Citrus Sinensis ID: 018151

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MGPHEPYWQTNTSFSPPPSRWDFRFQSEGLPYGSNDGFHFYGSSTSSNSKESKSGVRGNLPYNNQNSASDSAGLFLSSSSDLSQGPQWTPPAIQEITIDGYETPTRRDPVSTQFSFTPAIEGTSANPYSRGSTSSRSDSKDDTSTPQWEAHRWSSASSSVDFADVSEPFESESFGQSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRNRVKKNLSLKGNSSKEFPGKLRKTGACSSQLFNGKTIDPVVGCAKTTAGPSMRR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccHHHHHccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccEEEEccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccHccccccccEEEEEEccccccHHHHHHcccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccHHHHHHHHHHcccccccccccccccccEEccccccEcccccccccccccccccccccccc
mgphepywqtntsfspppsrwdfrfqseglpygsndgfhfygsstssnskesksgvrgnlpynnqnsasdsaglflssssdlsqgpqwtppaiqeitidgyetptrrdpvstqfsftpaiegtsanpysrgstssrsdskddtstpqweahrwssasssvdfadvsepfesesfgqsyvpsdtfkcglcerflsqrspwssrrivrsgdmpvvgVLSCRHvfhaecleqttpktqksdpscpiclrlqeenspdqqVFSRLknsfprlrqscdngqsrpwgcpqaggcvegashvpprntvLLLNRNRVKKnlslkgnsskefpgklrktgacssqlfngktidpvvgcakttagpsmrr
mgphepywqtntsfspppsRWDFRFQSEGLPYGSNDGFHFYGSSTSSNSKESKSGVRGNLPYNNQNSASDSAGLFLSSSSDLSQGPQWTPPAIQEITIDGYETPTRRDPVSTQFSftpaiegtsanpysrgstssrsdskddtstpqweahrwssasssVDFADVSEPFESESFGQSYVPSDTFKCGLCERFlsqrspwssrrivrsgdMPVVGVLSCRHVFHAEcleqttpktqksdpsCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRNRVkknlslkgnsskefpgklrktgacssqlfngktidpvvgcakttagpsmrr
MGPHEPYWQTNTSFSPPPSRWDFRFQSEGLPYGSNDGFHFYGsstssnskesksGVRGNLPYNNQNsasdsaglflssssdlsQGPQWTPPAIQEITIDGYETPTRRDPVSTQFSFTPAIEGTSANPYsrgstssrsdskddtstPQWEAHRWssasssvdfadvsEPFESESFGQSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTvlllnrnrvkknlslkgnsskEFPGKLRKTGACSSQLFNGKTIDPVVGCAKTTAGPSMRR
*********************************************************************************************************************************************************************************YVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLE***************************************************WGCPQAGGCVEGASHVPPRNTVLLLN******************************QLFNGKTIDPVVGC***********
*****PY*********************************************************************************************************************************************************************************KCGLCERFLSQRS***********DMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICL*******************************************************************************************************************
**************SPPPSRWDFRFQSEGLPYGSNDGFHFYG**************RGNLPYNNQNSASDSAGLFLSS*********WTPPAIQEITIDGYETPTRRDPVSTQFSFTPAIEGTS**************************************ADVSEPFESESFGQSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQT*********SCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRNRVKKNLSLKGNSSKEFPGKLRKTGACSSQLFNGKTIDPVVGCAK*********
*****PYWQTNTSFSPPPSRWDFRFQSEGLPYGSNDG*************************************************************************************************************************************************TFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRLQ***************************************************************************PGK**********************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPHEPYWQTNTSFSPPPSRWDFRFQSEGLPYGSNDGFHFYGSSTSSNSKESKSGVRGNLPYNNQNSASDSAGLFLSSSSDLSQGPQWTPPAIQEITIDGYETPTRRDPVSTQFSFTPAIEGTSANPYSRGSTSSRSDSKDDTSTPQWEAHRWSSASSSVDFADVSEPFESESFGQSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRNRVKKNLSLKGNSSKEFPGKLRKTGACSSQLFNGKTIDPVVGCAKTTAGPSMRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
356502555 508 PREDICTED: uncharacterized protein LOC10 1.0 0.708 0.594 1e-129
356497916422 PREDICTED: uncharacterized protein LOC10 0.880 0.751 0.591 1e-110
357487133447 hypothetical protein MTR_5g041750 [Medic 0.919 0.740 0.479 7e-90
449435334436 PREDICTED: uncharacterized protein LOC10 0.605 0.5 0.672 3e-77
113205448288 Putative mandelonitrile lyase, related [ 0.597 0.746 0.623 1e-72
53749466288 Putative mandelonitrile lyase, related [ 0.597 0.746 0.623 5e-72
240254076348 RING/U-box domain-containing protein [Ar 0.802 0.830 0.423 7e-66
255562906324 conserved hypothetical protein [Ricinus 0.747 0.830 0.484 2e-63
297844320338 hypothetical protein ARALYDRAFT_312416 [ 0.752 0.801 0.388 8e-53
240254078297 RING/U-box domain-containing protein [Ar 0.538 0.653 0.492 6e-50
>gi|356502555|ref|XP_003520084.1| PREDICTED: uncharacterized protein LOC100789831 [Glycine max] Back     alignment and taxonomy information
 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 246/414 (59%), Positives = 285/414 (68%), Gaps = 54/414 (13%)

Query: 1   MGPHEPYWQTNTSFSPPPSRWDFRFQSEGLPYGSNDGFHFYGSSTSSNSKESKSGVRGNL 60
           MGP+EPYW+TN+S+SPPP+RWDFRFQSEGLPY  NDG   YGSSTSS  KES+  VRGN 
Sbjct: 95  MGPNEPYWRTNSSYSPPPTRWDFRFQSEGLPYDVNDGVQLYGSSTSSIDKESRGWVRGNH 154

Query: 61  PYNNQNSASDSAGLFLSSSSDLSQGPQWTPPAIQEITIDGYETPTRRD--PVSTQFSFTP 118
            Y+   SASD  G+FLSS SDLSQGPQWTPPAIQEI+ID YET TR+D  P   + SFTP
Sbjct: 155 LYDLHYSASDDTGIFLSSPSDLSQGPQWTPPAIQEISIDNYETSTRKDSHPSVDRVSFTP 214

Query: 119 AIEGTSAN------------------------------------------PYSRGSTSSR 136
             EGTS N                                          P S    ++ 
Sbjct: 215 NKEGTSVNPNSGGSTSSQSESSESESTAKSRLSSQRNFSNLRSFMSKPIHPMSFNDLTTT 274

Query: 137 SDSKD---------DTSTPQWEAHRWSSASSSVDFADVSEPFESESFGQSYVPSDTFKCG 187
            D+ D         DTSTP  + HRWSSASSS +FAD++E FE E+ G+S+  SD F+CG
Sbjct: 275 RDAFDPAVTDFTEFDTSTPLRDGHRWSSASSSQEFADITESFELETPGRSHFLSDGFRCG 334

Query: 188 LCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICLRL 247
           LCERFL+QRSPWSSRRIVRSGDMP +GVL C H FHAECLEQTTPKTQKSDP CP+C++L
Sbjct: 335 LCERFLTQRSPWSSRRIVRSGDMPTIGVLPCCHAFHAECLEQTTPKTQKSDPPCPVCVKL 394

Query: 248 QEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHVPPRNTVLLLNRN 307
           +EENSPDQ+   RL+  FPRL+ S D+G SRPWGC Q G CVEGA H PPRNT+LLLNRN
Sbjct: 395 EEENSPDQRGHLRLRTGFPRLKSSRDDGPSRPWGCVQVGDCVEGALHAPPRNTMLLLNRN 454

Query: 308 RVKKNLSLKGNSSKEFPGKLRKTGACSSQLFNGKTID-PVVGCAKTTAGPSMRR 360
           R+KKNLSLKGN  KEFPGK+RK G  SS LF+G + D   VG +K TAGPS+ R
Sbjct: 455 RIKKNLSLKGNIGKEFPGKMRKNGTFSSHLFSGSSADGEAVGSSKATAGPSVWR 508

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356497916|ref|XP_003517802.1| PREDICTED: uncharacterized protein LOC100779481 [Glycine max] Back     alignment and taxonomy information
>gi|357487133|ref|XP_003613854.1| hypothetical protein MTR_5g041750 [Medicago truncatula] gi|355515189|gb|AES96812.1| hypothetical protein MTR_5g041750 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449435334|ref|XP_004135450.1| PREDICTED: uncharacterized protein LOC101203618 [Cucumis sativus] gi|449532609|ref|XP_004173273.1| PREDICTED: uncharacterized LOC101203618 [Cucumis sativus] Back     alignment and taxonomy information
>gi|113205448|gb|ABI34400.1| Putative mandelonitrile lyase, related [Solanum demissum] Back     alignment and taxonomy information
>gi|53749466|gb|AAU90320.1| Putative mandelonitrile lyase, related [Solanum demissum] Back     alignment and taxonomy information
>gi|240254076|ref|NP_563938.5| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|26451018|dbj|BAC42615.1| putative mandelonitrile lyase [Arabidopsis thaliana] gi|332190996|gb|AEE29117.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255562906|ref|XP_002522458.1| conserved hypothetical protein [Ricinus communis] gi|223538343|gb|EEF39950.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297844320|ref|XP_002890041.1| hypothetical protein ARALYDRAFT_312416 [Arabidopsis lyrata subsp. lyrata] gi|297335883|gb|EFH66300.1| hypothetical protein ARALYDRAFT_312416 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|240254078|ref|NP_973821.4| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|332190997|gb|AEE29118.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
TAIR|locus:2035819348 AT1G14180 [Arabidopsis thalian 0.430 0.445 0.453 4e-50
TAIR|locus:2172314320 AT5G18260 [Arabidopsis thalian 0.166 0.187 0.583 6.5e-19
TAIR|locus:2136368429 AT4G39140 [Arabidopsis thalian 0.163 0.137 0.542 2.4e-13
TAIR|locus:2050110421 AT2G21500 [Arabidopsis thalian 0.177 0.152 0.5 1.1e-12
TAIR|locus:2013114444 AT1G19680 [Arabidopsis thalian 0.175 0.141 0.471 1.2e-09
TAIR|locus:2018404455 AT1G75400 [Arabidopsis thalian 0.172 0.136 0.428 1.9e-08
TAIR|locus:2035819 AT1G14180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 391 (142.7 bits), Expect = 4.0e-50, Sum P(3) = 4.0e-50
 Identities = 73/161 (45%), Positives = 96/161 (59%)

Query:   176 QSYVPSDTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQ 235
             Q    S TFKCGLC R+LSQ+SPW SR IVR+ DMPV GVLSC+HVFH ECL+Q+TPK Q
Sbjct:   175 QQVAASSTFKCGLCNRYLSQKSPWGSRSIVRNRDMPVTGVLSCQHVFHVECLDQSTPKIQ 234

Query:   236 KSDPSCPICLRLQEENSPDQQVFSRLKNSFPRLRQSCDNGQSRPWGCPQAGGCVEGASHV 295
             ++DP CPIC + + E+     +  RLK  +       D   SRPWGC QAG CVE A +V
Sbjct:   235 RNDPLCPICTKQEGEHFKSNNIVPRLKPLYE------DGPSSRPWGCAQAGDCVESAVNV 288

Query:   296 PPRNTXXXXXXXXXXXXXXXXXXXXXEFPGKLRKTGACSSQ 336
             PP+NT                     +F  K++++ + + +
Sbjct:   289 PPKNTMMMINRNRIRKSLSLRGNSSKDFSRKMKRSNSVAME 329
GO:0005576 "extracellular region" evidence=ISM
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0042127 "regulation of cell proliferation" evidence=RCA
GO:0048451 "petal formation" evidence=RCA
GO:0048453 "sepal formation" evidence=RCA
TAIR|locus:2172314 AT5G18260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136368 AT4G39140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050110 AT2G21500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013114 AT1G19680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018404 AT1G75400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT1G14180
protein binding / zinc ion binding; protein binding / zinc ion binding; FUNCTIONS IN- protein binding, zinc ion binding; INVOLVED IN- biological_process unknown; EXPRESSED IN- 10 plant structures; EXPRESSED DURING- 6 growth stages; CONTAINS InterPro DOMAIN/s- Zinc finger, RING-type (InterPro-IPR001841); BEST Arabidopsis thaliana protein match is- protein binding / zinc ion binding (TAIR-AT5G18260.1); Has 25 Blast hits to 25 proteins in 6 species- Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 25; Viruses - 0; Other Eukaryotes - 0 (source- NCBI BLink). (348 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT5G61040
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (590 aa)
   •    0.407

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 9e-05
cd0016245 cd00162, RING, RING-finger (Really Interesting New 0.002
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 39.3 bits (92), Expect = 9e-05
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 4/32 (12%)

Query: 213 VGVLSCRHVFHAECLEQTTPKTQKSDPSCPIC 244
           V VL C HVFH ECL++      +S  +CP+C
Sbjct: 16  VVVLPCGHVFHKECLDKWL----RSSNTCPLC 43

Length = 46
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 360
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.3
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.27
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.21
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.04
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 99.03
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.87
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.82
PHA02929238 N1R/p28-like protein; Provisional 98.79
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.76
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.74
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.61
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.6
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.6
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.6
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.52
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.44
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.42
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.37
PF1463444 zf-RING_5: zinc-RING finger domain 98.37
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.25
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.21
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.19
PHA02926242 zinc finger-like protein; Provisional 98.13
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 98.13
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.12
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.07
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.98
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.96
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.79
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.76
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.64
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.61
KOG1941518 consensus Acetylcholine receptor-associated protei 97.57
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.57
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.56
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.53
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.52
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.45
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.31
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.25
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.21
COG52191525 Uncharacterized conserved protein, contains RING Z 97.04
KOG1940276 consensus Zn-finger protein [General function pred 97.01
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.97
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.77
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 96.7
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.63
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.25
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.1
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.09
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.77
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 95.76
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.67
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 95.65
PF04641260 Rtf2: Rtf2 RING-finger 95.49
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 95.37
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.15
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.94
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 94.8
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.51
KOG4445368 consensus Uncharacterized conserved protein, conta 94.46
COG5152259 Uncharacterized conserved protein, contains RING a 93.86
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 93.82
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 93.8
PHA02862156 5L protein; Provisional 93.23
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.23
PHA02825162 LAP/PHD finger-like protein; Provisional 92.96
COG5222427 Uncharacterized conserved protein, contains RING Z 92.6
KOG4739233 consensus Uncharacterized protein involved in syna 92.44
COG5236 493 Uncharacterized conserved protein, contains RING Z 91.9
PHA03096284 p28-like protein; Provisional 91.87
KOG0297 391 consensus TNF receptor-associated factor [Signal t 91.63
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 91.15
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 90.55
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 90.2
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 89.52
KOG1002791 consensus Nucleotide excision repair protein RAD16 89.06
KOG2660 331 consensus Locus-specific chromosome binding protei 88.82
KOG03091081 consensus Conserved WD40 repeat-containing protein 88.56
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 88.43
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 87.5
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 86.84
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 86.31
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 86.25
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 85.67
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 85.18
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 85.04
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 84.97
KOG1001674 consensus Helicase-like transcription factor HLTF/ 83.84
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 82.69
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 80.97
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information 
Probab=99.30  E-value=9.6e-13  Score=103.15  Aligned_cols=56  Identities=25%  Similarity=0.556  Sum_probs=42.8

Q ss_pred             CCccccccchhhhccCCCcccccccCCCCCCcEeeCCCChhhHHHHHhhcccCCCCCCCCcccc
Q 018151          182 DTFKCGLCERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPICL  245 (360)
Q Consensus       182 d~~~C~ICle~Lsq~sP~~s~~i~~~gD~~vVaVLPCGHVFHaeCLEqWl~k~~~~dpsCPlCr  245 (360)
                      .+.+|+||++.|.+.++.+..    +++...+++++|||+||.+||++|+...    .+||+||
T Consensus        18 ~~d~C~IC~~~l~~~~~~~~~----~~~~~~i~~~~C~H~FH~~Ci~~Wl~~~----~~CP~CR   73 (73)
T PF12678_consen   18 ADDNCAICREPLEDPCPECQA----PQDECPIVWGPCGHIFHFHCISQWLKQN----NTCPLCR   73 (73)
T ss_dssp             CCSBETTTTSBTTSTTCCHHH----CTTTS-EEEETTSEEEEHHHHHHHHTTS----SB-TTSS
T ss_pred             cCCcccccChhhhChhhhhcC----CccccceEecccCCCEEHHHHHHHHhcC----CcCCCCC
Confidence            455699999999877665543    2244567788999999999999999775    4999997

Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-04
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-04
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 4e-04
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
 Score = 38.0 bits (89), Expect = 2e-04
 Identities = 11/38 (28%), Positives = 16/38 (42%), Gaps = 5/38 (13%)

Query: 207 SGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPIC 244
           +  +    VL C H+ H  C E+      K    CP+C
Sbjct: 17  TSRVVAH-VLPCGHLLHRTCYEEML----KEGYRCPLC 49
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.43
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.35
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.33
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.32
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.28
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.28
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.27
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.26
2ect_A78 Ring finger protein 126; metal binding protein, st 99.25
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.24
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.21
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.19
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.18
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.17
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.16
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.14
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.13
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.07
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.06
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.06
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.03
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.03
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.97
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.96
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.95
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.95
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.93
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.93
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.92
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.91
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.91
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.89
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.89
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.85
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.85
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.85
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.84
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.84
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.84
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.82
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.79
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.76
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.69
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.68
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.65
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.5
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.48
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.46
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.44
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.44
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.37
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.36
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.33
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.33
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.28
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.26
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.26
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.21
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.18
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.13
2ea5_A68 Cell growth regulator with ring finger domain prot 98.03
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.96
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.9
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.88
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.8
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.79
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.7
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.59
3nw0_A238 Non-structural maintenance of chromosomes element 97.45
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.2
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 91.83
2k16_A75 Transcription initiation factor TFIID subunit 3; p 88.98
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 88.59
1wil_A89 KIAA1045 protein; ring finger domain, structural g 87.17
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 85.87
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 84.83
1we9_A64 PHD finger family protein; structural genomics, PH 83.49
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.43  E-value=8.2e-14  Score=112.02  Aligned_cols=76  Identities=25%  Similarity=0.390  Sum_probs=49.7

Q ss_pred             CCccccccchhhhccCCCccccccc-CCCCCCcEeeCCCChhhHHHHHhhcccCC-CCCCCCcccccCcccCCCCcch
Q 018151          182 DTFKCGLCERFLSQRSPWSSRRIVR-SGDMPVVGVLSCRHVFHAECLEQTTPKTQ-KSDPSCPICLRLQEENSPDQQV  257 (360)
Q Consensus       182 d~~~C~ICle~Lsq~sP~~s~~i~~-~gD~~vVaVLPCGHVFHaeCLEqWl~k~~-~~dpsCPlCrk~~~~~~~~q~~  257 (360)
                      ....|+||++.|............. .....++.+++|||+||.+||++|+.... .....||+||+.+..+.++||-
T Consensus        24 ~~~~C~ICl~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~H~Fh~~Ci~~wl~~~~~~~~~~CP~CR~~~~~~~g~qp~  101 (114)
T 1v87_A           24 PEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPW  101 (114)
T ss_dssp             CSCEETTTTEETTSCCSTTTTCCCSSSCSSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCCBSSSCSSSCTT
T ss_pred             CCCcCccCChhhcCcccccccccccccCcccceecCCCCCcccHHHHHHHHHcccCCCCCcCCCCCCccCCCCCCCCC
Confidence            3468999999997532211110000 01123455889999999999999995322 2246899999999876555543
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 360
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 7e-04
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 0.001
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 0.004
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 0.004
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.2 bits (88), Expect = 1e-04
 Identities = 11/61 (18%), Positives = 21/61 (34%), Gaps = 5/61 (8%)

Query: 185 KCGLC-ERFLSQRSPWSSRRIVRSGDMPVVGVLSCRHVFHAECLEQTTPKTQKSDPSCPI 243
            C +C    +       + +   + +   V    C H FH  C+     +  K+   CP+
Sbjct: 23  NCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCIS----RWLKTRQVCPL 78

Query: 244 C 244
            
Sbjct: 79  D 79
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.46
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.36
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.33
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.31
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.26
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.2
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.89
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.83
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.81
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.8
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.76
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.67
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.54
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.53
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.07
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.0
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.24
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 87.34
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Deltex protein 2 RING-H2 domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.46  E-value=1.6e-14  Score=115.66  Aligned_cols=76  Identities=26%  Similarity=0.387  Sum_probs=52.9

Q ss_pred             CCccccccchhhhccCCCcccccc-cCCCCCCcEeeCCCChhhHHHHHhhcccCCC-CCCCCcccccCcccCCCCcch
Q 018151          182 DTFKCGLCERFLSQRSPWSSRRIV-RSGDMPVVGVLSCRHVFHAECLEQTTPKTQK-SDPSCPICLRLQEENSPDQQV  257 (360)
Q Consensus       182 d~~~C~ICle~Lsq~sP~~s~~i~-~~gD~~vVaVLPCGHVFHaeCLEqWl~k~~~-~dpsCPlCrk~~~~~~~~q~~  257 (360)
                      ....|+||++.|.....+...... ...+...+.+++|||+||.+||++|+...+. ...+||+||+.|+.+.++||-
T Consensus        24 ~~~~C~IC~e~l~~~~~~~~~~~~~~~~~~~~~~~~~CgH~FH~~Ci~~Wl~~~~~~~~~~CP~CR~~~~~~~~~qP~  101 (114)
T d1v87a_          24 PEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPW  101 (114)
T ss_dssp             CSCEETTTTEETTSCCSTTTTCCCSSSCSSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCCBSSSCSSSCTT
T ss_pred             ccccccchhheecccccccccccccccccccceEECCCCChhhHHHHHHHHHhcCcCCCCccccccchhccCcCCCCC
Confidence            356799999999754333222111 1223445778899999999999999975432 235899999999887666653
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure