Citrus Sinensis ID: 018088


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MPQMDCTYSNIRSTSLLIPSRPTLSSAHHLFFPSTLKLSKFKRLVIRNACGFDENGSFNGFPITPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWDVVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLFANKGSTFMERQKQIVEKVPPKRKLTIDTIF
ccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHccccccccEEEEcccccccccHHHHHHHHHcccccccEEEEEccHHHHHHHHHcccEEEEEccccccHHHccccEEEcccccccHHHHHHHHHcccccHHHHHHHHHHcccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccEEEEHHHccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEccEEEccHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHcccHHHcEEEEcHHccccccHHHHHHHHHHccccHcHEEEEEccHHHHHHHHHcccEEEEEcccccHHHHHHccEEEccHHcccHHHHHHHHHHccccHHHHHHHHHcccccccEEEEEccc
mpqmdctysnirstsllipsrptlssahhlffpstlklskFKRLVIRNacgfdengsfngfpitpnklFMQEAIGAEygegfetfrqdgplkvdVDFLNDRLQEGFLKRIRYamkpdeaygLIFSWDVVADTRALKLNAWKQLAFeegkeipqeGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDnllsvtepmEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVkldrkpskcvvfeddpraitaAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLFANKGSTFMERQKQIvekvppkrkltidtif
mpqmdctysnIRSTSLLIPSRPTLSSAHHLFFPSTLKLSKFKRLVIRNACGFDENGSFNGFPITPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWDVVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAavkldrkpskCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLFANKgstfmerqkqivekvppkrkltidtif
MPQMDCTYSNIRSTSLLIPSRPTLSSAHHLFFPSTLKLSKFKRLVIRNACGFDENGSFNGFPITPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWDVVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLFANKGSTFMERQKQIVEKVPPKRKLTIDTIF
***************LLIP***TLSSAHHLFFPSTLKLSKFKRLVIRNACGFDENGSFNGFPITPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWDVVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLFANKGSTF***********************
***********************************************************GFPITPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWDVVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLF***********************LTIDTIF
MPQMDCTYSNIRSTSLLIPSRPTLSSAHHLFFPSTLKLSKFKRLVIRNACGFDENGSFNGFPITPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWDVVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLFANKGSTFMERQKQIVEKVPPKRKLTIDTIF
******************PSRPTLSSAHHLFFPSTLKLSKFKRLVIRNACGFDENGSFNGFPITPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWDVVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLFANKGSTFMERQKQIVEKVPPKRKLTIDTIF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQMDCTYSNIRSTSLLIPSRPTLSSAHHLFFPSTLKLSKFKRLVIRNACGFDENGSFNGFPITPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWDVVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLFANKGSTFMERQKQIVEKVPPKRKLTIDTIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query361 2.2.26 [Sep-21-2011]
O06995226 Beta-phosphoglucomutase O yes no 0.540 0.862 0.259 2e-06
Q9X0Y1216 Phosphorylated carbohydra yes no 0.504 0.842 0.256 6e-06
P77366219 Beta-phosphoglucomutase O N/A no 0.493 0.812 0.295 2e-05
P44004200 Uncharacterized protein H yes no 0.468 0.845 0.270 0.0001
Q8UEY9233 Phosphoglycolate phosphat yes no 0.432 0.669 0.254 0.0003
P77475188 Fructose-1-phosphate phos N/A no 0.470 0.904 0.270 0.0005
>sp|O06995|PGMB_BACSU Beta-phosphoglucomutase OS=Bacillus subtilis (strain 168) GN=yvdM PE=1 SV=1 Back     alignment and function desciption
 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 95/216 (43%), Gaps = 21/216 (9%)

Query: 121 GLIFSWD-VVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKE 179
            +IF  D V+ DT      AWK +A  E  +IP + D+  ++     +  L  +L++G  
Sbjct: 3   AVIFDLDGVITDTAEYHFLAWKHIA--EQIDIPFDRDMNERLKGISREESLESILIFGGA 60

Query: 180 ESELDRLNSRLTQLY------YDNLLSVTEP---MEGLQEWLDAVSSARIPCAVVSGLDR 230
           E++    N+   +L       Y  L+S   P   + G+   L  + +  I   + S    
Sbjct: 61  ETKY--TNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASS--S 116

Query: 231 RKMVEALERMGLLKYFQAIVSEEDGMESMAHR--FLSAAVKLDRKPSKCVVFEDDPRAIT 288
           R   + L R+ ++  F AIV      +       FL+AA  LD  P+ C   ED    I+
Sbjct: 117 RNAPKILRRLAIIDDFHAIVDPTTLAKGKPDPDIFLTAAAMLDVSPADCAAIEDAEAGIS 176

Query: 289 AAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSV 324
           A  +  M AVG+    +   ++ ADL V   ++L++
Sbjct: 177 AIKSAGMFAVGV---GQGQPMLGADLVVRQTSDLTL 209




Catalyze the interconversion of D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), and forming beta-D-glucose 1,6-(bis)phosphate (beta-G16P) as an intermediate. The beta-phosphoglucomutase (Beta-PGM) acts on the beta-C(1) anomer of G1P. It play a key role in the regulation of the flow of carbohydrate intermediates in glycolysis and the formation of the sugar nucleotide UDP-glucose.
Bacillus subtilis (strain 168) (taxid: 224308)
EC: 5EC: .EC: 4EC: .EC: 2EC: .EC: 6
>sp|Q9X0Y1|P1254_THEMA Phosphorylated carbohydrates phosphatase TM_1254 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1254 PE=1 SV=1 Back     alignment and function description
>sp|P77366|PGMB_ECOLI Beta-phosphoglucomutase OS=Escherichia coli (strain K12) GN=ycjU PE=1 SV=1 Back     alignment and function description
>sp|P44004|Y488_HAEIN Uncharacterized protein HI_0488 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0488 PE=3 SV=1 Back     alignment and function description
>sp|Q8UEY9|GPH_AGRT5 Phosphoglycolate phosphatase OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=gph PE=3 SV=2 Back     alignment and function description
>sp|P77475|YQAB_ECOLI Fructose-1-phosphate phosphatase YqaB OS=Escherichia coli (strain K12) GN=yqaB PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query361
255559643366 2-deoxyglucose-6-phosphate phosphatase, 0.941 0.928 0.794 1e-156
145332024364 haloacid dehalogenase-like hydrolase [Ar 0.986 0.978 0.745 1e-156
18399067365 haloacid dehalogenase-like hydrolase [Ar 0.986 0.975 0.746 1e-155
21592870365 unknown [Arabidopsis thaliana] 0.986 0.975 0.743 1e-155
42572363365 haloacid dehalogenase-like hydrolase [Ar 0.986 0.975 0.746 1e-155
14532506365 AT3g10970/F9F8_21 [Arabidopsis thaliana] 0.986 0.975 0.743 1e-154
297833886365 predicted protein [Arabidopsis lyrata su 0.986 0.975 0.738 1e-153
449457419367 PREDICTED: uncharacterized protein LOC10 0.991 0.975 0.727 1e-152
225448631360 PREDICTED: uncharacterized protein LOC10 0.914 0.916 0.774 1e-150
224145920368 predicted protein [Populus trichocarpa] 0.911 0.894 0.776 1e-147
>gi|255559643|ref|XP_002520841.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] gi|223539972|gb|EEF41550.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/345 (79%), Positives = 297/345 (86%), Gaps = 5/345 (1%)

Query: 22  PTLSSAHHLFFPSTLKLS-KFK---RLVIRNACGFDENGSFNGFPITPNKLFMQEAIGAE 77
           P L  + H  FPS L+ S K K   RL+IRNACGFD NGS NGFPITPNKLFMQE IGAE
Sbjct: 22  PLLCPSTHSLFPSNLRFSHKLKVRYRLLIRNACGFDANGSGNGFPITPNKLFMQETIGAE 81

Query: 78  YGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWD-VVADTRALK 136
           YGEGFETFRQDGPLK+DVDFLNDRLQEGFL RIRYAMKPDEAYGLIFSWD VVAD RA+K
Sbjct: 82  YGEGFETFRQDGPLKIDVDFLNDRLQEGFLHRIRYAMKPDEAYGLIFSWDNVVADARAMK 141

Query: 137 LNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYD 196
           LN WKQLA EEGKEIP++G   + +L AGADHVLHKVL W   ESELDRL  RL+ LYYD
Sbjct: 142 LNVWKQLASEEGKEIPEDGHAHKLMLYAGADHVLHKVLRWETTESELDRLKLRLSHLYYD 201

Query: 197 NLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGM 256
           +LL + EP EGL+EWLDAV+ ARIPCAVVS LDR  MV  LERMGL KYFQAIV+EEDGM
Sbjct: 202 HLLRLREPTEGLKEWLDAVARARIPCAVVSSLDRVNMVGVLERMGLKKYFQAIVAEEDGM 261

Query: 257 ESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAV 316
           ESMAHRFLSAA+KLDRKPSKCVVFEDDPR ITAAHNCTMMAV LIGAH AY+LVQADLAV
Sbjct: 262 ESMAHRFLSAALKLDRKPSKCVVFEDDPRGITAAHNCTMMAVALIGAHPAYELVQADLAV 321

Query: 317 ANFNELSVINLRRLFANKGSTFMERQKQIVEKVPPKRKLTIDTIF 361
           A+FNELSVINLRRLFANKGS+FM+++KQI+EK P KRKLTIDTIF
Sbjct: 322 ASFNELSVINLRRLFANKGSSFMDKEKQIIEKSPSKRKLTIDTIF 366




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|145332024|ref|NP_001078134.1| haloacid dehalogenase-like hydrolase [Arabidopsis thaliana] gi|332641464|gb|AEE74985.1| haloacid dehalogenase-like hydrolase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18399067|ref|NP_566385.1| haloacid dehalogenase-like hydrolase [Arabidopsis thaliana] gi|332641462|gb|AEE74983.1| haloacid dehalogenase-like hydrolase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21592870|gb|AAM64820.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42572363|ref|NP_974277.1| haloacid dehalogenase-like hydrolase [Arabidopsis thaliana] gi|332641463|gb|AEE74984.1| haloacid dehalogenase-like hydrolase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|14532506|gb|AAK63981.1| AT3g10970/F9F8_21 [Arabidopsis thaliana] gi|22137294|gb|AAM91492.1| AT3g10970/F9F8_21 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297833886|ref|XP_002884825.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330665|gb|EFH61084.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449457419|ref|XP_004146446.1| PREDICTED: uncharacterized protein LOC101211766 [Cucumis sativus] gi|449522998|ref|XP_004168512.1| PREDICTED: uncharacterized LOC101211766 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225448631|ref|XP_002274357.1| PREDICTED: uncharacterized protein LOC100262145 [Vitis vinifera] gi|297736518|emb|CBI25389.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145920|ref|XP_002325812.1| predicted protein [Populus trichocarpa] gi|222862687|gb|EEF00194.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query361
TAIR|locus:2085507365 AT3G10970 [Arabidopsis thalian 0.986 0.975 0.746 4.3e-141
TAIR|locus:2123141373 AT4G11570 [Arabidopsis thalian 0.653 0.632 0.293 4.2e-24
TIGR_CMR|DET_0395456 DET_0395 "glycoprotease family 0.545 0.432 0.254 1.8e-09
UNIPROTKB|O06995226 yvdM "Beta-phosphoglucomutase" 0.540 0.862 0.271 2.5e-08
TIGR_CMR|GSU_0184215 GSU_0184 "HAD-superfamily hydr 0.487 0.818 0.259 1.5e-06
UNIPROTKB|P77475188 yqaB [Escherichia coli K-12 (t 0.476 0.914 0.289 1.6e-06
UNIPROTKB|P77366219 ycjU "beta-phosphoglucomutase" 0.493 0.812 0.295 2.2e-06
TIGR_CMR|BA_4427221 BA_4427 "hydrolase, haloacid d 0.457 0.746 0.242 4.9e-05
TIGR_CMR|GSU_1839228 GSU_1839 "hydrolase, haloacid 0.581 0.921 0.252 7.1e-05
UNIPROTKB|Q9KN63219 VC_A0102 "CbbY family protein" 0.465 0.767 0.269 0.00042
TAIR|locus:2085507 AT3G10970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1380 (490.8 bits), Expect = 4.3e-141, P = 4.3e-141
 Identities = 274/367 (74%), Positives = 310/367 (84%)

Query:     4 MDCTYSNIRSTSLLIPSRPTLSSAHHLF-------FPSTLKLSKFKRLVIRNACGFD-EN 55
             MDC+ S  R +SLLI S P+    H  F        P   KL K +RLV+R++ G D +N
Sbjct:     1 MDCSCST-RPSSLLISSEPSFRFPHSNFSSNLSFQIPKDTKLVK-QRLVVRSSSGSDYQN 58

Query:    56 GSFNGFPITPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFLNDRLQEGFLKRIRYAMK 115
             G  NGFP+ PNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDF N++LQ+GFL+RIRYAMK
Sbjct:    59 GDVNGFPLKPNKLFMQEAIGAEYGEGFETFRQDGPLKVDVDFWNEKLQDGFLQRIRYAMK 118

Query:   116 PDEAYGLIFSWD-VVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVL 174
             PDEAYGLIFSWD VVADTR+LKL AWKQLA EEGKEI +E D+ R +L AGADHVL KVL
Sbjct:   119 PDEAYGLIFSWDNVVADTRSLKLEAWKQLAAEEGKEITEEVDIQRLMLYAGADHVLRKVL 178

Query:   175 LWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMV 234
              W K +S++DRL  RL+++YYD+LL +TEP EGL++WLDAV++ARIPCAVVS LDR+ M+
Sbjct:   179 FWEKTQSKIDRLKLRLSEIYYDSLLKLTEPKEGLRDWLDAVTTARIPCAVVSNLDRKNMI 238

Query:   235 EALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCT 294
              ALERMGL KYFQA+VSEEDGMES+AHRFLSAAVKLDRKPSKCVVFEDDPR ITAAHNCT
Sbjct:   239 NALERMGLQKYFQAVVSEEDGMESIAHRFLSAAVKLDRKPSKCVVFEDDPRGITAAHNCT 298

Query:   295 MMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRLFANKGSTFMERQKQIVEKVPPKRK 354
             MMAVGLIGAHRAYDLVQADLAV NF ELSVINLRRLFANKGSTFM+ +KQI+EK PPKRK
Sbjct:   299 MMAVGLIGAHRAYDLVQADLAVGNFYELSVINLRRLFANKGSTFMDHEKQIIEKSPPKRK 358

Query:   355 LTIDTIF 361
             LTIDTIF
Sbjct:   359 LTIDTIF 365




GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016787 "hydrolase activity" evidence=IEA;ISS
TAIR|locus:2123141 AT4G11570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0395 DET_0395 "glycoprotease family protein/hydrolase, beta-phosphoglucomutase family" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|O06995 yvdM "Beta-phosphoglucomutase" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0184 GSU_0184 "HAD-superfamily hydrolase, subfamily IA, variant 1" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P77475 yqaB [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|P77366 ycjU "beta-phosphoglucomutase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4427 BA_4427 "hydrolase, haloacid dehalogenase-like family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1839 GSU_1839 "hydrolase, haloacid dehalogenase-like family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KN63 VC_A0102 "CbbY family protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
PLN02575381 PLN02575, PLN02575, haloacid dehalogenase-like hyd 9e-30
COG0637221 COG0637, COG0637, Predicted phosphatase/phosphohex 3e-27
PLN03243260 PLN03243, PLN03243, haloacid dehalogenase-like hyd 2e-25
TIGR02009185 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase f 5e-17
TIGR01990185 TIGR01990, bPGM, beta-phosphoglucomutase 4e-13
pfam13419176 pfam13419, HAD_2, Haloacid dehalogenase-like hydro 9e-13
COG0546220 COG0546, Gph, Predicted phosphatases [General func 3e-12
PRK10725188 PRK10725, PRK10725, fructose-1-P/6-phosphogluconat 3e-08
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 2e-07
PRK13222226 PRK13222, PRK13222, phosphoglycolate phosphatase; 4e-07
TIGR01449213 TIGR01449, PGP_bact, 2-phosphoglycolate phosphatas 1e-06
TIGR01509177 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase sup 2e-06
COG1011229 COG1011, COG1011, Predicted hydrolase (HAD superfa 1e-05
PRK10826222 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; 4e-05
PLN02940 382 PLN02940, PLN02940, riboflavin kinase 5e-05
pfam1324274 pfam13242, Hydrolase_like, HAD-hyrolase-like 1e-04
PLN02811220 PLN02811, PLN02811, hydrolase 0.001
PLN02919 1057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 0.001
TIGR02252203 TIGR02252, DREG-2, REG-2-like, HAD superfamily (su 0.002
TIGR02253221 TIGR02253, CTE7, HAD superfamily (subfamily IA) hy 0.004
>gnl|CDD|215313 PLN02575, PLN02575, haloacid dehalogenase-like hydrolase Back     alignment and domain information
 Score =  117 bits (294), Expect = 9e-30
 Identities = 67/219 (30%), Positives = 115/219 (52%), Gaps = 15/219 (6%)

Query: 121 GLIFSWD--VVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGK 178
           G IF W+  ++ D   L+  AW  LA EEGK  P    +LR++     +  + +VL W +
Sbjct: 133 GAIFEWEGVIIEDNPDLENQAWLTLAQEEGKSPP-PAFILRRVEGMKNEQAISEVLCWSR 191

Query: 179 EESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALE 238
           + +EL R+ +R  ++Y      +     G QE+++ + + +IP A+VS   R+ +  A+ 
Sbjct: 192 DPAELRRMATRKEEIYQALQGGIYRLRTGSQEFVNVLMNYKIPMALVSTRPRKTLENAIG 251

Query: 239 RMGLLKYFQAIVSEEDGMESMAHR-------FLSAAVKLDRKPSKCVVFEDDPRAITAAH 291
            +G+  +F  IV+ ED      +R       F+ AA  L+  P +C+VF +  + + AAH
Sbjct: 252 SIGIRGFFSVIVAAED-----VYRGKPDPEMFIYAAQLLNFIPERCIVFGNSNQTVEAAH 306

Query: 292 NCTMMAVGLIGAHRAYDLVQADLAVANFNELSVINLRRL 330
           +  M  V +   H  Y+L  ADL V   +ELS+++L+ L
Sbjct: 307 DARMKCVAVASKHPIYELGAADLVVRRLDELSIVDLKNL 345


Length = 381

>gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>gnl|CDD|215644 PLN03243, PLN03243, haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|213673 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>gnl|CDD|213672 TIGR01990, bPGM, beta-phosphoglucomutase Back     alignment and domain information
>gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|182679 PRK10725, PRK10725, fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|237310 PRK13222, PRK13222, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|130516 TIGR01449, PGP_bact, 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>gnl|CDD|233443 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|236770 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|178528 PLN02940, PLN02940, riboflavin kinase Back     alignment and domain information
>gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like Back     alignment and domain information
>gnl|CDD|178407 PLN02811, PLN02811, hydrolase Back     alignment and domain information
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|200170 TIGR02252, DREG-2, REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 361
PLN02575381 haloacid dehalogenase-like hydrolase 100.0
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.97
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.97
PRK13288214 pyrophosphatase PpaX; Provisional 99.96
PRK13226229 phosphoglycolate phosphatase; Provisional 99.96
COG0546220 Gph Predicted phosphatases [General function predi 99.96
PRK13225273 phosphoglycolate phosphatase; Provisional 99.96
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.96
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.96
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.96
PRK13222226 phosphoglycolate phosphatase; Provisional 99.96
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.96
PRK11587218 putative phosphatase; Provisional 99.96
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.95
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.95
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.95
PRK13223272 phosphoglycolate phosphatase; Provisional 99.95
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.94
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.94
PLN02940 382 riboflavin kinase 99.94
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.94
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.93
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.93
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.93
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.93
PRK09449224 dUMP phosphatase; Provisional 99.93
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.93
PRK14988224 GMP/IMP nucleotidase; Provisional 99.91
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.91
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.91
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.9
PLN02811220 hydrolase 99.9
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.89
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.89
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.88
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.88
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.87
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.87
PHA02597197 30.2 hypothetical protein; Provisional 99.87
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.86
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.86
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.86
PRK11133322 serB phosphoserine phosphatase; Provisional 99.85
PLN02954224 phosphoserine phosphatase 99.84
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.83
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 99.82
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.81
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.78
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.77
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 99.77
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.76
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.76
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 99.75
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.73
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.72
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.7
PRK06769173 hypothetical protein; Validated 99.7
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.68
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.68
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 99.65
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.64
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 99.63
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.62
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 99.6
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.56
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 99.56
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.55
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.55
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 99.55
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 99.54
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.54
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 99.49
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 99.48
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.46
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 99.45
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 99.45
PRK11590211 hypothetical protein; Provisional 99.43
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.42
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.4
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.37
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 99.35
PHA02530300 pseT polynucleotide kinase; Provisional 99.35
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 99.32
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 99.31
PLN02645311 phosphoglycolate phosphatase 99.31
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 99.3
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.26
PRK10444248 UMP phosphatase; Provisional 99.26
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 99.22
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 99.22
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.2
PRK08238 479 hypothetical protein; Validated 99.18
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 99.16
PRK01158230 phosphoglycolate phosphatase; Provisional 99.06
COG4229229 Predicted enolase-phosphatase [Energy production a 99.04
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 99.03
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 99.03
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 99.03
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 99.01
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 99.01
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 99.0
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 98.97
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 98.95
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 98.93
COG0647269 NagD Predicted sugar phosphatases of the HAD super 98.92
COG0241181 HisB Histidinol phosphatase and related phosphatas 98.92
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.91
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 98.9
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 98.88
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 98.87
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.86
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 98.8
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 98.8
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 98.78
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 98.76
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 98.73
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 98.73
PRK10671834 copA copper exporting ATPase; Provisional 98.73
PRK10513270 sugar phosphate phosphatase; Provisional 98.71
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.7
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 98.69
COG4087152 Soluble P-type ATPase [General function prediction 98.67
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 98.67
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 98.67
PLN02887580 hydrolase family protein 98.67
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.56
PTZ00445219 p36-lilke protein; Provisional 98.56
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 98.56
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.54
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 98.52
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 98.49
COG4359220 Uncharacterized conserved protein [Function unknow 98.42
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 98.4
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 98.38
PRK14010673 potassium-transporting ATPase subunit B; Provision 98.34
PHA03398303 viral phosphatase superfamily protein; Provisional 98.29
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 98.29
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 98.26
TIGR01675229 plant-AP plant acid phosphatase. This model explic 98.24
PRK01122679 potassium-transporting ATPase subunit B; Provision 98.21
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 98.19
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 98.17
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 98.13
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 98.11
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 98.1
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 98.09
KOG2630254 consensus Enolase-phosphatase E-1 [Amino acid tran 98.09
PRK10976266 putative hydrolase; Provisional 98.01
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 97.99
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 97.97
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 97.96
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 97.93
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 97.93
PRK15122 903 magnesium-transporting ATPase; Provisional 97.91
PF05761448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 97.87
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 97.83
COG2503274 Predicted secreted acid phosphatase [General funct 97.78
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 97.75
PLN02645 311 phosphoglycolate phosphatase 97.73
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 97.68
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 97.65
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 97.65
PLN03190 1178 aminophospholipid translocase; Provisional 97.63
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 97.63
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 97.59
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 97.58
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 97.55
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 97.54
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 97.53
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 97.41
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 97.41
TIGR01658274 EYA-cons_domain eyes absent protein conserved doma 97.4
COG3700237 AphA Acid phosphatase (class B) [General function 97.36
PLN02177 497 glycerol-3-phosphate acyltransferase 97.34
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 97.27
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 97.24
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 97.24
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.23
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 97.22
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 97.14
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 97.1
COG4996164 Predicted phosphatase [General function prediction 97.06
COG4030315 Uncharacterized protein conserved in archaea [Func 97.06
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 96.96
KOG0206 1151 consensus P-type ATPase [General function predicti 96.81
PLN02382 413 probable sucrose-phosphatase 96.75
KOG2470510 consensus Similar to IMP-GMP specific 5'-nucleotid 96.74
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 96.7
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 96.68
COG2216681 KdpB High-affinity K+ transport system, ATPase cha 96.59
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 96.58
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 96.58
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 96.3
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 96.28
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 95.89
COG4502180 5'(3')-deoxyribonucleotidase [Nucleotide transport 95.67
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 95.61
KOG0210 1051 consensus P-type ATPase [Inorganic ion transport a 95.31
PRK10976266 putative hydrolase; Provisional 95.3
COG5610 635 Predicted hydrolase (HAD superfamily) [General fun 95.16
KOG3107468 consensus Predicted haloacid dehalogenase-like hyd 95.16
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 94.99
KOG0204 1034 consensus Calcium transporting ATPase [Inorganic i 93.89
PTZ00174247 phosphomannomutase; Provisional 93.83
COG5663194 Uncharacterized conserved protein [Function unknow 93.82
PRK10444248 UMP phosphatase; Provisional 93.69
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 93.41
PTZ00174247 phosphomannomutase; Provisional 92.96
PLN02580384 trehalose-phosphatase 92.64
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 92.25
PLN02423245 phosphomannomutase 91.72
KOG0203 1019 consensus Na+/K+ ATPase, alpha subunit [Inorganic 91.66
KOG3128298 consensus Uncharacterized conserved protein [Funct 91.41
PLN02499 498 glycerol-3-phosphate acyltransferase 91.28
PF05822246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 89.06
KOG2882 306 consensus p-Nitrophenyl phosphatase [Inorganic ion 88.85
KOG0209 1160 consensus P-type ATPase [Inorganic ion transport a 88.35
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 87.48
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 85.99
PRK10513270 sugar phosphate phosphatase; Provisional 85.71
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 85.29
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 85.2
KOG4549144 consensus Magnesium-dependent phosphatase [General 83.83
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 82.61
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 82.6
KOG2469424 consensus IMP-GMP specific 5'-nucleotidase [Nucleo 81.84
PRK01158230 phosphoglycolate phosphatase; Provisional 81.8
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 80.78
KOG2116738 consensus Protein involved in plasmid maintenance/ 80.48
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 80.15
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
Probab=100.00  E-value=2.9e-31  Score=256.08  Aligned_cols=244  Identities=29%  Similarity=0.498  Sum_probs=203.0

Q ss_pred             CCcccchhhhHHHHHHhHHHHHhhhcCCCCceEEEEece-eccccHH-HHHHHHHHHHHHhCCCCCchHHHHHHHhcCCH
Q 018088           89 GPLKVDVDFLNDRLQEGFLKRIRYAMKPDEAYGLIFSWD-VVADTRA-LKLNAWKQLAFEEGKEIPQEGDVLRQILNAGA  166 (361)
Q Consensus        89 g~l~~dv~~~~~~~~~~~~~rir~~m~~~~~k~VIFDlD-TL~ds~~-~~~~a~~~~l~~~G~~~~~~~~~~~~~~g~~~  166 (361)
                      ...+.|.+.+.+-+-  ..+||     ...+++|||||| ||+|+.. .+..+|.++++++|++.+.. .....+.|.+.
T Consensus       108 ~~~~~~~~~~~~~~~--~~~~~-----~~~~~~VIFDlDGTLIDS~~~i~~~a~~~l~~e~G~~~~~~-e~~~~~~G~~~  179 (381)
T PLN02575        108 PENRADNPSLHNPLL--RQERM-----GCGWLGAIFEWEGVIIEDNPDLENQAWLTLAQEEGKSPPPA-FILRRVEGMKN  179 (381)
T ss_pred             CCCccccccccCHHH--HHHhc-----cCCCCEEEEcCcCcceeCHHHHHHHHHHHHHHHcCCCCCHH-HHHHHhcCCCH
Confidence            345566665555331  13342     234899999999 9999987 66689999999999876543 34456778888


Q ss_pred             HHHHHHHHccCCChHHHHHHHHHHHHHHHHhcccCCCCCccHHHHHHHHhhCCCcEEEEeCCCHHHHHHHHHhCCCCccc
Q 018088          167 DHVLHKVLLWGKEESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYF  246 (361)
Q Consensus       167 ~~~l~~~l~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~pgv~elL~~L~~~Gi~vaivSn~~~~~~~~~L~~lgl~~~F  246 (361)
                      ...+..++.+..+...++.+...+.+.|.+.......++||+.++|+.|+++|++++|+||+.+..+...++.+|+..||
T Consensus       180 ~~~l~~ll~~~~~~~~~e~l~~~~~~~y~~~~~~~~~l~pGa~ElL~~Lk~~GiklaIaSn~~~~~~~~~L~~lgL~~yF  259 (381)
T PLN02575        180 EQAISEVLCWSRDPAELRRMATRKEEIYQALQGGIYRLRTGSQEFVNVLMNYKIPMALVSTRPRKTLENAIGSIGIRGFF  259 (381)
T ss_pred             HHHHHHHhhccCCHHHHHHHHHHHHHHHHHHhccCCCcCcCHHHHHHHHHHCCCeEEEEeCCCHHHHHHHHHHcCCHHHc
Confidence            88888877665566667777777788777766556688999999999999999999999999999999999999999999


Q ss_pred             ceeEecCCCCCCC--hHHHHHHHHHcCCCCCcEEEEcCChHHHHHHHHcCCeEEEEeCCCCcccccCcceEeCChhhhHH
Q 018088          247 QAIVSEEDGMESM--AHRFLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAYDLVQADLAVANFNELSV  324 (361)
Q Consensus       247 d~iv~~e~~~~~K--P~~~~~~~~klgi~p~~~v~IGDs~~Di~aA~~aG~~~v~V~g~~~~~~l~~ad~vi~sl~EL~~  324 (361)
                      +.+++++++...|  |++|..+++++|+.|++|+||||+..|+++|+++||.+|+|.+.+.......+|++++++.||..
T Consensus       260 d~Iv~sddv~~~KP~Peifl~A~~~lgl~Peecl~IGDS~~DIeAAk~AGm~~IgV~~~~~~~~l~~Ad~iI~s~~EL~~  339 (381)
T PLN02575        260 SVIVAAEDVYRGKPDPEMFIYAAQLLNFIPERCIVFGNSNQTVEAAHDARMKCVAVASKHPIYELGAADLVVRRLDELSI  339 (381)
T ss_pred             eEEEecCcCCCCCCCHHHHHHHHHHcCCCcccEEEEcCCHHHHHHHHHcCCEEEEECCCCChhHhcCCCEEECCHHHHHH
Confidence            9999999976555  67999999999999999999999999999999999999999655555555679999999999999


Q ss_pred             HHHHhhHhcCCCChhh
Q 018088          325 INLRRLFANKGSTFME  340 (361)
Q Consensus       325 ~ll~~l~~~~~~~~~~  340 (361)
                      ..++.+++..++||=-
T Consensus       340 ~~l~~l~~~~~~~~~~  355 (381)
T PLN02575        340 VDLKNLADIESPEFGP  355 (381)
T ss_pred             HHHhhhhhcCccccCC
Confidence            9999999999999833



>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01658 EYA-cons_domain eyes absent protein conserved domain Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>KOG0206 consensus P-type ATPase [General function prediction only] Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG3107 consensus Predicted haloacid dehalogenase-like hydrolase (eyes absent) [General function prediction only] Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3128 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG2469 consensus IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
4g9b_A243 Crystal Structure Of Beta-Phosphoglucomutase Homolo 9e-07
3nas_A233 The Crystal Structure Of Beta-Phosphoglucomutase Fr 2e-06
3kbb_A216 Crystal Structure Of Putative Beta-Phosphoglucomuta 5e-06
4gib_A250 2.27 Angstrom Crystal Structure Of Beta-Phosphogluc 3e-05
>pdb|4G9B|A Chain A, Crystal Structure Of Beta-Phosphoglucomutase Homolog From Escherichia Coli, Target Efi-501172, With Bound Mg, Open Lid Length = 243 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 57/193 (29%), Positives = 87/193 (45%), Gaps = 15/193 (7%) Query: 121 GLIFSWD-VVADTRALKLNAWKQLAFEEGKEI-PQEGDVLRQILNAGADHVLHKVLLWGK 178 G+IF D V+ DT L AW+Q+A E G I Q + L+ I D L ++L G Sbjct: 7 GVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGI---SRDESLRRILQHGG 63 Query: 179 EESELD-----RLNSRLTQLYYDNL--LSVTEPMEGLQEWLDAVSSARIPCAVVS-GLDR 230 +E + + +L R LY +L L+V + G++ L + + +I + S L+ Sbjct: 64 KEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNA 123 Query: 231 RKMVEALERMGLLKYFQAIVSEEDGMESMAHRFLSAAVKLDRKPSKCVVFEDDPRAITAA 290 ++ ALE F A S+ + FL+A L P C+ ED I A Sbjct: 124 PTILAALELREFFT-FCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAI 182 Query: 291 HNCTMMAVGLIGA 303 + M +VG IGA Sbjct: 183 NASGMRSVG-IGA 194
>pdb|3NAS|A Chain A, The Crystal Structure Of Beta-Phosphoglucomutase From Bacillus Subtilis Length = 233 Back     alignment and structure
>pdb|3KBB|A Chain A, Crystal Structure Of Putative Beta-Phosphoglucomutase From Thermotoga Maritima Length = 216 Back     alignment and structure
>pdb|4GIB|A Chain A, 2.27 Angstrom Crystal Structure Of Beta-Phosphoglucomutase (Pgmb) From Clostridium Difficile Length = 250 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 2e-30
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 1e-29
1te2_A226 Putative phosphatase; structural genomics, phospha 2e-28
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 5e-28
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 7e-28
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 2e-27
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 7e-27
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 2e-24
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 4e-24
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 4e-24
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 1e-23
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 2e-22
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 2e-21
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 4e-20
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 4e-16
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 3e-13
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 3e-12
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 5e-12
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 3e-11
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 5e-11
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 9e-11
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 1e-10
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 1e-10
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 2e-10
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 3e-10
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 2e-09
2hsz_A243 Novel predicted phosphatase; structural genomics, 2e-09
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 3e-08
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 2e-07
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 3e-07
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 5e-07
3ib6_A189 Uncharacterized protein; structural genomics, unkn 7e-07
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 7e-07
2zg6_A220 Putative uncharacterized protein ST2620, probable 9e-07
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 1e-06
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 2e-06
3sd7_A240 Putative phosphatase; structural genomics, haloaci 2e-06
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 3e-06
2p11_A231 Hypothetical protein; putative haloacid dehalogena 6e-06
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 6e-06
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 1e-05
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 2e-05
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 6e-05
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 9e-05
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 3e-04
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 Back     alignment and structure
 Score =  115 bits (289), Expect = 2e-30
 Identities = 44/221 (19%), Positives = 86/221 (38%), Gaps = 20/221 (9%)

Query: 114 MKPDEAYGLIFSWD-VVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHK 172
           ++P  +   IF  D  + D+    + AWK+    E   +     + R+I  +G   +   
Sbjct: 3   LRPQTS--FIFDLDGTLTDSVYQNVAAWKEALDAENIPLAMW-RIHRKIGMSGGLMLKSL 59

Query: 173 VLLWGKE--ESELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDR 230
               G    + + +RL+ +  Q  Y+ L      + G  E L+ +    +   + +    
Sbjct: 60  SRETGMSITDEQAERLSEKHAQ-AYERLQHQIIALPGAVELLETLDKENLKWCIATSGGI 118

Query: 231 RKMVEALERMGLLKYFQAIVSEEDGMESMAHR------FLSAAVKLDRKPSKCVVFEDDP 284
                 L+ + L      IV+ +D    +++       FL+AA K+     +C+V  D  
Sbjct: 119 DTATINLKALKLDINKINIVTRDD----VSYGKPDPDLFLAAAKKIGAPIDECLVIGDAI 174

Query: 285 RAITAAHNCTMMAVGLI-GAHRAYDLVQ--ADLAVANFNEL 322
             + AA  C    VGL+ G +   +L +  A     +  +L
Sbjct: 175 WDMLAARRCKATGVGLLSGGYDIGELERAGALRVYEDPLDL 215


>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Length = 229 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} Length = 277 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Length = 275 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Length = 250 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Length = 267 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Length = 209 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Length = 234 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Length = 196 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Length = 222 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Length = 243 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Length = 260 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} Length = 240 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 210 Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Length = 251 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Length = 240 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Length = 240 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Length = 231 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Length = 261 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Length = 238 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Length = 240 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Length = 234 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Length = 200 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query361
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.97
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.97
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.96
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.96
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.96
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.96
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.96
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.96
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.95
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.95
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.95
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.95
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.95
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.95
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.95
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.95
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.95
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.95
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.95
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.94
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.94
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.94
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.94
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.94
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.93
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.93
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.93
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.93
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.93
1te2_A226 Putative phosphatase; structural genomics, phospha 99.93
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.93
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.93
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.92
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.92
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.92
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.92
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.92
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.91
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.91
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.91
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.91
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.91
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.91
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.91
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.9
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.9
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.9
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.9
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.89
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.89
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.89
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.89
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.89
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.89
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.87
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.87
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.87
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.87
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.86
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.86
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.86
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.85
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.85
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.85
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.84
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.83
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.83
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.82
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.82
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.81
3fvv_A232 Uncharacterized protein; unknown function, structu 99.81
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.81
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.81
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.8
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.79
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.79
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.78
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.78
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 99.78
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.77
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.75
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.75
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.73
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.73
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 99.57
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.72
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.72
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.71
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.7
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.7
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 99.7
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.69
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.69
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 99.68
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.68
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.68
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.67
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.66
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.66
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.63
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.63
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.6
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.59
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.59
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.57
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.56
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.55
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.54
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 99.53
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.5
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 99.47
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.46
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.45
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.43
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.42
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.42
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.41
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 99.4
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 99.39
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.37
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.34
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.33
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 99.28
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.24
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 99.24
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.22
1y8a_A332 Hypothetical protein AF1437; structural genomics, 99.18
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 99.13
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 99.08
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 99.07
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 99.05
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 99.01
2jc9_A 555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 98.97
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 98.93
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 98.91
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 98.86
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 98.83
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 98.78
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 98.77
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 98.72
4gxt_A385 A conserved functionally unknown protein; structur 98.68
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 98.61
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 98.47
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 98.44
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 98.15
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 98.12
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 98.07
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 98.0
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 97.8
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 97.79
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 97.74
4g63_A470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 97.73
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 97.64
2hx1_A 284 Predicted sugar phosphatases of the HAD superfamil 97.46
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 97.25
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 97.16
3geb_A274 EYES absent homolog 2; hydrolase, activator, alter 96.97
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 96.88
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 96.7
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 96.53
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 96.32
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 95.91
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 95.75
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 94.92
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 94.66
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 94.48
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 94.38
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 93.22
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 92.19
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 90.19
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 87.08
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 84.74
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 82.48
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 81.25
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=99.97  E-value=1.1e-29  Score=226.22  Aligned_cols=209  Identities=23%  Similarity=0.316  Sum_probs=165.7

Q ss_pred             ceEEEEece-eccccHHHHHHHHHHHHHHhCCCCCchHHHHHHHhcCCHHHHHHHHHccCCChHHHHHHHHHHHHHHHHh
Q 018088          119 AYGLIFSWD-VVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEESELDRLNSRLTQLYYDN  197 (361)
Q Consensus       119 ~k~VIFDlD-TL~ds~~~~~~a~~~~l~~~G~~~~~~~~~~~~~~g~~~~~~l~~~l~~~~~~~~~~~l~~~~~~~~~~~  197 (361)
                      +|+||||+| ||+|+...+.++|.++++++|++.+.  .....+.+......+.............+.+...+.+.+...
T Consensus         1 IkAViFD~DGTL~ds~~~~~~a~~~~~~~~g~~~~~--~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   78 (216)
T 3kbb_A            1 MEAVIFDMDGVLMDTEPLYFEAYRRVAESYGKPYTE--DLHRRIMGVPEREGLPILMEALEIKDSLENFKKRVHEEKKRV   78 (216)
T ss_dssp             CCEEEEESBTTTBCCGGGHHHHHHHHHHHTTCCCCH--HHHHHHTTSCHHHHHHHHHHHTTCCSCHHHHHHHHHHHHHHH
T ss_pred             CeEEEECCCCcccCCHHHHHHHHHHHHHHcCCCCCH--HHHHHHhccchhhhhhhhhhcccchhhHHHHHHHHHHHHHHH
Confidence            589999999 99999999999999999999987654  355667777777666655444333333344444444444444


Q ss_pred             cccCCCCCccHHHHHHHHhhCCCcEEEEeCCCHHHHHHHHHhCCCCcccceeEecCCCCCCC--hHHHHHHHHHcCCCCC
Q 018088          198 LLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESM--AHRFLSAAVKLDRKPS  275 (361)
Q Consensus       198 l~~~~~~~pgv~elL~~L~~~Gi~vaivSn~~~~~~~~~L~~lgl~~~Fd~iv~~e~~~~~K--P~~~~~~~~klgi~p~  275 (361)
                      ......++||+.++|+.|++.|++++++||+.+..+...++.+|+.++||.++++++++.+|  |++|..+++++|++|+
T Consensus        79 ~~~~~~~~pg~~~~l~~L~~~g~~~~i~tn~~~~~~~~~l~~~~l~~~fd~~~~~~~~~~~KP~p~~~~~a~~~lg~~p~  158 (216)
T 3kbb_A           79 FSELLKENPGVREALEFVKSKRIKLALATSTPQREALERLRRLDLEKYFDVMVFGDQVKNGKPDPEIYLLVLERLNVVPE  158 (216)
T ss_dssp             HHHHCCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHTTCGGGCSEEECGGGSSSCTTSTHHHHHHHHHHTCCGG
T ss_pred             HHHhcccCccHHHHHHHHHHcCCCcccccCCcHHHHHHHHHhcCCCccccccccccccCCCcccHHHHHHHHHhhCCCcc
Confidence            44455789999999999999999999999999999999999999999999999999987776  5799999999999999


Q ss_pred             cEEEEcCChHHHHHHHHcCCeEEE-E-eCCCCcccccC-cceEeCChhhhHHHHHHh
Q 018088          276 KCVVFEDDPRAITAAHNCTMMAVG-L-IGAHRAYDLVQ-ADLAVANFNELSVINLRR  329 (361)
Q Consensus       276 ~~v~IGDs~~Di~aA~~aG~~~v~-V-~g~~~~~~l~~-ad~vi~sl~EL~~~ll~~  329 (361)
                      +|+||||+.+|+.+|+++||.+|+ | +|.+....+.. ....+.+.+|+...+.+.
T Consensus       159 e~l~VgDs~~Di~aA~~aG~~~i~~v~~g~~~~~~l~~~~~~~i~~~~eli~~l~eL  215 (216)
T 3kbb_A          159 KVVVFEDSKSGVEAAKSAGIERIYGVVHSLNDGKALLEAGAVALVKPEEILNVLKEV  215 (216)
T ss_dssp             GEEEEECSHHHHHHHHHTTCCCEEEECCSSSCCHHHHHTTCSEEECGGGHHHHHHHH
T ss_pred             ceEEEecCHHHHHHHHHcCCcEEEEecCCCCCHHHHHhCCCcEECCHHHHHHHHHHH
Confidence            999999999999999999999985 5 44444444432 233455788887765543



>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 361
d1te2a_218 c.108.1.6 (A:) Phosphatase YniC {Escherichia coli 1e-10
d1o08a_221 c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcu 2e-10
d1zs9a1253 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien 4e-09
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 5e-09
d1cr6a1222 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal 1e-08
d1zd3a1225 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal 3e-08
d1swva_257 c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Ba 3e-08
d2hsza1224 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase G 7e-07
d2ah5a1210 c.108.1.6 (A:1-210) predicted phosphatase SP0104 { 4e-06
d2go7a1204 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S 7e-06
d2fdra1222 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 { 9e-06
d2b0ca1197 c.108.1.2 (A:8-204) Putative phosphatase YihX {Esc 3e-05
d1qq5a_245 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan 0.001
d2fi1a1187 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str 0.002
d1zrna_220 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pse 0.003
d2hdoa1207 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase { 0.004
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Phosphatase YniC
species: Escherichia coli [TaxId: 562]
 Score = 58.3 bits (139), Expect = 1e-10
 Identities = 38/211 (18%), Positives = 72/211 (34%), Gaps = 5/211 (2%)

Query: 122 LIFSWD-VVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLWGKEE 180
            IF  D ++ D+  L   A   +    G +I +  ++   +       V           
Sbjct: 6   AIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNG 65

Query: 181 SELDRLNSRLTQLYYDNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERM 240
                +  R+       +      + G++E +       +   + S      + + L   
Sbjct: 66  PSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMF 125

Query: 241 GLLKYFQAIVSEEDGMESMAHR--FLSAAVKLDRKPSKCVVFEDDPRAITAAHNCTMMAV 298
            L   F A+ S E    S  H   +L  A KL   P  CV  ED    + A+    M ++
Sbjct: 126 DLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSI 185

Query: 299 GLIGAHRAYDL--VQADLAVANFNELSVINL 327
            +       D   V A++ +++  EL+  +L
Sbjct: 186 VVPAPEAQNDPRFVLANVKLSSLTELTAKDL 216


>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Length = 221 Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Length = 257 Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Length = 224 Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Length = 210 Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Length = 222 Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Length = 197 Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Length = 220 Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Length = 207 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query361
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.97
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.96
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.96
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.96
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.95
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.95
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.94
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.94
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.94
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.93
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.93
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.91
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.9
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.9
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.87
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.81
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.81
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.81
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.79
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.77
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.77
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.75
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.73
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.68
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.67
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 99.64
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.59
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.59
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.5
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 99.5
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.49
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.48
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 99.4
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.19
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.11
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.08
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.05
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 98.94
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 98.91
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 98.85
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 98.77
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 98.76
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.72
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 98.7
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.6
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 98.52
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 98.4
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 98.32
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.23
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 98.04
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 97.94
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 97.73
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 97.57
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 96.3
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 96.06
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 95.68
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 95.68
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 93.07
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 86.46
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Phosphatase YniC
species: Escherichia coli [TaxId: 562]
Probab=99.97  E-value=2.3e-30  Score=229.30  Aligned_cols=205  Identities=18%  Similarity=0.221  Sum_probs=162.4

Q ss_pred             CceEEEEece-eccccHHHHHHHHHHHHHHhCCCCCchHHHHHHHhcCCHHHHHHHHHcc-CCChHHHHHHHHHHHHHHH
Q 018088          118 EAYGLIFSWD-VVADTRALKLNAWKQLAFEEGKEIPQEGDVLRQILNAGADHVLHKVLLW-GKEESELDRLNSRLTQLYY  195 (361)
Q Consensus       118 ~~k~VIFDlD-TL~ds~~~~~~a~~~~l~~~G~~~~~~~~~~~~~~g~~~~~~l~~~l~~-~~~~~~~~~l~~~~~~~~~  195 (361)
                      .+++||||+| ||+|++..+.++|.++++++|++.+....+ ..+.+......+...... ...............+.+.
T Consensus         2 ~i~a~iFD~DGTL~dt~~~~~~a~~~~~~~~g~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (218)
T d1te2a_           2 QILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNEL-PDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAI   80 (218)
T ss_dssp             CCCEEEECCBTTTBCCHHHHHHHHHHHHHHTTCCGGGGGGS-CCCTTCCHHHHHHHHHHHSCCSSSCHHHHHHHHHHHHH
T ss_pred             cceEEEECCCCcccCCHHHHHHHHHHHHHHcCCCCCHHHHH-HHHhCCCccchhhhhhhcccccchhHHHHHHHHHHHHH
Confidence            4899999999 999999999999999999999876544322 233455555544443322 2222223334444444444


Q ss_pred             HhcccCCCCCccHHHHHHHHhhCCCcEEEEeCCCHHHHHHHHHhCCCCcccceeEecCCCCCCCh--HHHHHHHHHcCCC
Q 018088          196 DNLLSVTEPMEGLQEWLDAVSSARIPCAVVSGLDRRKMVEALERMGLLKYFQAIVSEEDGMESMA--HRFLSAAVKLDRK  273 (361)
Q Consensus       196 ~~l~~~~~~~pgv~elL~~L~~~Gi~vaivSn~~~~~~~~~L~~lgl~~~Fd~iv~~e~~~~~KP--~~~~~~~~klgi~  273 (361)
                      +.......++||+.++|+.|+++|++++|+||+.+..+...++.+|+.++|+.++++++++.+||  ++|..+++++|++
T Consensus        81 ~~~~~~~~~~pg~~~~l~~L~~~g~~~~i~T~~~~~~~~~~l~~~~l~~~F~~i~~~~~~~~~Kp~~~~~~~~~~~l~~~  160 (218)
T d1te2a_          81 SLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVD  160 (218)
T ss_dssp             HHHHHHCCBCTTHHHHHHHHHHTTCEEEEEESSCHHHHHHHHHHTTCGGGCSEEEECTTSSCCTTSTHHHHHHHHHHTSC
T ss_pred             HhhhccccccchHHHHHHHhhhccccccccccccccccccccccccccccccccccccccccchhhHHHHHHHHHHcCCC
Confidence            44444457799999999999999999999999999999999999999999999999999877775  7999999999999


Q ss_pred             CCcEEEEcCChHHHHHHHHcCCeEEEEeCCCCcc--cccCcceEeCChhhhH
Q 018088          274 PSKCVVFEDDPRAITAAHNCTMMAVGLIGAHRAY--DLVQADLAVANFNELS  323 (361)
Q Consensus       274 p~~~v~IGDs~~Di~aA~~aG~~~v~V~g~~~~~--~l~~ad~vi~sl~EL~  323 (361)
                      |++|++|||+.+|+.+|+++|+.+|+|.+.....  ....||++++++.||.
T Consensus       161 ~~~~l~igD~~~di~aA~~~G~~~i~v~~~~~~~~~~~~~a~~~i~~l~el~  212 (218)
T d1te2a_         161 PLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELT  212 (218)
T ss_dssp             GGGEEEEESSHHHHHHHHHTTCEEEECCCTTTTTCGGGGGSSEECSCGGGCC
T ss_pred             chhcEEEeeCHHHHHHHHHcCCEEEEECCCCCccchhhcCCCEEECChhhCC
Confidence            9999999999999999999999999995543322  2357999999999985



>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure