98.04
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 98.03
PLN02858 1378 fructose-bisphosphate aldolase 98.01
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 98.0
PRK08655437 prephenate dehydrogenase; Provisional 97.99
PLN02712 667 arogenate dehydrogenase 97.98
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 97.98
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 97.97
TIGR00243389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 97.94
PRK05479330 ketol-acid reductoisomerase; Provisional 97.94
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 97.93
PRK06407301 ornithine cyclodeaminase; Provisional 97.93
PRK07417279 arogenate dehydrogenase; Reviewed 97.92
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 97.9
PRK06823315 ornithine cyclodeaminase; Validated 97.88
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.87
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 97.83
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 97.8
PRK12464383 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 97.8
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 97.78
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 97.78
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.78
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.78
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.76
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 97.76
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.76
PRK07589346 ornithine cyclodeaminase; Validated 97.75
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 97.75
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 97.74
PTZ00431260 pyrroline carboxylate reductase; Provisional 97.73
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.72
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 97.71
PRK13403335 ketol-acid reductoisomerase; Provisional 97.71
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.71
PRK05722495 glucose-6-phosphate 1-dehydrogenase; Validated 97.71
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.7
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.68
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 97.68
PTZ00187317 succinyl-CoA synthetase alpha subunit; Provisional 97.67
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.67
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 97.66
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.65
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 97.64
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 97.64
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.63
PRK06199379 ornithine cyclodeaminase; Validated 97.63
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 97.61
PLN02353 473 probable UDP-glucose 6-dehydrogenase 97.61
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.61
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.6
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 97.59
PLN00125300 Succinyl-CoA ligase [GDP-forming] subunit alpha 97.57
KOG0172445 consensus Lysine-ketoglutarate reductase/saccharop 97.55
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.55
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 97.54
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 97.53
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.53
PRK12550272 shikimate 5-dehydrogenase; Reviewed 97.52
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 97.52
PRK08040336 putative semialdehyde dehydrogenase; Provisional 97.51
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.48
TIGR02717447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 97.48
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.48
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.47
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 97.46
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.45
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.39
COG0074293 SucD Succinyl-CoA synthetase, alpha subunit [Energ 97.39
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.38
TIGR00871482 zwf glucose-6-phosphate 1-dehydrogenase. This is a 97.38
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 97.38
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.37
PRK06545359 prephenate dehydrogenase; Validated 97.36
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.35
PRK07574385 formate dehydrogenase; Provisional 97.35
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.35
PLN00203519 glutamyl-tRNA reductase 97.35
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 97.35
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.35
PRK13940414 glutamyl-tRNA reductase; Provisional 97.34
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.33
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 97.33
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 97.33
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.32
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 97.32
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.26
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.25
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.25
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 97.22
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.2
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 97.19
PRK08818370 prephenate dehydrogenase; Provisional 97.19
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 97.18
PRK08605332 D-lactate dehydrogenase; Validated 97.18
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 97.16
PLN03139386 formate dehydrogenase; Provisional 97.13
PRK12480330 D-lactate dehydrogenase; Provisional 97.11
PLN02383344 aspartate semialdehyde dehydrogenase 97.1
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 97.09
PRK12921305 2-dehydropantoate 2-reductase; Provisional 97.08
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.06
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 97.06
PRK13243333 glyoxylate reductase; Reviewed 97.04
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.0
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 96.99
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.98
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 96.97
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.97
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.92
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 96.91
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.86
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 96.85
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 96.83
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.8
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 96.8
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 96.78
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 96.77
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 96.74
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.7
COG1810224 Uncharacterized protein conserved in archaea [Func 96.69
COG3268382 Uncharacterized conserved protein [Function unknow 96.68
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.67
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.66
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 96.66
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.65
PRK05225487 ketol-acid reductoisomerase; Validated 96.64
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.62
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 96.61
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 96.61
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 96.59
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 96.58
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 96.57
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 96.56
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 96.53
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.51
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 96.49
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.49
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.49
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.48
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.48
PRK06436303 glycerate dehydrogenase; Provisional 96.47
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 96.46
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 96.46
PRK06249313 2-dehydropantoate 2-reductase; Provisional 96.44
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.43
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.4
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.39
COG1832140 Predicted CoA-binding protein [General function pr 96.38
COG2910211 Putative NADH-flavin reductase [General function p 96.37
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.36
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.34
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 96.33
PRK06223307 malate dehydrogenase; Reviewed 96.33
PLN02928347 oxidoreductase family protein 96.33
PTZ00075476 Adenosylhomocysteinase; Provisional 96.33
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.32
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotid 96.32
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.31
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.31
TIGR03450351 mycothiol_INO1 inositol 1-phosphate synthase, Acti 96.31
PRK09414445 glutamate dehydrogenase; Provisional 96.3
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 96.3
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.29
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 96.26
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 96.26
TIGR03025445 EPS_sugtrans exopolysaccharide biosynthesis polypr 96.25
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 96.25
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 96.23
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 96.22
PLN02237442 glyceraldehyde-3-phosphate dehydrogenase B 96.19
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.19
PTZ00082321 L-lactate dehydrogenase; Provisional 96.15
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 96.14
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.12
PRK08223287 hypothetical protein; Validated 96.11
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 96.11
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.1
PRK10669558 putative cation:proton antiport protein; Provision 96.08
PTZ00117319 malate dehydrogenase; Provisional 96.06
PRK15076431 alpha-galactosidase; Provisional 96.05
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 96.04
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.02
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 96.01
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 96.01
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 96.0
PRK09496453 trkA potassium transporter peripheral membrane com 95.98
TIGR03023451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp 95.95
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.9
PRK03659601 glutathione-regulated potassium-efflux system prot 95.86
PRK12853482 glucose-6-phosphate 1-dehydrogenase; Provisional 95.83
PRK06487317 glycerate dehydrogenase; Provisional 95.83
PRK10124463 putative UDP-glucose lipid carrier transferase; Pr 95.8
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 95.8
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.8
PRK06932314 glycerate dehydrogenase; Provisional 95.79
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 95.78
PRK04148134 hypothetical protein; Provisional 95.72
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 95.68
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.66
PLN02306386 hydroxypyruvate reductase 95.65
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.65
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 95.64
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 95.64
PLN02494477 adenosylhomocysteinase 95.6
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.6
PRK03562621 glutathione-regulated potassium-efflux system prot 95.59
PLN02586360 probable cinnamyl alcohol dehydrogenase 95.59
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 95.59
PLN02477410 glutamate dehydrogenase 95.58
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.58
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 95.57
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.56
PF10100429 DUF2338: Uncharacterized protein conserved in bact 95.55
PLN02602350 lactate dehydrogenase 95.55
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 95.52
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.5
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.44
PRK15116268 sulfur acceptor protein CsdL; Provisional 95.43
PRK09496453 trkA potassium transporter peripheral membrane com 95.42
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 95.38
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.37
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 95.35
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.35
PLN02178375 cinnamyl-alcohol dehydrogenase 95.32
PRK14982340 acyl-ACP reductase; Provisional 95.28
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 95.23
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 95.22
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 95.22
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 95.19
PLN02514357 cinnamyl-alcohol dehydrogenase 95.15
PRK05600370 thiamine biosynthesis protein ThiF; Validated 95.14
PRK05708305 2-dehydropantoate 2-reductase; Provisional 95.13
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 95.13
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 95.08
cd01483143 E1_enzyme_family Superfamily of activating enzymes 95.07
CHL00194317 ycf39 Ycf39; Provisional 95.07
KOG2733423 consensus Uncharacterized membrane protein [Functi 95.04
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.04
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.02
PRK06091 555 membrane protein FdrA; Validated 95.01
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.94
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 94.93
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 94.92
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.91
PLN02827378 Alcohol dehydrogenase-like 94.91
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.86
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 94.82
PRK14031444 glutamate dehydrogenase; Provisional 94.82
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 94.81
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.8
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 94.75
PRK06444197 prephenate dehydrogenase; Provisional 94.73
TIGR03022456 WbaP_sugtrans Undecaprenyl-phosphate galactose pho 94.72
COG0364483 Zwf Glucose-6-phosphate 1-dehydrogenase [Carbohydr 94.71
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 94.7
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 94.69
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.68
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 94.68
PLN02285334 methionyl-tRNA formyltransferase 94.66
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 94.65
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.57
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 94.54
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 94.53
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 94.52
PRK00005309 fmt methionyl-tRNA formyltransferase; Reviewed 94.45
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 94.41
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 94.38
PRK05562223 precorrin-2 dehydrogenase; Provisional 94.38
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 94.34
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.33
PF00479183 G6PD_N: Glucose-6-phosphate dehydrogenase, NAD bin 94.29
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 94.28
PRK06988312 putative formyltransferase; Provisional 94.27
PRK06719157 precorrin-2 dehydrogenase; Validated 94.19
PRK08328231 hypothetical protein; Provisional 94.13
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 94.13
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 94.1
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 94.08
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 94.07
PRK06153393 hypothetical protein; Provisional 93.97
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 93.96
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 93.95
PRK00885420 phosphoribosylamine--glycine ligase; Provisional 93.94
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 93.92
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.88
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 93.85
PF13727175 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B. 93.84
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 93.83
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 93.82
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 93.72
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 93.7
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 93.66
PTZ00325321 malate dehydrogenase; Provisional 93.61
PRK05784 486 phosphoribosylamine--glycine ligase; Provisional 93.55
TIGR03013442 EpsB_2 sugar transferase, PEP-CTERM system associa 93.45
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 93.43
PRK14030445 glutamate dehydrogenase; Provisional 93.34
PRK05086312 malate dehydrogenase; Provisional 93.3
PRK15204476 undecaprenyl-phosphate galactose phosphotransferas 93.28
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 93.27
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.23
PRK14852 989 hypothetical protein; Provisional 93.23
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 93.14
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 93.12
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 93.06
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 93.06
PLN00112444 malate dehydrogenase (NADP); Provisional 93.02
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.0
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 92.97
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 92.94
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 92.93
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 92.92
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 92.85
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 92.84
PRK05442326 malate dehydrogenase; Provisional 92.83
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 92.78
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 92.77
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 92.75
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 92.74
TIGR00460313 fmt methionyl-tRNA formyltransferase. The top-scor 92.73
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 92.65
PRK14851 679 hypothetical protein; Provisional 92.64
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 92.63
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 92.63
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 92.61
TIGR00877423 purD phosphoribosylamine--glycine ligase. This enz 92.6
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 92.57
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.56
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 92.55
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 92.45
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 92.42
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 92.41
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.4
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 92.33
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 92.32
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 92.27
KOG1255329 consensus Succinyl-CoA synthetase, alpha subunit [ 92.25
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 92.22
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 92.22
PRK00536262 speE spermidine synthase; Provisional 92.19
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 92.11
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 91.99
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.98
COG0223307 Fmt Methionyl-tRNA formyltransferase [Translation, 91.89
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 91.86
PLN02740381 Alcohol dehydrogenase-like 91.84
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 91.83
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 91.81
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 91.81
PRK12854484 glucose-6-phosphate 1-dehydrogenase; Provisional 91.81
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 91.75
PRK11908347 NAD-dependent epimerase/dehydratase family protein 91.66
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 91.61
PLN02427386 UDP-apiose/xylose synthase 91.58
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 91.48
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 91.43
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 91.38
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 91.38
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 91.38
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 91.31
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 91.29
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 91.2
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.03
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 91.02
COG0421282 SpeE Spermidine synthase [Amino acid transport and 91.0
PRK00676338 hemA glutamyl-tRNA reductase; Validated 90.97
COG2201350 CheB Chemotaxis response regulator containing a Ch 90.94
PRK08462445 biotin carboxylase; Validated 90.93
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 90.88
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 90.88
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 90.83
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 90.74
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 90.72
TIGR03586327 PseI pseudaminic acid synthase. 90.67
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 90.67
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 90.64
COG3367339 Uncharacterized conserved protein [Function unknow 90.59
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 90.58
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 90.49
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 90.47
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 90.44
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 90.4
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 90.31
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 90.29
PLN02539491 glucose-6-phosphate 1-dehydrogenase 90.28
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 90.22
PRK06849389 hypothetical protein; Provisional 90.17
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 90.16
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 90.15
PRK10083339 putative oxidoreductase; Provisional 90.14
COG5495289 Uncharacterized conserved protein [Function unknow 90.06
COG4566202 TtrR Response regulator [Signal transduction mecha 90.06
PLN00106323 malate dehydrogenase 89.9
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 89.87
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 89.87
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 89.75
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 89.67
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 89.66
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 89.56
PRK07411390 hypothetical protein; Validated 89.54
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.7e-55  Score=410.34  Aligned_cols=335  Identities=16%  Similarity=0.130  Sum_probs=259.6

Q ss_pred             ceeEEEEEeccHHHH-HHHHHHhcCCCcEEEEEEcCCHHHHHHHHHHcCCCCCCcccCCHHHHhcCCCCcEEEEcCCCcc
Q 018020            7 AAIRFGIIGAADIAR-KLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTSM   85 (362)
Q Consensus         7 ~~~~v~iiG~G~~g~-~~~~~~~~~~~~~vv~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~~~~~D~V~i~~~~~~   85 (362)
                      +++||||||+|.+|. .|++.+...|++++++|||++++++.   ++++.   ..+|+|++++|+++++|+|+|+||+..
T Consensus         3 ~~irvgiiG~G~i~~~~~~~~~~~~~~~~l~av~d~~~~~~~---~~~~~---~~~~~~~~ell~~~~vD~V~I~tp~~~   76 (346)
T PRK11579          3 DKIRVGLIGYGYASKTFHAPLIAGTPGLELAAVSSSDATKVK---ADWPT---VTVVSEPQHLFNDPNIDLIVIPTPNDT   76 (346)
T ss_pred             CcceEEEECCCHHHHHHHHHHHhhCCCCEEEEEECCCHHHHH---hhCCC---CceeCCHHHHhcCCCCCEEEEcCCcHH
Confidence            369999999999998 58899999999999999999987653   45543   368999999999999999999999999


Q ss_pred             cHHHHHHHHHcCCeEEEeCCCCCCHHHHHHHHHHHHHcCCEEEEeeecccChhHHHHHHhhcCCCCccceEEEEEEeeec
Q 018020           86 HVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFA  165 (362)
Q Consensus        86 h~~~~~~al~~gk~V~~EKP~~~~~~~~~~l~~~a~~~~~~~~v~~~~r~~p~~~~~k~~i~~~g~iG~i~~i~~~~~~~  165 (362)
                      |++++++||++||||+||||++.|++++++|.++|+++|+++++++++||+|.++++|++| ++|.||+|..++.++..+
T Consensus        77 H~~~~~~al~aGkhVl~EKPla~t~~ea~~l~~~a~~~g~~l~v~~~~R~~p~~~~~k~~i-~~g~iG~i~~~~~~~~~~  155 (346)
T PRK11579         77 HFPLAKAALEAGKHVVVDKPFTVTLSQARELDALAKSAGRVLSVFHNRRWDSDFLTLKALL-AEGVLGEVAYFESHFDRF  155 (346)
T ss_pred             HHHHHHHHHHCCCeEEEeCCCCCCHHHHHHHHHHHHHhCCEEEEEeeccCCHHHHHHHHHH-hcCCCCCeEEEEEEeccc
Confidence            9999999999999999999999999999999999999999999999999999999999999 999999999999877543


Q ss_pred             CCcccccCccCcCCCCCCCcccccccchHHHHHHHHccCCCCcEEEEeeccccCCCCeeEeeEEEEEeCCCcEEEEEEee
Q 018020          166 GDAEFLKNDIRVKPDLDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSF  245 (362)
Q Consensus       166 ~~~~~~~~~w~~~~~~~ggg~l~~~g~h~id~~~~l~g~~~~~~V~a~~~~~~~~~~~~d~~~~~~~~~~G~~~~~~~~~  245 (362)
                      .+.  ...+|+..+.. |||++.|+|+|.+|+++||+|  .|.+|++.........+.+|.+.++++|+||.. ++..++
T Consensus       156 ~~~--~~~~w~~~~~~-ggG~l~d~g~H~id~~~~l~G--~~~~v~a~~~~~~~~~~~~D~~~~~l~f~~g~~-~~~~s~  229 (346)
T PRK11579        156 RPQ--VRQRWREQGGP-GSGIWYDLAPHLLDQAIQLFG--LPVSITVDLAQLRPGAQSTDYFHAILSYPQRRV-VLHGTM  229 (346)
T ss_pred             CCC--CccccccCCCC-CCcchhhhhhhHHHHHHHHhC--CCeEEEEEeeeecCCCCCCceEEEEEEECCeEE-EEEEEe
Confidence            321  23467766554 559999999999999999999  589999876444334567899999999999855 788888


Q ss_pred             eeCC-ceeEEEEeccceEEEcceeccC----CC---CcceEEecccccccccccccccCCcceeeecCCchhHHHHHHHH
Q 018020          246 LANM-TMDITATGTNGSLQLHDFIIPF----RE---EEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFS  317 (362)
Q Consensus       246 ~~~~-~~~~~v~G~~G~i~~~~~~~~~----~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (362)
                      .... ..+++|+|++|++.+.+.....    ..   ....+.......  ... ..... ... ..........|..+++
T Consensus       230 ~~~~~~~~~~i~G~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~-~~~~~-~~~-~~~~~~~~~~~~~~~~  304 (346)
T PRK11579        230 LAAAESARYIVHGSRGSYVKYGLDPQEERLKNGERLPQEDWGYDMRDG--VLT-LVEGE-ERV-EETLLTLPGNYPAYYA  304 (346)
T ss_pred             eecCCCCEEEEEecCceEEEcCCCccHHHHhCCCCCCCCCCCCCCccC--eEE-EecCC-ccc-eeeecCCCCCHHHHHH
Confidence            7653 4589999999999765421110    00   000000000000  000 00000 000 0000111234667899


Q ss_pred             HHHHhhhcCCCCCCCchHhHHHHHHHHHHHHHHHhhCCcceeec
Q 018020          318 RLVANIKNGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEIK  361 (362)
Q Consensus       318 ~~~~~i~~g~~~~~~~~e~~l~~~~i~~a~~~S~~~g~~~V~l~  361 (362)
                      +|+++|++|.+|..+ .|+++++++|++|+++|+++| ++|.|.
T Consensus       305 ~f~~~i~~~~~~~~~-~e~a~~~l~i~~a~~~Sa~~g-~~v~l~  346 (346)
T PRK11579        305 AIRDALNGDGENPVP-ASQAIQVMELIELGIESAKHR-ATLCLA  346 (346)
T ss_pred             HHHHHHhCCCCCCCC-HHHHHHHHHHHHHHHHHHhcC-CEEecC
Confidence            999999988777665 788999999999999999999 999873

>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2742 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PF02894 GFO_IDH_MocA_C: Oxidoreductase family, C-terminal alpha/beta domain; InterPro: IPR004104 Enzymes containing this domain utilise NADP or NAD, and are known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PF08635 ox_reductase_C: Putative oxidoreductase C terminal; InterPro: IPR013944 This is the C terminus of putative oxidoreductases Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>COG4693 PchG Oxidoreductase (NAD-binding), involved in siderophore biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>KOG0455 consensus Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK12464 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK05722 glucose-6-phosphate 1-dehydrogenase; Validated Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN00125 Succinyl-CoA ligase [GDP-forming] subunit alpha Back     alignment and domain information
>KOG0172 consensus Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00871 zwf glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG1810 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>COG1832 Predicted CoA-binding protein [General function prediction only] Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>TIGR03450 mycothiol_INO1 inositol 1-phosphate synthase, Actinobacterial type Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK12853 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK06091 membrane protein FdrA; Validated Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03022 WbaP_sugtrans Undecaprenyl-phosphate galactose phosphotransferase, WbaP Back     alignment and domain information
>COG0364 Zwf Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PLN02285 methionyl-tRNA formyltransferase Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00479 G6PD_N: Glucose-6-phosphate dehydrogenase, NAD binding domain; InterPro: IPR022674 Glucose-6-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK06988 putative formyltransferase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>PF13727 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR03013 EpsB_2 sugar transferase, PEP-CTERM system associated Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK15204 undecaprenyl-phosphate galactose phosphotransferase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>TIGR00460 fmt methionyl-tRNA formyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>KOG1255 consensus Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK12854 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG3367 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PLN02539 glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
1ydw_A362 X-Ray Structure Of Gene Product From Arabidopsis Th 1e-140
4had_A350 Crystal Structure Of Probable Oxidoreductase Protei 5e-23
3rbv_A350 Crystal Structure Of Kijd10, A 3-Ketoreductase From 1e-19
3rcb_A350 Crystal Structure Of The K102e Mutant Of Kijd10, A 3e-19
3rc7_A350 Crystal Structure Of The Y186f Mutant Of Kijd10, A 4e-19
3rc9_A350 Crystal Structure Of The K102a Mutant Of Kijd10, A 6e-19
3e9m_A330 Crystal Structure Of An Oxidoreductase From Enteroc 7e-14
3evn_A329 Crystal Structure Of Putative Oxidoreductase From S 3e-13
2o48_X334 Crystal Structure Of Mammalian Dimeric Dihydrodiol 2e-12
3moi_A387 The Crystal Structure Of The Putative Dehydrogenase 3e-11
2glx_A332 Crystal Structure Analysis Of Bacterial 1,5-Af Redu 2e-10
1ryd_A387 Crystal Structure Of Glucose-Fructose Oxidoreductas 6e-09
1ofg_A381 Glucose-Fructose Oxidoreductase Length = 381 6e-09
1h6d_A433 Oxidized Precursor Form Of Glucose-Fructose Oxidore 6e-09
1zh8_A340 Crystal Structure Of Oxidoreductase (tm0312) From T 9e-09
1evj_A352 Crystal Structure Of Glucose-Fructose Oxidoreductas 1e-08
4iq0_A328 Crystal Structure Of Oxidoreductase, Gfo/idh/moca F 3e-08
3ezy_A344 Crystal Structure Of Probable Dehydrogenase Tm_0414 3e-08
2ho5_A325 Crystal Structure Of Oxidoreductase, GfoIDHMOCA FAM 3e-08
3db2_A354 Crystal Structure Of A Putative Nadph-Dependent Oxi 4e-08
3q2k_A370 Crystal Structure Of The Wlba Dehydrogenase From Bo 4e-08
3ec7_A357 Crystal Structure Of Putative Dehydrogenase From Sa 2e-06
3gfg_A367 Structure Of Putative Oxidoreductase Yvaa From Baci 2e-06
3gdo_A358 Crystal Structure Of Putative Oxidoreductase Yvaa F 2e-06
3e18_A359 Crystal Structure Of Nad-Binding Protein From Liste 4e-06
4fb5_A393 Crystal Structure Of A Probable Oxidoreduxtase Prot 1e-04
3euw_A344 Crystal Structure Of A Myo-Inositol Dehydrogenase F 1e-04
>pdb|1YDW|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At4g09670 Length = 362 Back     alignment and structure 
Iteration: 1

 Score =  495 bits (1274), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 232/360 (64%), Positives = 287/360 (79%), Gaps = 3/360 (0%)
Query: 2   ATESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKV 61
           ATE+Q  IR G+ G ADIARK+SRAI LAPNA +S VASRSLEKA  FA ANN+P   K+
Sbjct: 2   ATETQ--IRIGVXGCADIARKVSRAIHLAPNATISGVASRSLEKAKAFATANNYPESTKI 59
Query: 62  YGSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACE 121
           +GSYE+LL+D +IDA+Y+PLPTS+HV+WAI  A+K KH+L+EKP+A NV EFD I++ACE
Sbjct: 60  HGSYESLLEDPEIDALYVPLPTSLHVEWAIKAAEKGKHILLEKPVAXNVTEFDKIVDACE 119
Query: 122 ENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPXX 181
            NGVQ+ DGT WVHNPRTA +KEF+SD +RFGQL+T+ SCFSFAGD +FLKNDIRVKP  
Sbjct: 120 ANGVQIXDGTXWVHNPRTALLKEFLSDSERFGQLKTVQSCFSFAGDEDFLKNDIRVKPGL 179
Query: 182 XXXXXXXXXXWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATF 241
                     WY IR+ L AN++ELPKTV A  G VLNEAGVILSCGASL W+DGR AT 
Sbjct: 180 DGLGALGDAGWYAIRATLLANNFELPKTVTAFPGAVLNEAGVILSCGASLSWEDGRTATI 239
Query: 242 SCSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHV 301
            CSFLAN+T +ITA GT G+L++HDFIIP++E EAS+ T+T+ +FNDLVT WV  PSEH 
Sbjct: 240 YCSFLANLTXEITAIGTKGTLRVHDFIIPYKETEASFTTSTKAWFNDLVTAWVSPPSEHT 299
Query: 302 VTTDIPQEACMVREFSRLVANIK-NGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEI 360
           V T++PQEAC VREF+RLV  IK NG+KP+  WP ISRKTQL++DAVK S+++ ++ I +
Sbjct: 300 VKTELPQEACXVREFARLVGEIKNNGAKPDGYWPSISRKTQLVVDAVKESVDKNYQQISL 359
>pdb|4HAD|A Chain A, Crystal Structure Of Probable Oxidoreductase Protein From Rhizobium Etli Cfn 42 Length = 350 Back     alignment and structure
>pdb|3RBV|A Chain A, Crystal Structure Of Kijd10, A 3-Ketoreductase From Actinomadura Kijaniata Incomplex With Nadp Length = 350 Back     alignment and structure
>pdb|3RCB|A Chain A, Crystal Structure Of The K102e Mutant Of Kijd10, A 3-Ketoreductase From Actinomadura Kijaniata In Complex With Tdp-Benzene And Nadp Length = 350 Back     alignment and structure
>pdb|3RC7|A Chain A, Crystal Structure Of The Y186f Mutant Of Kijd10, A 3-Ketoreductase From Actinomadura Kijaniata In Complex With Tdp-Benzene And Nadp Length = 350 Back     alignment and structure
>pdb|3RC9|A Chain A, Crystal Structure Of The K102a Mutant Of Kijd10, A 3-Ketoreductase From Actinomadura Kijaniata In Complex With Tdp-Benzene And Nadp Length = 350 Back     alignment and structure
>pdb|3E9M|A Chain A, Crystal Structure Of An Oxidoreductase From Enterococcus Faecalis Length = 330 Back     alignment and structure
>pdb|3EVN|A Chain A, Crystal Structure Of Putative Oxidoreductase From Streptococcus Agalactiae 2603vR Length = 329 Back     alignment and structure
>pdb|2O48|X Chain X, Crystal Structure Of Mammalian Dimeric Dihydrodiol Dehydrogenase Length = 334 Back     alignment and structure
>pdb|3MOI|A Chain A, The Crystal Structure Of The Putative Dehydrogenase From Bordetella Bronchiseptica Rb50 Length = 387 Back     alignment and structure
>pdb|2GLX|A Chain A, Crystal Structure Analysis Of Bacterial 1,5-Af Reductase Length = 332 Back     alignment and structure
>pdb|1RYD|A Chain A, Crystal Structure Of Glucose-Fructose Oxidoreductase From Zymomonas Mobilis Length = 387 Back     alignment and structure
>pdb|1OFG|A Chain A, Glucose-Fructose Oxidoreductase Length = 381 Back     alignment and structure
>pdb|1H6D|A Chain A, Oxidized Precursor Form Of Glucose-Fructose Oxidoreductase From Zymomonas Mobilis Complexed With Glycerol Length = 433 Back     alignment and structure
>pdb|1ZH8|A Chain A, Crystal Structure Of Oxidoreductase (tm0312) From Thermotoga Maritima At 2.50 A Resolution Length = 340 Back     alignment and structure
>pdb|1EVJ|A Chain A, Crystal Structure Of Glucose-Fructose Oxidoreductase (Gfor) Delta1-22 S64d Length = 352 Back     alignment and structure
>pdb|4IQ0|A Chain A, Crystal Structure Of Oxidoreductase, Gfo/idh/moca Family From Streptococcus Pneumoniae With Reductive Methylated Lysine Length = 328 Back     alignment and structure
>pdb|3EZY|A Chain A, Crystal Structure Of Probable Dehydrogenase Tm_0414 From Thermotoga Maritima Length = 344 Back     alignment and structure
>pdb|2HO5|A Chain A, Crystal Structure Of Oxidoreductase, GfoIDHMOCA FAMILY FROM Streptococcus Pneumoniae Length = 325 Back     alignment and structure
>pdb|3DB2|A Chain A, Crystal Structure Of A Putative Nadph-Dependent Oxidoreductase (Dhaf_2064) From Desulfitobacterium Hafniense Dcb-2 At 1.70 A Resolution Length = 354 Back     alignment and structure
>pdb|3Q2K|A Chain A, Crystal Structure Of The Wlba Dehydrogenase From Bordetella Pertussis In Complex With Nadh And Udp-Glcnaca Length = 370 Back     alignment and structure
>pdb|3EC7|A Chain A, Crystal Structure Of Putative Dehydrogenase From Salmonella Typhimurium Lt2 Length = 357 Back     alignment and structure
>pdb|3GFG|A Chain A, Structure Of Putative Oxidoreductase Yvaa From Bacillus Subtilis In Triclinic Form Length = 367 Back     alignment and structure
>pdb|3GDO|A Chain A, Crystal Structure Of Putative Oxidoreductase Yvaa From Bacillus Subtilis Length = 358 Back     alignment and structure
>pdb|3E18|A Chain A, Crystal Structure Of Nad-Binding Protein From Listeria Innocua Length = 359 Back     alignment and structure
>pdb|4FB5|A Chain A, Crystal Structure Of A Probable Oxidoreduxtase Protein Length = 393 Back     alignment and structure
>pdb|3EUW|A Chain A, Crystal Structure Of A Myo-Inositol Dehydrogenase From Corynebacterium Glutamicum Atcc 13032 Length = 344 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
1ydw_A362 AX110P-like protein; structural genomics, protein 1e-151
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 3e-98
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 1e-79
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 2e-79
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 7e-78
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 1e-74
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 2e-73
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 2e-72
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 1e-65
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 1e-56
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 6e-51
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 6e-50
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 2e-49
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 3e-46
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 1e-44
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 2e-44
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 4e-44
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 8e-44
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 2e-43
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 2e-42
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 5e-42
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 4e-41
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 5e-40
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 6e-40
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 9e-37
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 2e-36
3oqb_A383 Oxidoreductase; structural genomics, protein struc 2e-36
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 6e-35
3btv_A438 Galactose/lactose metabolism regulatory protein GA 3e-34
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 1e-32
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 3e-31
3euw_A344 MYO-inositol dehydrogenase; protein structure init 3e-31
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 4e-31
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 4e-31
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 2e-30
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 9e-30
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 2e-29
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 4e-28
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 7e-27
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 1e-26
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 1e-24
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 1e-24
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 4e-24
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 4e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 5e-06
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Length = 362 Back     alignment and structure
 Score =  430 bits (1108), Expect = e-151
 Identities = 243/359 (67%), Positives = 302/359 (84%), Gaps = 1/359 (0%)

Query: 3   TESQAAIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVY 62
           + ++  IR G++G ADIARK+SRAI LAPNA +S VASRSLEKA  FA ANN+P   K++
Sbjct: 1   SATETQIRIGVMGCADIARKVSRAIHLAPNATISGVASRSLEKAKAFATANNYPESTKIH 60

Query: 63  GSYEALLDDKDIDAVYLPLPTSMHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEE 122
           GSYE+LL+D +IDA+Y+PLPTS+HV+WAI  A+K KH+L+EKP+A+NV EFD I++ACE 
Sbjct: 61  GSYESLLEDPEIDALYVPLPTSLHVEWAIKAAEKGKHILLEKPVAMNVTEFDKIVDACEA 120

Query: 123 NGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLD 182
           NGVQ+MDGTMWVHNPRTA +KEF+SD +RFGQL+T+ SCFSFAGD +FLKNDIRVKP LD
Sbjct: 121 NGVQIMDGTMWVHNPRTALLKEFLSDSERFGQLKTVQSCFSFAGDEDFLKNDIRVKPGLD 180

Query: 183 GLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFS 242
           GLGALGDAGWY IR+ L AN++ELPKTV A  G VLNEAGVILSCGASL W+DGR AT  
Sbjct: 181 GLGALGDAGWYAIRATLLANNFELPKTVTAFPGAVLNEAGVILSCGASLSWEDGRTATIY 240

Query: 243 CSFLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVV 302
           CSFLAN+TM+ITA GT G+L++HDFIIP++E EAS+ T+T+ +FNDLVT WV  PSEH V
Sbjct: 241 CSFLANLTMEITAIGTKGTLRVHDFIIPYKETEASFTTSTKAWFNDLVTAWVSPPSEHTV 300

Query: 303 TTDIPQEACMVREFSRLVANIK-NGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEI 360
            T++PQEACMVREF+RLV  IK NG+KP+  WP ISRKTQL++DAVK S+++ ++ I +
Sbjct: 301 KTELPQEACMVREFARLVGEIKNNGAKPDGYWPSISRKTQLVVDAVKESVDKNYQQISL 359
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Length = 350 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Length = 330 Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Length = 329 Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Length = 433 Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Length = 340 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Length = 332 Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Length = 334 Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Length = 354 Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Length = 330 Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Length = 337 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Length = 354 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Length = 359 Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Length = 387 Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Length = 345 Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Length = 352 Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Length = 336 Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Length = 361 Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Length = 364 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Length = 359 Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Length = 362 Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Length = 358 Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Length = 349 Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Length = 294 Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Length = 323 Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Length = 383 Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Length = 319 Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Length = 438 Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Length = 393 Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Length = 344 Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Length = 344 Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Length = 346 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Length = 308 Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Length = 357 Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Length = 315 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Length = 344 Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Length = 479 Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Length = 444 Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Length = 318 Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Length = 312 Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Length = 398 Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Length = 304 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Length = 320 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
4had_A350 Probable oxidoreductase protein; structural genomi 100.0
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 100.0
4h3v_A390 Oxidoreductase domain protein; structural genomics 100.0
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 100.0
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 100.0
1ydw_A362 AX110P-like protein; structural genomics, protein 100.0
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 100.0
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 100.0
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 100.0
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 100.0
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 100.0
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 100.0
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 100.0
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 100.0
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 100.0
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 100.0
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 100.0
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 100.0
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 100.0
3oqb_A383 Oxidoreductase; structural genomics, protein struc 100.0
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 100.0
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 100.0
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 100.0
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 100.0
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 100.0
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 100.0
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 100.0
3euw_A344 MYO-inositol dehydrogenase; protein structure init 100.0
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 100.0
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 100.0
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 100.0
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 100.0
3btv_A438 Galactose/lactose metabolism regulatory protein GA 100.0
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 100.0
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 100.0
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 100.0
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 100.0
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 100.0
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 100.0
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 100.0
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 100.0
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 100.0
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 100.0
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 100.0
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 100.0
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 100.0
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 100.0
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 100.0
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 99.95
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 99.9
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 99.85
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 99.85
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 99.82
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 99.81
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 99.76
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 99.75
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 99.75
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 99.74
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 99.73
3a06_A376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 99.73
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 99.69
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 99.69
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 99.6
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 99.52
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 99.46
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 99.41
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 99.4
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 99.39
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 99.32
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 99.32
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 99.26
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 99.26
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 99.24
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.21
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 99.14
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 99.1
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 99.09
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 99.07
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 99.07
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 99.02
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 98.96
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 98.93
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 98.93
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.86
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 98.86
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 98.82
3l6d_A306 Putative oxidoreductase; structural genomics, prot 98.81
2d59_A144 Hypothetical protein PH1109; COA binding, structur 98.79
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 98.79
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 98.78
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 98.78
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 98.77
2duw_A145 Putative COA-binding protein; ligand binding prote 98.77
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 98.76
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 98.76
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 98.75
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 98.74
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.73
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 98.73
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 98.72
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 98.7
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.7
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 98.69
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.69
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.68
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 98.68
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.67
3qha_A296 Putative oxidoreductase; seattle structural genomi 98.65
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 98.65
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 98.64
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 98.64
1vpd_A299 Tartronate semialdehyde reductase; structural geno 98.63
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 98.6
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 98.6
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 98.6
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 98.59
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 98.58
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 98.57
1iuk_A140 Hypothetical protein TT1466; structural genomics, 98.57
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 98.57
1yb4_A295 Tartronic semialdehyde reductase; structural genom 98.57
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.56
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 98.54
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 98.53
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 98.53
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 98.48
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 98.46
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 98.46
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 98.45
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 98.44
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 98.4
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 98.39
4ezb_A317 Uncharacterized conserved protein; structural geno 98.39
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 98.37
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 98.36
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.35
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 98.31
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 98.29
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 98.27
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 98.27
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 98.26
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 98.26
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 98.25
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 98.24
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 98.19
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 98.19
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 98.17
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 98.17
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 98.15
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.15
2y1e_A398 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 98.15
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 98.15
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 98.14
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 98.13
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 98.12
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 98.11
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 98.1
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 98.1
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 98.1
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 98.1
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 98.08
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 98.07
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 98.07
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.05
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 98.03
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.02
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 97.98
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 97.98
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 97.97
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.96
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.95
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.94
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 97.93
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.93
3au8_A488 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 97.93
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 97.9
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.89
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 97.87
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.84
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 97.83
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 97.81
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.79
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.78
2csu_A457 457AA long hypothetical protein; structural genomi 97.78
2obn_A349 Hypothetical protein; structural genomics, joint c 97.78
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 97.76
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.75
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.7
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 97.7
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 97.69
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 97.68
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.68
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.67
3mwd_B334 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 97.66
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.64
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.64
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 97.63
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.62
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 97.62
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 97.62
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.61
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.6
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.58
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.58
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 97.57
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.56
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.56
2g0t_A350 Conserved hypothetical protein; structural genomic 97.56
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 97.55
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 97.55
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.54
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.52
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 97.51
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 97.47
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 97.43
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 97.43
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.42
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 97.41
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.39
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.38
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.38
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.38
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.37
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.36
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 97.35
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.35
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.34
1q0q_A406 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 97.34
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.33
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.32
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.31
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 97.31
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.31
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 97.29
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 97.28
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.27
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.27
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 97.27
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.26
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.25
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.24
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.22
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 97.19
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 97.19
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.18
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.16
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 97.16
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 96.24
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 97.14
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 97.14
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.14
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 97.13
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 97.12
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 97.11
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.1
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 97.1
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.09
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 97.09
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.08
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.07
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.06
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 97.05
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.04
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.04
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 97.03
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 97.03
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 97.03
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 97.0
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.0
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 97.0
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.0
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 96.99
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.97
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 96.96
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 96.95
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 96.95
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 96.95
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.94
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 96.93
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 96.93
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.92
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.91
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 96.89
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 96.87
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 96.87
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.86
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.85
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 96.84
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 96.83
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.83
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 96.83
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 96.82
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 96.81
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 96.8
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.79
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 96.79
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 96.78
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 96.78
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.77
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 96.77
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 96.75
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 96.74
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 96.74
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.74
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 96.7
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 96.68
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 96.68
1gr0_A367 Inositol-3-phosphate synthase; isomerase, oxidored 96.67
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 96.66
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 96.65
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 96.62
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.62
4g65_A 461 TRK system potassium uptake protein TRKA; structur 96.56
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.55
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 96.54
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 96.54
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 96.53
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 96.49
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 96.48
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 96.44
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 96.41
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 96.37
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.36
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 96.35
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.34
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.34
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 96.33
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.33
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 96.3
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.3
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.29
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.29
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 96.28
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.19
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 96.17
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.17
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 96.17
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 96.16
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 96.15
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.11
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 96.11
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 96.1
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 96.1
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 96.08
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 96.05
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 96.05
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.05
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 96.04
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 96.03
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.01
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.99
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 95.97
3krt_A456 Crotonyl COA reductase; structural genomics, prote 95.96
3pff_A829 ATP-citrate synthase; phosphohistidine, organic ac 95.93
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 95.9
3tl2_A315 Malate dehydrogenase; center for structural genomi 95.86
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.86
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 95.82
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.79
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.74
3q0i_A318 Methionyl-tRNA formyltransferase; structural genom 95.71
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 95.71
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 95.7
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 95.66
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.63
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 95.63
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 95.62
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 95.61
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.55
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 95.55
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 95.55
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 95.5
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 95.49
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 95.48
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.46
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 95.45
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.43
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 95.41
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 95.38
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 95.37
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 95.32
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.31
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 95.29
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 95.29
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 95.26
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 95.25
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 95.24
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 95.24
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 95.23
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 95.19
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.19
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 95.17
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.12
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 95.08
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.08
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 95.02
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 95.01
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 95.0
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 94.99
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 94.98
3cnb_A143 DNA-binding response regulator, MERR family; signa 94.95
3ius_A286 Uncharacterized conserved protein; APC63810, silic 94.92
3gjy_A317 Spermidine synthase; APC62791, structural genomics 94.91
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 94.87
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 94.85
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 94.82
3fbg_A346 Putative arginate lyase; structural genomics, unkn 94.81
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 94.78
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 94.74
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 94.73
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.68
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 94.67
3dmy_A 480 Protein FDRA; predicted actyl-COA synthetase, nysg 94.66
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 94.64
2bw0_A329 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase 94.61
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 94.61
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.55
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 94.54
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 94.53
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 94.51
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 94.47
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 94.43
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 94.37
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 94.33
3mjf_A431 Phosphoribosylamine--glycine ligase; structural ge 94.32
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 94.31
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 94.28
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 94.21
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 94.16
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 94.15
3av3_A212 Phosphoribosylglycinamide formyltransferase; struc 94.13
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 94.07
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 94.05
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 94.02
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 94.0
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.98
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 93.97
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 93.97
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 93.95
2bln_A305 Protein YFBG; transferase, formyltransferase, L-AR 93.94
3slg_A372 PBGP3 protein; structural genomics, seattle struct 93.92
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 93.9
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 93.9
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 93.88
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 93.85
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 93.84
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 93.79
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 93.77
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 93.73
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 93.71
1fmt_A314 Methionyl-tRNA FMet formyltransferase; initiator t 93.64
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 93.64
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 93.6
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 93.6
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 93.57
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 93.47
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 93.47
2wm3_A299 NMRA-like family domain containing protein 1; unkn 93.32
3gms_A340 Putative NADPH:quinone reductase; structural genom 93.31
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 93.29
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 93.23
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 93.18
3tqq_A314 Methionyl-tRNA formyltransferase; protein synthesi 93.16
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 93.06
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 92.98
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 92.97
1lnq_A336 MTHK channels, potassium channel related protein; 92.89
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 92.77
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 92.77
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 92.71
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 92.7
3rfo_A317 Methionyl-tRNA formyltransferase; structural genom 92.69
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 92.67
3cg0_A140 Response regulator receiver modulated diguanylate 92.6
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 92.59
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 92.53
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 92.44
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 92.43
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 92.42
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 92.42
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 92.39
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 92.36
3lp8_A442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 92.32
2xcl_A422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 92.3
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 92.29
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 92.23
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 92.19
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 92.13
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 92.13
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 92.11
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 92.06
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 92.05
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 92.04
3cz5_A153 Two-component response regulator, LUXR family; str 91.98
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 91.93
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 91.92
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 91.86
4gx0_A565 TRKA domain protein; membrane protein, ION channel 91.85
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 91.81
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
Probab=100.00  E-value=7.3e-62  Score=456.34  Aligned_cols=329  Identities=27%  Similarity=0.407  Sum_probs=265.8

Q ss_pred             CceeEEEEEeccHHHHH-HHHHHhcCCCcEEEEEEcCCHHHHHHHHHHcCCCCCCcccCCHHHHhcCCCCcEEEEcCCCc
Q 018020            6 QAAIRFGIIGAADIARK-LSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTS   84 (362)
Q Consensus         6 ~~~~~v~iiG~G~~g~~-~~~~~~~~~~~~vv~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~~~~~D~V~i~~~~~   84 (362)
                      +++|||||||+|.||+. +++.+++.|+++|+||||++++++++++++||++   ++|+|+++||+++++|+|+|+||+.
T Consensus        21 ~~mirigiIG~G~ig~~~~~~~~~~~~~~~lvav~d~~~~~a~~~a~~~g~~---~~y~d~~ell~~~~iDaV~I~tP~~   97 (350)
T 4had_A           21 QSMLRFGIISTAKIGRDNVVPAIQDAENCVVTAIASRDLTRAREMADRFSVP---HAFGSYEEMLASDVIDAVYIPLPTS   97 (350)
T ss_dssp             -CCEEEEEESCCHHHHHTHHHHHHHCSSEEEEEEECSSHHHHHHHHHHHTCS---EEESSHHHHHHCSSCSEEEECSCGG
T ss_pred             cCccEEEEEcChHHHHHHHHHHHHhCCCeEEEEEECCCHHHHHHHHHHcCCC---eeeCCHHHHhcCCCCCEEEEeCCCc
Confidence            46799999999999986 5899999999999999999999999999999986   7899999999999999999999999


Q ss_pred             ccHHHHHHHHHcCCeEEEeCCCCCCHHHHHHHHHHHHHcCCEEEEeeecccChhHHHHHHhhcCCCCccceEEEEEEeee
Q 018020           85 MHVKWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSF  164 (362)
Q Consensus        85 ~h~~~~~~al~~gk~V~~EKP~~~~~~~~~~l~~~a~~~~~~~~v~~~~r~~p~~~~~k~~i~~~g~iG~i~~i~~~~~~  164 (362)
                      .|++++++||++|||||||||++.|++++++|.++|+++|+++++++++||+|.++++|++| ++|.||+|..+++.+.+
T Consensus        98 ~H~~~~~~al~aGkhVl~EKPla~~~~ea~~l~~~a~~~~~~l~v~~~~R~~p~~~~~k~~i-~~G~iG~i~~i~~~~~~  176 (350)
T 4had_A           98 QHIEWSIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAYMITYSPVWQKVRSLI-DEGAIGSLRHVQGAFTY  176 (350)
T ss_dssp             GHHHHHHHHHHTTCEEEECSCCCSSGGGGHHHHHHHHHHTCCEEECCGGGGSHHHHHHHHHH-HTTTTSSEEEEEEEEEE
T ss_pred             hhHHHHHHHHhcCCEEEEeCCcccchhhHHHHHHHHHHcCCceeEeeeeecCHHHHHhhHhh-hcCCCCcceeeeEEEee
Confidence            99999999999999999999999999999999999999999999999999999999999999 89999999999998876


Q ss_pred             cCCcccccCccCcCCCCCCCcccccccchHHHHHHHHccCCCCcEEEEeeccccCCCCeeEeeEEEEEeCCCcEEEEEEe
Q 018020          165 AGDAEFLKNDIRVKPDLDGLGALGDAGWYGIRSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCS  244 (362)
Q Consensus       165 ~~~~~~~~~~w~~~~~~~ggg~l~~~g~h~id~~~~l~g~~~~~~V~a~~~~~~~~~~~~d~~~~~~~~~~G~~~~~~~~  244 (362)
                      ..++.   .+|+..+..+ ||.|.|+|+|.+|+++|++|. +|++|++... ...+.+.++.+.++++|+||.++.+. +
T Consensus       177 ~~~~~---~~~~~~~~~g-GG~l~d~g~H~id~~~~l~G~-~~~~V~a~~~-~~~~~~~d~~~~~~l~~~~g~~~~~~-~  249 (350)
T 4had_A          177 FNRDA---SNMRNIPELG-GGGLPDIGVYPVMSTRFSTGK-EPLRIQANTE-RDPDFGTDIYSSVKADFDDFELSFYV-S  249 (350)
T ss_dssp             ECCCC----------------CCHHHHHHHHHHHHHHHCC-CCSEEEEEEE-ECTTTCCEEEEEEEEECSSCEEEEEE-E
T ss_pred             ccccc---ccccCChhhc-CCcccCCceehhHHHHHHcCC-CceEEEEEEE-EcCCCCceEEEEEEEEECCEEEEEEE-e
Confidence            55432   3566666664 599999999999999999994 5999999853 33455789999999999999876554 4


Q ss_pred             eeeCCceeEEEEeccceEEEcceeccCCCCcceEEecccccccccccccccCCcceeeecCCchhHHHHHHHHHHHHhhh
Q 018020          245 FLANMTMDITATGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDIPQEACMVREFSRLVANIK  324 (362)
Q Consensus       245 ~~~~~~~~~~v~G~~G~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  324 (362)
                      +..+....++|+|++|++.+++.................             .........+...+.|..++++|+++|+
T Consensus       250 ~~~~~~~~~~i~G~~G~i~i~~~~~~~~~~~~~~~~~~~-------------~~~~~~~~~~~~~~~~~~~~~~F~~~i~  316 (350)
T 4had_A          250 TQMANRQIMVFHGTNGYIEVKSPFNANRWGPEEIELADR-------------SHNESRIFRFQDSRQYRREVEAFARAVE  316 (350)
T ss_dssp             SEEEEEEEEEEEESSCEEEESSTTTGGGTSCCEEEEECS-------------SSSEEEEEECTTCCHHHHHHHHHHHHHH
T ss_pred             cCCCCCcccccccCceEEEEccccccccCCcceEEEecC-------------CCCceeEeecCCChHHHHHHHHHHHHHH
Confidence            444455679999999999997532111111111111111             0111111223344568899999999999


Q ss_pred             cCCCCCCCchHhHHHHHHHHHHHHHHHhhCCcceee
Q 018020          325 NGSKPEQKWPIISRKTQLIIDAVKTSIERGFEPIEI  360 (362)
Q Consensus       325 ~g~~~~~~~~e~~l~~~~i~~a~~~S~~~g~~~V~l  360 (362)
                      +|+++.++ .+|++++++|++|+++|+++| +||.|
T Consensus       317 ~g~~~~~~-~~dal~~~~iieai~~Sa~~g-~wv~V  350 (350)
T 4had_A          317 NGKEEVVT-LENSKLNQKVIDAIYRASEKD-GWEAV  350 (350)
T ss_dssp             HSCSCCCC-HHHHHHHHHHHHHHHHHTTSS-SCEEC
T ss_pred             cCCCCCCC-HHHHHHHHHHHHHHHHHHHhC-CCcCC
Confidence            88877665 777999999999999999999 99986
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1gr0_A Inositol-3-phosphate synthase; isomerase, oxidoreductase, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: NAD; 1.95A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3q0i_A Methionyl-tRNA formyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 1.89A {Vibrio cholerae} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, STRU genomics, protein structure initiative; 2.07A {Escherichia coli} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* 3r8x_A Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3tqq_A Methionyl-tRNA formyltransferase; protein synthesis; 2.00A {Coxiella burnetii} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 362
d1ydwa2171 d.81.1.5 (A:134-304) Probable oxidoreductase At4g0 2e-37
d1ydwa1184 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductas 9e-17
d1lc0a1172 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase { 5e-15
d1xeaa1167 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductas 4e-14
d2nvwa1237 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose meta 4e-14
d1h6da1221 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxid 2e-13
d1zh8a1181 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein T 1e-11
d1zh8a2144 d.81.1.5 (A:132-275) Hypothetical protein TM0312 { 5e-11
d1tlta1164 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM 2e-10
d1f06a1170 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid de 5e-10
d1h6da2162 d.81.1.5 (A:213-374) Glucose-fructose oxidoreducta 1e-09
d1nvmb1157 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydroge 3e-05
>d1ydwa2 d.81.1.5 (A:134-304) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: Glucose 6-phosphate dehydrogenase-like
domain: Probable oxidoreductase At4g09670
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  130 bits (327), Expect = 2e-37
 Identities = 122/171 (71%), Positives = 145/171 (84%)

Query: 136 NPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGDAEFLKNDIRVKPDLDGLGALGDAGWYGI 195
           NPRTA +KEF+SD +RFGQL+T+ SCFSFAGD +FLKNDIRVKP LDGLGALGDAGWY I
Sbjct: 1   NPRTALLKEFLSDSERFGQLKTVQSCFSFAGDEDFLKNDIRVKPGLDGLGALGDAGWYAI 60

Query: 196 RSILWANDYELPKTVIAMHGPVLNEAGVILSCGASLHWDDGRVATFSCSFLANMTMDITA 255
           R+ L AN++ELPKTV A  G VLNEAGVILSCGASL W+DGR AT  CSFLAN+TM+ITA
Sbjct: 61  RATLLANNFELPKTVTAFPGAVLNEAGVILSCGASLSWEDGRTATIYCSFLANLTMEITA 120

Query: 256 TGTNGSLQLHDFIIPFREEEASYFTNTRCFFNDLVTGWVPLPSEHVVTTDI 306
            GT G+L++HDFIIP++E EAS+ T+T+ +FNDLVT WV  PSEH V T++
Sbjct: 121 IGTKGTLRVHDFIIPYKETEASFTTSTKAWFNDLVTAWVSPPSEHTVKTEL 171
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 184 Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 172 Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Length = 167 Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Length = 237 Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Length = 221 Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Length = 181 Back     information, alignment and structure
>d1zh8a2 d.81.1.5 (A:132-275) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Length = 144 Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Length = 170 Back     information, alignment and structure
>d1h6da2 d.81.1.5 (A:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]} Length = 162 Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Length = 157 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 100.0
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 100.0
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 100.0
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 100.0
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 100.0
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 99.97
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 99.97
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 99.92
d1ydwa2171 Probable oxidoreductase At4g09670 {Thale cress (Ar 99.91
d1zh8a2144 Hypothetical protein TM0312 {Thermotoga maritima [ 99.84
d1h6da2162 Glucose-fructose oxidoreductase {Zymomonas mobilis 99.81
d2nvwa2219 Galactose/lactose metabolism regulatory protein GA 99.78
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 99.59
d1xeaa2144 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 99.56
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 99.51
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.99
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.93
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 98.9
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.87
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.79
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.79
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 98.76
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 98.73
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 98.65
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 98.65
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.65
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.64
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 98.6
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.52
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.49
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 98.45
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 98.43
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 98.4
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 98.38
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.34
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.33
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 98.26
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 98.19
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 98.13
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 98.07
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 98.02
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.97
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 97.97
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 97.92
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 97.9
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 97.89
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 97.86
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.84
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 97.83
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.83
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.77
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 97.72
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.71
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.71
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.67
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.63
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 97.63
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.54
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 97.5
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.44
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 97.4
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.35
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.34
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.34
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 97.31
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.3
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 97.29
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.27
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.26
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.24
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.22
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 97.21
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 97.2
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 97.19
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.19
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.18
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.16
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 97.15
d1tlta2140 Virulence factor MviM {Escherichia coli [TaxId: 56 97.14
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.14
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.12
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.11
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.09
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.05
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.05
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.04
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.01
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.99
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.97
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.97
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.96
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 96.95
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.94
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.94
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.92
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.91
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.85
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.84
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.83
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.82
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.82
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.81
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.8
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.79
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 96.78
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.78
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 96.78
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.78
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.71
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 96.71
d1h9aa1195 Glucose 6-phosphate dehydrogenase, N-terminal doma 96.59
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.56
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.55
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 96.54
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.48
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.43
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.39
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.38
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.36
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 96.3
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.28
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.24
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.13
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 95.96
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.95
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.88
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.85
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.85
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.77
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.71
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.71
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.7
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.67
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.63
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.54
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.42
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.33
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.31
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.2
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.13
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 95.0
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.86
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 94.86
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.86
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 94.82
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 94.73
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 94.73
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 94.43
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 94.42
d1gr0a1243 Myo-inositol 1-phosphate synthase {Mycobacterium t 94.31
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.17
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.15
d1qkia1203 Glucose 6-phosphate dehydrogenase, N-terminal doma 94.02
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 93.98
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.36
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.18
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 93.11
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 92.92
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.66
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 92.59
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 92.55
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 92.54
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 92.23
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 92.04
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 92.0
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 91.88
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 91.67
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 91.57
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 91.54
d2g0ta1338 Hypothetical protein TM0796 {Thermotoga maritima [ 91.53
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 91.22
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 91.21
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 91.13
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 91.1
d1b74a1105 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 90.89
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 90.8
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 90.46
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 90.38
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 90.16
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 90.0
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 89.87
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 89.85
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 89.75
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 89.74
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 89.31
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 89.29
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 88.81
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 88.67
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 88.64
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 88.3
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 88.15
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 88.01
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 87.4
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 87.37
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 87.18
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 87.06
d1s8na_190 Probable two-component system transcriptional regu 86.93
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 86.93
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 86.78
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 86.74
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 86.65
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 86.57
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 86.44
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 86.41
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 86.31
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 85.88
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 85.46
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 84.94
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 84.88
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 83.95
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 83.92
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 83.84
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 83.37
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 83.33
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 83.16
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 83.08
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 82.95
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 82.48
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 82.36
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 82.22
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 81.95
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 81.88
d1u6ka1282 F420-dependent methylenetetrahydromethanopterin de 81.78
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 81.74
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 81.74
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 81.54
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 81.45
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 81.33
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 81.2
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 80.93
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 80.84
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 80.74
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 80.66
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 80.35
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 80.21
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 80.19
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 80.14
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Probable oxidoreductase At4g09670
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=6.1e-38  Score=264.99  Aligned_cols=175  Identities=53%  Similarity=0.830  Sum_probs=150.4

Q ss_pred             eeEEEEEeccHHHHHHHHHHhcCCCcEEEEEEcCCHHHHHHHHHHcCCCCCCcccCCHHHHhcCCCCcEEEEcCCCcccH
Q 018020            8 AIRFGIIGAADIARKLSRAITLAPNAVLSAVASRSLEKATNFAKANNFPPDAKVYGSYEALLDDKDIDAVYLPLPTSMHV   87 (362)
Q Consensus         8 ~~~v~iiG~G~~g~~~~~~~~~~~~~~vv~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~~~~~D~V~i~~~~~~h~   87 (362)
                      +|||||||+|.+|+.|++.++..++++|+|+||+++++++.+++++++++..++|+|++++++++++|+|+|+||+..|.
T Consensus         1 kiki~iIG~G~~g~~~~~~l~~~~~~~i~ai~d~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~iD~v~I~tp~~~h~   80 (184)
T d1ydwa1           1 QIRIGVMGCADIARKVSRAIHLAPNATISGVASRSLEKAKAFATANNYPESTKIHGSYESLLEDPEIDALYVPLPTSLHV   80 (184)
T ss_dssp             CEEEEEESCCTTHHHHHHHHHHCTTEEEEEEECSSHHHHHHHHHHTTCCTTCEEESSHHHHHHCTTCCEEEECCCGGGHH
T ss_pred             CeEEEEEcCCHHHHHHHHHHHhCCCCEEEEEEeCCccccccchhccccccceeecCcHHHhhhccccceeeecccchhhc
Confidence            58999999999999999999999999999999999999999999999987778999999999999999999999999999


Q ss_pred             HHHHHHHHcCCeEEEeCCCCCCHHHHHHHHHHHHHcCCEEEEeeecccChhHHHHHHhhcCCCCccceEEEEEEeeecCC
Q 018020           88 KWAISVAQKKKHLLMEKPMALNVAEFDVILNACEENGVQLMDGTMWVHNPRTAQMKEFVSDPQRFGQLRTMHSCFSFAGD  167 (362)
Q Consensus        88 ~~~~~al~~gk~V~~EKP~~~~~~~~~~l~~~a~~~~~~~~v~~~~r~~p~~~~~k~~i~~~g~iG~i~~i~~~~~~~~~  167 (362)
                      +++..|+++|+||+||||++.+++++++|.++++++|+.+++++++||+|.+..+|+++   +.||+|..+......   
T Consensus        81 ~~~~~~l~~g~~v~~EKP~~~~~~e~~~l~~~~~~~~~~~~v~~~~r~~~~~~~~k~li---~~iG~I~~~~~~~~~---  154 (184)
T d1ydwa1          81 EWAIKAAEKGKHILLEKPVAMNVTEFDKIVDACEANGVQIMDGTMWVHPQEACMVREFA---RLVGEIKNNGAKPDG---  154 (184)
T ss_dssp             HHHHHHHTTTCEEEECSSCSSSHHHHHHHHHHHHTTTCCEEECCCGGGCHHHHHHHHHT---TCC---------------
T ss_pred             chhhhhhhccceeecccccccCHHHHHHHHHHHHhhCCEEEEEEeeecChHHHHHHHHH---HhhCCeEEEEEecCC---
Confidence            99999999999999999999999999999999999999999999999999999999998   589999877654211   


Q ss_pred             cccccCccCcCCCCCCCcccccccchHHH
Q 018020          168 AEFLKNDIRVKPDLDGLGALGDAGWYGIR  196 (362)
Q Consensus       168 ~~~~~~~w~~~~~~~ggg~l~~~g~h~id  196 (362)
                             |+.... ..||.+.|+++|.+|
T Consensus       155 -------~~~~~~-~~g~~i~d~~~h~iD  175 (184)
T d1ydwa1         155 -------YWPSIS-RKTQLVVDAVKESVD  175 (184)
T ss_dssp             -------CHHHHH-HHHHHHHHHHHHHHH
T ss_pred             -------CCCCcc-cCCCEEEecchhhcc
Confidence                   111111 134888999999988
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1ydwa2 d.81.1.5 (A:134-304) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zh8a2 d.81.1.5 (A:132-275) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da2 d.81.1.5 (A:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2nvwa2 d.81.1.5 (A:155-373) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1xeaa2 d.81.1.5 (A:123-266) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1tlta2 d.81.1.5 (A:128-267) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h9aa1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qkia1 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g0ta1 c.37.1.10 (A:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6ka1 c.127.1.1 (A:2-283) F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure