Citrus Sinensis ID: 018250

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36

MAVDEVVTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVRIADLGCSVGPNTFISVQNIIEALEFKFQNLSLPVPDFQVFFNDHTENDFNTLFRTLPPRKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMRHKTFPAQFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLKRISKN

ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHccccccEEEEcccccccccccccccEEEEEEccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHcHHHcccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHHcccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccc

ccEEEEEEEccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHccccccEEEEEccccccccccccccEEEEEcHHHHHHHHccccHccccccccHccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHcccccHHHccccccccccccHHHHHHHHHHcccEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccc

mavdevvtfpmmggdgtcsyahnsqfqrgTVDAAKELVREAIVNKLdvgsygydnsytVRIAdlgcsvgpntFISVQNIIEALEFKfqnlslpvpdfqvffndhtendfntlfrtlpprkyyaagvpgsfhgrlfpkstlHVVNSFNAMhwlsktpkvnMLEKSLEwnqgsikctrfmkgvheTFQAQFRSDFESILNARAEELVPGGLMVFSlitgpsgipfadtvqgaTYNFLGSCLWDLakmgviseekartfnvpayfpyVEELESLIQRNGHFAMERMQQldqpmrhktfpaQFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLKRISKN

MAVDEVVTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVnkldvgsygyDNSYTVRIADLGCSVGPNTFISVQNIIEALEFKFQNLSLPVPDFQVFFNDHTENDFNTLFRTLPPRKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMRHKTFPAQFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSihngklhkeIEVFVVLKRISKN

*****VVTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVRIADLGCSVGPNTFISVQNIIEALEFKFQNLSLPVPDFQVFFNDHTENDFNTLFRTLPPRKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERM******MRHKTFPAQFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLKR****

******VTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVRIADLGCSVGPNTFISVQNIIEALEFKFQNLSLPVPDFQVFFNDHTENDFNTLFRTLPPRKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMRHKTFPAQFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLKRIS**

*AVDEVVTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVRIADLGCSVGPNTFISVQNIIEALEFKFQNLSLPVPDFQVFFNDHTENDFNTLFRTLPPRKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMRHKTFPAQFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLKRI***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		359	2.2.26 [Sep-21-2011]
Q9FKC8		362	Probable S-adenosylmethio	no	no	0.966	0.958	0.418	1e-76
Q9FKD0		362	Probable S-adenosylmethio	no	no	0.966	0.958	0.418	3e-76
Q9FKR0		361	Probable S-adenosylmethio	no	no	0.963	0.958	0.410	2e-73
Q9LS10		359	Probable S-adenosylmethio	no	no	0.938	0.938	0.407	1e-71
Q68CM3		365	Probable caffeine synthas	N/A	no	0.935	0.920	0.351	7e-52
Q9FZN8		369	Caffeine synthase 1 OS=Ca	N/A	no	0.916	0.891	0.332	1e-48
Q0J998		404	Indole-3-acetate O-methyl	yes	no	0.941	0.836	0.298	3e-41
Q9SPV4		359	Salicylate O-methyltransf	N/A	no	0.924	0.924	0.334	5e-41
Q9AVK0		372	7-methylxanthosine syntha	N/A	no	0.924	0.892	0.283	5e-40
Q9AVK1		385	Probable caffeine synthas	N/A	no	0.922	0.859	0.294	1e-39

>sp\|Q9FKC8\|MT799_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37990 OS=Arabidopsis thaliana GN=At5g37990 PE=2 SV=2	Back alignment and function desciption

 Score =  287 bits (734), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/356 (41%), Positives = 215/356 (60%), Gaps = 9/356 (2%)

Query: 8   TFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTV-RIADLGC 66
           +FPM GGDG  SY HNS +Q+  +D AKE   EAI+  LD+     ++   + RIAD GC
Sbjct: 7   SFPMNGGDGPHSYIHNSSYQKVAIDGAKEKTSEAILKNLDLELLNRNSDENILRIADFGC 66

Query: 67  SVGPNTFISVQNIIEALE---FKFQNLSLPVP-DFQVFFNDHTENDFNTLFRTLP---PR 119
           S+GPNTF  VQNII+ ++    K  N  +  P +FQV FND   NDFNTLFRT P    +
Sbjct: 67  SIGPNTFEVVQNIIDTVKQKNLKENNAYIGAPLEFQVCFNDQPNNDFNTLFRTQPISSKQ 126

Query: 120 KYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMK 179
            Y + GVPGSFHGR+ PK++LH+ +   A+HWLS  P+    +KS   N+  I+C   ++
Sbjct: 127 AYLSVGVPGSFHGRVLPKNSLHIGHITYALHWLSTVPQHVCDKKSPALNKSYIQCNNLVE 186

Query: 180 GVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCL 239
            V E ++ QF+ D    L ARAEELV GGLM+ S    P G+P A T QG   + +G CL
Sbjct: 187 EVTEAYRVQFKKDMGDFLGARAEELVSGGLMILSGQCLPDGVPKALTWQGVVIDMIGDCL 246

Query: 240 WDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMRHKTFPAQF 299
            D+AK G+ ++EK   F++P Y P++ E ++ I+RN +F++E M+++  PM +K     F
Sbjct: 247 MDMAKQGITTKEKIELFSLPIYIPHISEFKAEIERNENFSIETMEKISHPMDYKPLTNDF 306

Query: 300 YLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLKR 355
             S  RA+L  +I +HFG+ ++  +F+    K+     I   +  K +  F+VLKR
Sbjct: 307 ITSMFRAILNTIIEEHFGDGVVNELFDRF-AKKLNKYPIDFKRCKKYVNYFIVLKR 361

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -

>sp\|Q9FKD0\|MT797_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37970 OS=Arabidopsis thaliana GN=At5g37970 PE=1 SV=1	Back alignment and function description

>sp\|Q9FKR0\|MT878_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38780 OS=Arabidopsis thaliana GN=At5g38780 PE=2 SV=1	Back alignment and function description

>sp\|Q9LS10\|MT810_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38100 OS=Arabidopsis thaliana GN=At5g38100 PE=2 SV=1	Back alignment and function description

>sp\|Q68CM3\|TCS2_CAMSI Probable caffeine synthase 2 OS=Camellia sinensis GN=TCS2 PE=2 SV=1	Back alignment and function description

>sp\|Q9FZN8\|TCS1_CAMSI Caffeine synthase 1 OS=Camellia sinensis GN=TCS1 PE=1 SV=1	Back alignment and function description

>sp\|Q0J998\|IAMT1_ORYSJ Indole-3-acetate O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=IAMT1 PE=1 SV=1	Back alignment and function description

>sp\|Q9SPV4\|SAMT_CLABR Salicylate O-methyltransferase OS=Clarkia breweri GN=SAMT PE=1 SV=1	Back alignment and function description

>sp\|Q9AVK0\|XMT1_COFAR 7-methylxanthosine synthase 1 OS=Coffea arabica GN=XMT1 PE=1 SV=1	Back alignment and function description

>sp\|Q9AVK1\|CS3_COFAR Probable caffeine synthase 3 OS=Coffea arabica GN=CS3 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		359
224069525		370	predicted protein [Populus trichocarpa]	0.988	0.959	0.487	8e-89
224144825		351	predicted protein [Populus trichocarpa]	0.961	0.982	0.481	6e-88
147833899		521	hypothetical protein VITISV_030502 [Viti	0.963	0.664	0.468	2e-84
225462819		377	PREDICTED: probable S-adenosylmethionine	0.955	0.909	0.472	5e-84
296087219		806	unnamed protein product [Vitis vinifera]	0.963	0.429	0.468	6e-84
225456081		369	PREDICTED: probable S-adenosylmethionine	0.958	0.932	0.459	2e-83
225424399		360	PREDICTED: probable S-adenosylmethionine	0.958	0.955	0.457	1e-81
225424405		361	PREDICTED: probable S-adenosylmethionine	0.947	0.941	0.442	1e-80
359488227		370	PREDICTED: probable S-adenosylmethionine	0.966	0.937	0.471	5e-79
297737614		347	unnamed protein product [Vitis vinifera]	0.938	0.971	0.440	7e-79

>gi\|224069525\|ref\|XP_002302990.1\| predicted protein [Populus trichocarpa] gi\|222844716\|gb\|EEE82263.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  333 bits (854), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 179/367 (48%), Positives = 234/367 (63%), Gaps = 12/367 (3%)

Query: 1   MAVDEVVTFP----MMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNS 56
           MA +E+   P    M+GGDG  SY  NS +Q+G VDA+KE V E I +KLD  S G+D+S
Sbjct: 1   MATEEIKELPKSWAMVGGDGPQSYTQNSAYQKGVVDASKEKVTEGIKDKLDFKSLGFDSS 60

Query: 57  Y-TVRIADLGCSVGPNTFISVQNIIEALEFKFQNLSLPVP----DFQVFFNDHTENDFNT 111
             T RIAD GCSVGPNTF +V+NIIEA+E K+Q      P    +FQVFFND T NDFNT
Sbjct: 61  NDTFRIADFGCSVGPNTFFAVENIIEAVEQKYQAQFQKSPPLELEFQVFFNDVTTNDFNT 120

Query: 112 LFRTL-PPRKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQG 170
           LF+TL   RKY+AAG+PG+F+GRL PKSTLH   S   + WLSK PK  +  KS  WN+G
Sbjct: 121 LFKTLHSNRKYFAAGLPGTFYGRLLPKSTLHFAYSSYCLQWLSKVPKEVVDSKSPAWNKG 180

Query: 171 SIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGA 230
           SI+C    K V + + AQF+SD  + LNARA+E+V GGLMV  +   P GI  +    G 
Sbjct: 181 SIQCDGLKKEVTKAYSAQFQSDMNTFLNARAQEIVGGGLMVIIMAGLPDGIFMSQAGVGM 240

Query: 231 TYNFLGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPM 290
            Y  LGSCL D+AK+G ISEEK  +FN+P Y+    E+E +I+ NG+F +E M  L   +
Sbjct: 241 YYELLGSCLVDMAKLGEISEEKVDSFNLPLYYSSSTEIEEIIKENGNFNIEIMDSLSHQI 300

Query: 291 --RHKTFPAQFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIE 348
               K    +  +S  RAV +GL+ +HFG E++E  F H   K  +  SI +G  H+ I+
Sbjct: 301 WKTSKKSNIEVSVSGGRAVFQGLVEEHFGSEVVEKTFEHFAKKLVDNFSIFDGAAHEHID 360

Query: 349 VFVVLKR 355
            F++LKR
Sbjct: 361 HFILLKR 367

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224144825\|ref\|XP_002336178.1\| predicted protein [Populus trichocarpa] gi\|222875362\|gb\|EEF12493.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147833899\|emb\|CAN73170.1\| hypothetical protein VITISV_030502 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225462819\|ref\|XP_002266476.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296087219\|emb\|CBI33593.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225456081\|ref\|XP_002277876.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g38780 [Vitis vinifera] gi\|297734281\|emb\|CBI15528.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225424399\|ref\|XP_002281366.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] gi\|297737618\|emb\|CBI26819.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225424405\|ref\|XP_002284898.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359488227\|ref\|XP_002266288.2\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297737614\|emb\|CBI26815.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		359
TAIR\|locus:2166640		361	AT5G38780 [Arabidopsis thalian	0.963	0.958	0.410	1.7e-68
TAIR\|locus:2144461		359	AT5G38100 [Arabidopsis thalian	0.947	0.947	0.416	4e-67
TAIR\|locus:2082157		348	AT3G44840 [Arabidopsis thalian	0.952	0.982	0.417	2.2e-66
TAIR\|locus:504956193		351	AT1G15125 [Arabidopsis thalian	0.947	0.968	0.420	3.6e-66
TAIR\|locus:2200186		363	AT1G68040 [Arabidopsis thalian	0.974	0.964	0.378	5.4e-63
TAIR\|locus:2082112		348	FAMT "farnesoic acid carboxyl-	0.952	0.982	0.394	4.8e-62
TAIR\|locus:2082117		379	AT3G44870 "AT3G44870" [Arabido	0.947	0.897	0.389	3.4e-61
TAIR\|locus:2033409		353	PXMT1 [Arabidopsis thaliana (t	0.938	0.954	0.389	5.1e-58
TAIR\|locus:2033414		353	AT1G66690 "AT1G66690" [Arabido	0.927	0.943	0.379	3.7e-55
TAIR\|locus:2033389		352	AT1G66720 [Arabidopsis thalian	0.938	0.957	0.370	1.1e-53

TAIR\|locus:2166640 AT5G38780 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 695 (249.7 bits), Expect = 1.7e-68, P = 1.7e-68
 Identities = 146/356 (41%), Positives = 209/356 (58%)

Query:     8 TFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVRIADLGCS 67
             ++PM GGD   SY HNS +Q+  +D  +E  R+ I+  LD+ +    N  T  IAD GCS
Sbjct:     7 SYPMSGGDDQHSYIHNSSYQKAGIDGVQEKARQYILENLDLLNMN-PNLSTFTIADFGCS 65

Query:    68 VGPNTFISVQNIIEALEFKF----QNLSLPVP-DFQVFFNDHTENDFNTLFRTLPP---R 119
             +GPNTF +VQNII+ ++ K     Q  S   P +FQV+FND   NDFNTLFRT PP   +
Sbjct:    66 IGPNTFHAVQNIIDIVKLKHLKESQEDSRVAPLEFQVYFNDLPNNDFNTLFRTQPPSSKQ 125

Query:   120 KYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMK 179
             +Y++ GVPGSF+GR+ P++++H+ N+    HWLSK P+    + SL WN+  I C   ++
Sbjct:   126 EYFSVGVPGSFYGRVLPRNSIHIGNTSFTTHWLSKVPEEVCDKNSLAWNKNYIHCNNLIE 185

Query:   180 GVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCL 239
              V E ++ QF  D    L ARAEELVPGGLM+      P G+   +T  G   + +G CL
Sbjct:   186 EVTEAYKVQFEKDMGVFLKARAEELVPGGLMITLGQCLPDGVAMYETWSGIVKDTIGDCL 245

Query:   240 WDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMRHKTFPAQF 299
              D+A +GV +EEK   FN+P YFP V EL+  I++N  F +E M+ +  P+        F
Sbjct:   246 QDMATLGVTTEEKIEMFNLPVYFPQVSELKGAIEQNIRFTIEMMEIVSHPLEAVQLSNNF 305

Query:   300 YLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLKR 355
               S  RA+L  +I +HFG  +++ +F     K +E   I   K  K++   +VLKR
Sbjct:   306 ITSMYRAILSTVIERHFGGSVVDELFRQFAKKLSEH-PIDFEKCKKQMVYHIVLKR 360

GO:0008168 "methyltransferase activity" evidence=IEA

GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=ISS

GO:0009507 "chloroplast" evidence=ISM

TAIR\|locus:2144461 AT5G38100 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2082157 AT3G44840 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956193 AT1G15125 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2200186 AT1G68040 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2082112 FAMT "farnesoic acid carboxyl-O-methyltransferase" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2082117 AT3G44870 "AT3G44870" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2033409 PXMT1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2033414 AT1G66690 "AT1G66690" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2033389 AT1G66720 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		359
pfam03492		331	pfam03492, Methyltransf_7, SAM dependent carboxyl	1e-103
PLN02668		386	PLN02668, PLN02668, indole-3-acetate carboxyl meth	3e-54

>gnl\|CDD\|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase	Back alignment and domain information

 Score =  307 bits (789), Expect = e-103
 Identities = 130/316 (41%), Positives = 192/316 (60%), Gaps = 18/316 (5%)

Query: 58  TVRIADLGCSVGPNTFISVQNIIEALEFKFQNLS-LPVPDFQVFFNDHTENDFNTLFRTL 116
           +++IADLGCS GPNTF++V NII+ +E K+Q  + L  P+FQVFFND   NDFNTLF+ L
Sbjct: 17  SIKIADLGCSSGPNTFLAVSNIIDTVEKKYQKENILEPPEFQVFFNDLPSNDFNTLFKLL 76

Query: 117 PP-----RKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGS 171
           PP     R Y+ +GVPGSF+GRLFP+++LH V+S  ++HWLS+ PK    ++S  WN+G+
Sbjct: 77  PPFQKKKRSYFVSGVPGSFYGRLFPRNSLHFVHSSYSLHWLSQVPKGLEDKESPAWNKGN 136

Query: 172 IKCTRFM-KGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGA 230
           I  +    + V++ +  QF+ DF   L ARAEELV GGLMV + + G   +  ++T  G 
Sbjct: 137 IYISGASPEEVYKAYLDQFKKDFSLFLRARAEELVSGGLMVLTFL-GRPSVDPSETECGI 195

Query: 231 TYNFLGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPM 290
            ++ LG  L DL   G+I EEK  +FN+P Y P  EE++ +I++ G F +ER++ +  P 
Sbjct: 196 FWDLLGDALNDLVSEGLIEEEKLDSFNIPIYAPSPEEVKEIIEKEGSFTIERLEIIKHPN 255

Query: 291 RHKTFPAQFYL----------SHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHN 340
               +                S +RAV+E ++  HFGE++++ +F+    K +E LS   
Sbjct: 256 GEVPWDESDSEDKVEDGRFVASSVRAVVEPMLVAHFGEDIMDKLFDRYAKKLSEHLSKEL 315

Query: 341 GKLHKEIEVFVVLKRI 356
               K I V V L R 
Sbjct: 316 QNAKKTINVVVSLSRK 331

This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331

>gnl\|CDD\|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		359
PLN02668		386	indole-3-acetate carboxyl methyltransferase	100.0
PF03492		334	Methyltransf_7: SAM dependent carboxyl methyltrans	100.0
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	99.68
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	99.67
PRK10258		251	biotin biosynthesis protein BioC; Provisional	99.65
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	99.6
COG4106		257	Tam Trans-aconitate methyltransferase [General fun	99.39
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	99.32
PLN02233		261	ubiquinone biosynthesis methyltransferase	99.29
PLN02244		340	tocopherol O-methyltransferase	99.27
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	99.23
TIGR00740		239	methyltransferase, putative. A simple BLAST search	99.22
PLN02336		475	phosphoethanolamine N-methyltransferase	99.2
PRK08317		241	hypothetical protein; Provisional	99.19
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	99.16
PRK15068		322	tRNA mo(5)U34 methyltransferase; Provisional	99.15
PF13489		161	Methyltransf_23: Methyltransferase domain; PDB: 3J	99.12
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	99.08
PRK15451		247	tRNA cmo(5)U34 methyltransferase; Provisional	99.07
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	99.04
PLN02396		322	hexaprenyldihydroxybenzoate methyltransferase	99.03
TIGR00452		314	methyltransferase, putative. Known examples to dat	99.03
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	99.01
smart00828		224	PKS_MT Methyltransferase in polyketide synthase (P	99.0
PLN02490		340	MPBQ/MSBQ methyltransferase	98.94
PRK11705		383	cyclopropane fatty acyl phospholipid synthase; Pro	98.93
PRK06202		232	hypothetical protein; Provisional	98.87
KOG2940		325	consensus Predicted methyltransferase [General fun	98.87
TIGR01934		223	MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis	98.85
KOG1540		296	consensus Ubiquinone biosynthesis methyltransferas	98.85
PRK11088		272	rrmA 23S rRNA methyltransferase A; Provisional	98.82
PRK00216		239	ubiE ubiquinone/menaquinone biosynthesis methyltra	98.82
PRK11207		197	tellurite resistance protein TehB; Provisional	98.81
PRK11873		272	arsM arsenite S-adenosylmethyltransferase; Reviewe	98.8
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	98.76
PF02353		273	CMAS: Mycolic acid cyclopropane synthetase; InterP	98.71
PRK12335		287	tellurite resistance protein TehB; Provisional	98.68
KOG1541		270	consensus Predicted protein carboxyl methylase [Ge	98.63
PRK06922		677	hypothetical protein; Provisional	98.63
PRK05785		226	hypothetical protein; Provisional	98.61
TIGR02716		306	C20_methyl_CrtF C-20 methyltransferase BchU. Membe	98.6
PF08242		99	Methyltransf_12: Methyltransferase domain; InterPr	98.59
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	98.57
PF13847		152	Methyltransf_31: Methyltransferase domain; PDB: 3T	98.54
TIGR02021		219	BchM-ChlM magnesium protoporphyrin O-methyltransfe	98.53
COG2230		283	Cfa Cyclopropane fatty acid synthase and related m	98.53
TIGR01983		224	UbiG ubiquinone biosynthesis O-methyltransferase.	98.51
PLN02336		475	phosphoethanolamine N-methyltransferase	98.51
PF08003		315	Methyltransf_9: Protein of unknown function (DUF16	98.51
PRK00121		202	trmB tRNA (guanine-N(7)-)-methyltransferase; Revie	98.5
smart00138		264	MeTrc Methyltransferase, chemotaxis proteins. Meth	98.49
KOG3010		261	consensus Methyltransferase [General function pred	98.46
TIGR02081		194	metW methionine biosynthesis protein MetW. This pr	98.45
PRK07580		230	Mg-protoporphyrin IX methyl transferase; Validated	98.4
PF13649		101	Methyltransf_25: Methyltransferase domain; PDB: 3B	98.38
TIGR00537		179	hemK_rel_arch HemK-related putative methylase. The	98.37
KOG2361		264	consensus Predicted methyltransferase [General fun	98.37
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	98.37
PRK05134		233	bifunctional 3-demethylubiquinone-9 3-methyltransf	98.36
PF03848		192	TehB: Tellurite resistance protein TehB; InterPro:	98.36
TIGR03438		301	probable methyltransferase. This model represents	98.35
TIGR03587		204	Pse_Me-ase pseudaminic acid biosynthesis-associate	98.32
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	98.27
KOG1270		282	consensus Methyltransferases [Coenzyme transport a	98.26
TIGR03840		213	TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d	98.22
PRK09489		342	rsmC 16S ribosomal RNA m2G1207 methyltransferase;	98.19
TIGR00091		194	tRNA (guanine-N(7)-)-methyltransferase. In E. coli	98.18
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	98.16
PF00891		241	Methyltransf_2: O-methyltransferase; InterPro: IPR	98.16
PLN02585		315	magnesium protoporphyrin IX methyltransferase	98.13
PF05401		201	NodS: Nodulation protein S (NodS); InterPro: IPR00	98.13
PRK15001		378	SAM-dependent 23S ribosomal RNA mG1835 methyltrans	98.1
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	98.09
PTZ00146		293	fibrillarin; Provisional	98.07
PF05175		170	MTS: Methyltransferase small domain; InterPro: IPR	98.06
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	98.04
PLN02232		160	ubiquinone biosynthesis methyltransferase	98.04
PRK04266		226	fibrillarin; Provisional	98.03
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	98.02
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	98.0
PRK14121		390	tRNA (guanine-N(7)-)-methyltransferase; Provisiona	97.98
PRK14967		223	putative methyltransferase; Provisional	97.98
PRK13255		218	thiopurine S-methyltransferase; Reviewed	97.97
PHA03411		279	putative methyltransferase; Provisional	97.97
PF05148		219	Methyltransf_8: Hypothetical methyltransferase; In	97.97
COG4123		248	Predicted O-methyltransferase [General function pr	97.96
PF06080		204	DUF938: Protein of unknown function (DUF938); Inte	97.93
cd02440		107	AdoMet_MTases S-adenosylmethionine-dependent methy	97.93
TIGR03533		284	L3_gln_methyl protein-(glutamine-N5) methyltransfe	97.88
TIGR00438		188	rrmJ cell division protein FtsJ.	97.85
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	97.81
KOG3045		325	consensus Predicted RNA methylase involved in rRNA	97.8
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	97.79
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	97.76
PF07021		193	MetW: Methionine biosynthesis protein MetW; InterP	97.75
PRK14968		188	putative methyltransferase; Provisional	97.73
PF03141		506	Methyltransf_29: Putative S-adenosyl-L-methionine-	97.72
PRK11805		307	N5-glutamine S-adenosyl-L-methionine-dependent met	97.7
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	97.69
KOG4300		252	consensus Predicted methyltransferase [General fun	97.64
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	97.62
PF13659		117	Methyltransf_26: Methyltransferase domain; PDB: 3G	97.61
TIGR00406		288	prmA ribosomal protein L11 methyltransferase. Ribo	97.52
TIGR00536		284	hemK_fam HemK family putative methylases. The gene	97.4
PLN03075		296	nicotianamine synthase; Provisional	97.38
PRK09328		275	N5-glutamine S-adenosyl-L-methionine-dependent met	97.32
TIGR01177		329	conserved hypothetical protein TIGR01177. This fam	97.32
PRK10901		427	16S rRNA methyltransferase B; Provisional	97.31
COG4976		287	Predicted methyltransferase (contains TPR repeat)	97.31
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	97.29
PF05891		218	Methyltransf_PK: AdoMet dependent proline di-methy	97.29
PRK14966		423	unknown domain/N5-glutamine S-adenosyl-L-methionin	97.28
PF03291		331	Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971	97.27
TIGR00563		426	rsmB ribosomal RNA small subunit methyltransferase	97.26
KOG3178		342	consensus Hydroxyindole-O-methyltransferase and re	97.25
PRK00377		198	cbiT cobalt-precorrin-6Y C(15)-methyltransferase;	97.21
PRK00811		283	spermidine synthase; Provisional	97.2
PRK14903		431	16S rRNA methyltransferase B; Provisional	97.17
COG2813		300	RsmC 16S RNA G1207 methylase RsmC [Translation, ri	97.1
PRK14904		445	16S rRNA methyltransferase B; Provisional	97.08
COG2264		300	PrmA Ribosomal protein L11 methylase [Translation,	97.04
TIGR03704		251	PrmC_rel_meth putative protein-(glutamine-N5) meth	97.04
COG2242		187	CobL Precorrin-6B methylase 2 [Coenzyme metabolism	97.0
PRK14902		444	16S rRNA methyltransferase B; Provisional	97.0
PF02390		195	Methyltransf_4: Putative methyltransferase ; Inter	97.0
COG2518		209	Pcm Protein-L-isoaspartate carboxylmethyltransfera	96.88
PRK13943		322	protein-L-isoaspartate O-methyltransferase; Provis	96.85
PRK04457		262	spermidine synthase; Provisional	96.73
TIGR00446		264	nop2p NOL1/NOP2/sun family putative RNA methylase.	96.73
PRK14901		434	16S rRNA methyltransferase B; Provisional	96.71
PRK07402		196	precorrin-6B methylase; Provisional	96.67
PF01135		209	PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl	96.67
PLN02672		1082	methionine S-methyltransferase	96.62
smart00650		169	rADc Ribosomal RNA adenine dimethylases.	96.45
COG2890		280	HemK Methylase of polypeptide chain release factor	96.43
KOG2904		328	consensus Predicted methyltransferase [General fun	96.4
PRK03612		521	spermidine synthase; Provisional	96.32
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	96.29
KOG1331		293	consensus Predicted methyltransferase [General fun	96.29
PF05724		218	TPMT: Thiopurine S-methyltransferase (TPMT); Inter	96.28
KOG2899		288	consensus Predicted methyltransferase [General fun	96.18
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	96.17
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	96.13
PLN02366		308	spermidine synthase	96.13
PHA03412		241	putative methyltransferase; Provisional	96.11
KOG1975		389	consensus mRNA cap methyltransferase [RNA processi	96.11
KOG1271		227	consensus Methyltransferases [General function pre	96.09
PRK13256		226	thiopurine S-methyltransferase; Reviewed	96.07
COG0220		227	Predicted S-adenosylmethionine-dependent methyltra	96.06
PRK10611		287	chemotaxis methyltransferase CheR; Provisional	95.97
KOG1499		346	consensus Protein arginine N-methyltransferase PRM	95.9
PF05185		448	PRMT5: PRMT5 arginine-N-methyltransferase; InterPr	95.76
PF01728		181	FtsJ: FtsJ-like methyltransferase; InterPro: IPR00	95.71
PF11968		219	DUF3321: Putative methyltransferase (DUF3321); Int	95.68
PF06325		295	PrmA: Ribosomal protein L11 methyltransferase (Prm	95.68
KOG3191		209	consensus Predicted N6-DNA-methyltransferase [Tran	95.63
PF12147		311	Methyltransf_20: Putative methyltransferase; Inter	95.48
PF01739		196	CheR: CheR methyltransferase, SAM binding domain;	95.35
COG1352		268	CheR Methylase of chemotaxis methyl-accepting prot	95.24
TIGR00478		228	tly hemolysin TlyA family protein. Hemolysins are	95.24
PRK01581		374	speE spermidine synthase; Validated	95.19
PF10294		173	Methyltransf_16: Putative methyltransferase; Inter	95.12
PRK15128		396	23S rRNA m(5)C1962 methyltransferase; Provisional	94.99
COG2519		256	GCD14 tRNA(1-methyladenosine) methyltransferase an	94.69
PLN02781		234	Probable caffeoyl-CoA O-methyltransferase	94.63
TIGR03439		319	methyl_EasF probable methyltransferase domain, Eas	94.41
KOG1500		517	consensus Protein arginine N-methyltransferase CAR	94.1
PRK00274		272	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	93.97
PRK10909		199	rsmD 16S rRNA m(2)G966-methyltransferase; Provisio	93.95
PF01234		256	NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I	93.76
PF07942		270	N2227: N2227-like protein; InterPro: IPR012901 Thi	93.68
PRK14896		258	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	93.47
PF08123		205	DOT1: Histone methylation protein DOT1 ; InterPro:	92.76
PTZ00338		294	dimethyladenosine transferase-like protein; Provis	92.65
PRK13168		443	rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe	91.98
PLN02823		336	spermine synthase	91.67
TIGR00755		253	ksgA dimethyladenosine transferase. Alternate name	91.41
PRK11727		321	23S rRNA mA1618 methyltransferase; Provisional	91.0
PF04672		267	Methyltransf_19: S-adenosyl methyltransferase; Int	90.96
COG0500		257	SmtA SAM-dependent methyltransferases [Secondary m	90.58
PF05219		265	DREV: DREV methyltransferase; InterPro: IPR007884	90.39
PRK11933		470	yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF;	90.35
PRK03522		315	rumB 23S rRNA methyluridine methyltransferase; Rev	88.56
TIGR02987		524	met_A_Alw26 type II restriction m6 adenine DNA met	88.43
PF09243		274	Rsm22: Mitochondrial small ribosomal subunit Rsm22	88.32
COG2263		198	Predicted RNA methylase [Translation, ribosomal st	87.8
COG0030		259	KsgA Dimethyladenosine transferase (rRNA methylati	87.57
COG4122		219	Predicted O-methyltransferase [General function pr	87.37
PF13679		141	Methyltransf_32: Methyltransferase domain	87.34
PF06859		110	Bin3: Bicoid-interacting protein 3 (Bin3); InterPr	87.3
PRK04338		382	N(2),N(2)-dimethylguanosine tRNA methyltransferase	87.29
PRK04148		134	hypothetical protein; Provisional	86.85
PRK11524		284	putative methyltransferase; Provisional	86.84
PLN02476		278	O-methyltransferase	85.84
PLN02589		247	caffeoyl-CoA O-methyltransferase	85.32
PF02384		311	N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T	84.26
PF08704		247	GCD14: tRNA methyltransferase complex GCD14 subuni	82.6
KOG1269		364	consensus SAM-dependent methyltransferases [Lipid	81.68
TIGR00479		431	rumA 23S rRNA (uracil-5-)-methyltransferase RumA.	80.45

>PLN02668 indole-3-acetate carboxyl methyltransferase	Back alignment and domain information

Probab=100.00  E-value=5.4e-94  Score=703.72  Aligned_cols=346  Identities=29%  Similarity=0.500  Sum_probs=310.8

Q ss_pred             ccc-eeeeccCCCCccchHHhhHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCcceEEEeecCCCCcccHHHHHHHHHH
Q 018250            4 DEV-VTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVRIADLGCSVGPNTFISVQNIIEA   82 (359)
Q Consensus         4 ~~~-~~~~M~gG~g~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~~~~~~~~~~~~~IaDlGCs~G~nt~~~~~~ii~~   82 (359)
                      |++ ++|||+||+|++||++||.+|+.++..++|+|+++|++.. ....   +.++++|||||||+|+||+.+++.||++
T Consensus        13 m~~~~~l~M~gG~g~~SYa~nS~~Q~~~~~~~k~~leeai~~~~-~~~~---p~~~~~iaDlGcs~G~ntl~~vs~iI~~   88 (386)
T PLN02668         13 MKLEKLLCMKGGKGEGSYANNSQAQALHARSMLHLLEETLDNVH-LNSS---PEVPFTAVDLGCSSGSNTIHIIDVIVKH   88 (386)
T ss_pred             ceeccccccCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHhc-cccC---CCcceeEEEecCCCCccHHHHHHHHHHH
Confidence            445 7899999999999999999999999999999999998753 1211   1268999999999999999999999999


Q ss_pred             HHHHhhcCCCCCCCceEEecCCCCCchHHHHHhCCC-----------------CcccccccCcccccCCCCCCceeEEEe
Q 018250           83 LEFKFQNLSLPVPDFQVFFNDHTENDFNTLFRTLPP-----------------RKYYAAGVPGSFHGRLFPKSTLHVVNS  145 (359)
Q Consensus        83 ~~~~~~~~~~~~p~~~v~~nDLp~NDFn~lf~~l~~-----------------~~~~~~~vpgsfy~~l~p~~s~d~~~S  145 (359)
                      |+++|++.+.+.|++||+|||||+||||+||++|+.                 ++||++|||||||+||||++|+||+||
T Consensus        89 i~~~~~~~~~~~pe~qv~~nDLP~NDFNtlF~~L~~~~~~~~~~~~~~~~~~~~~~f~~gvpGSFY~RLfP~~Slh~~~S  168 (386)
T PLN02668         89 MSKRYESAGLDPPEFSAFFSDLPSNDFNTLFQLLPPLANYGGSMEECLAASGHRSYFAAGVPGSFYRRLFPARSIDVFHS  168 (386)
T ss_pred             HHHHhhhcCCCCCcceEEecCCCCCCHHHHHhhchhhhhhhcchhhhccccCCCceEEEecCccccccccCCCceEEEEe
Confidence            999998766678999999999999999999999974                 239999999999999999999999999


Q ss_pred             cCcccccCCCCcccccccccccCCCceeecCCCHHHHHHHHHHHHHHHHHHHHHHHHhhccCceeEEEeccCCCCCCCCC
Q 018250          146 FNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFAD  225 (359)
Q Consensus       146 ~~alHWLs~~p~~~~~~~~~~~n~g~i~~~~~~~~~~~~y~~Q~~~D~~~fL~~Ra~EL~pGG~lvl~~~g~~~~~~~~~  225 (359)
                      ++||||||++|+.+.|+.+++||||+|||++++|+|.+||++||++||..||++|++||+|||+||++++||++.++..+
T Consensus       169 s~slHWLS~vP~~l~d~~s~~~Nkg~iyi~~~s~~v~~aY~~Qf~~D~~~FL~~Ra~ELvpGG~mvl~~~Gr~~~~~~~~  248 (386)
T PLN02668        169 AFSLHWLSQVPESVTDKRSAAYNKGRVFIHGASESTANAYKRQFQADLAGFLRARAQEMKRGGAMFLVCLGRTSVDPTDQ  248 (386)
T ss_pred             eccceecccCchhhccCCcccccCCceEecCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccCcEEEEEEecCCCCCcccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988666555


Q ss_pred             cchhHHHHH-HHHHHHHHHHcCCCChhhhccCCccccCCCHHHHHHHHHhCCceeEeEEEEeecCCC-CC--C----CCh
Q 018250          226 TVQGATYNF-LGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMR-HK--T----FPA  297 (359)
Q Consensus       226 ~~~~~~~~~-l~~al~~lv~eGli~~e~~d~f~~P~y~ps~~E~~~~i~~~G~F~i~~le~~~~~~~-~~--~----~~~  297 (359)
                      ...+.+|+. +.++|++||.||+|++||+|+||+|+|+||.+|++++|+++|+|+|+++|.++...+ +.  +    ..+
T Consensus       249 ~~~~~~~~~~l~~al~dlv~eGlI~eek~dsFniP~Y~ps~eEv~~~Ie~~gsF~I~~le~~~~~~~~~~~~~~d~~~~g  328 (386)
T PLN02668        249 GGAGLLFGTHFQDAWDDLVQEGLVTSEKRDSFNIPVYAPSLQDFKEVVEANGSFAIDKLEVFKGGSPLVVNEPDDAAEVG  328 (386)
T ss_pred             CchhHHHHHHHHHHHHHHHHcCCCCHHHHhcccCcccCCCHHHHHHHHhhcCCEEeeeeEEeeccCcccccCcccHHHHH
Confidence            435566776 999999999999999999999999999999999999999999999999999874322 11  1    124


Q ss_pred             hHHHHHHHHHhhhhhhhccCHHHHHHHHHHHHHHHHHHhhhhhcCCcceEEEEEEEE
Q 018250          298 QFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLK  354 (359)
Q Consensus       298 ~~v~~~iRa~~~~~l~~~~~e~i~delf~r~~~~~~~~~~~~~~~~~~~~~~~~~l~  354 (359)
                      ..+++++||++||++.+|||++++|+||+||+++++++++... +..++++++|+|.
T Consensus       329 ~~~a~~~RA~~E~ll~~HFG~~i~D~lF~r~~~~v~~~~~~~~-~~~~~~~~~~sL~  384 (386)
T PLN02668        329 RAMANSCRSVAGVLVDAHIGEELSNELFLRVERRATSHAKELL-EKLQFFHIVASLS  384 (386)
T ss_pred             HHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHhhc-ccCceEEEEEEEe
Confidence            5789999999999999999999999999999999999888642 5578888888885

>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only]	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>TIGR00740 methyltransferase, putative	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C	Back alignment and domain information

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PLN02396 hexaprenyldihydroxybenzoate methyltransferase	Back alignment and domain information

>TIGR00452 methyltransferase, putative	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional	Back alignment and domain information

>PRK06202 hypothetical protein; Provisional	Back alignment and domain information

>KOG2940 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases	Back alignment and domain information

>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional	Back alignment and domain information

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4)	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only]	Back alignment and domain information

>PRK06922 hypothetical protein; Provisional	Back alignment and domain information

>PRK05785 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU	Back alignment and domain information

>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A	Back alignment and domain information

>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase	Back alignment and domain information

>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed	Back alignment and domain information

>smart00138 MeTrc Methyltransferase, chemotaxis proteins	Back alignment and domain information

>KOG3010 consensus Methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR02081 metW methionine biosynthesis protein MetW	Back alignment and domain information

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated	Back alignment and domain information

>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A	Back alignment and domain information

>TIGR00537 hemK_rel_arch HemK-related putative methylase	Back alignment and domain information

>KOG2361 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional	Back alignment and domain information

>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB	Back alignment and domain information

>TIGR03438 probable methyltransferase	Back alignment and domain information

>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism]	Back alignment and domain information

>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family	Back alignment and domain information

>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional	Back alignment and domain information

>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PLN02585 magnesium protoporphyrin IX methyltransferase	Back alignment and domain information

>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins	Back alignment and domain information

>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>PTZ00146 fibrillarin; Provisional	Back alignment and domain information

>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>PLN02232 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>PRK13255 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>PHA03411 putative methyltransferase; Provisional	Back alignment and domain information

>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases	Back alignment and domain information

>COG4123 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes	Back alignment and domain information

>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification]	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins	Back alignment and domain information

>PRK14968 putative methyltransferase; Provisional	Back alignment and domain information

>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases	Back alignment and domain information

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>KOG4300 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A	Back alignment and domain information

>TIGR00406 prmA ribosomal protein L11 methyltransferase	Back alignment and domain information

>TIGR00536 hemK_fam HemK family putative methylases	Back alignment and domain information

>PLN03075 nicotianamine synthase; Provisional	Back alignment and domain information

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>TIGR01177 conserved hypothetical protein TIGR01177	Back alignment and domain information

>PRK10901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like	Back alignment and domain information

>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional	Back alignment and domain information

>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes	Back alignment and domain information

>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB	Back alignment and domain information

>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only]	Back alignment and domain information

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>PRK14903 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14904 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific	Back alignment and domain information

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]	Back alignment and domain information

>PRK14902 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2	Back alignment and domain information

>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK04457 spermidine synthase; Provisional	Back alignment and domain information

>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase	Back alignment and domain information

>PRK14901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK07402 precorrin-6B methylase; Provisional	Back alignment and domain information

>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2	Back alignment and domain information

>PLN02672 methionine S-methyltransferase	Back alignment and domain information

>smart00650 rADc Ribosomal RNA adenine dimethylases	Back alignment and domain information

>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2904 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PRK03612 spermidine synthase; Provisional	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>KOG1331 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>KOG2899 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>PLN02366 spermidine synthase	Back alignment and domain information

>PHA03412 putative methyltransferase; Provisional	Back alignment and domain information

>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification]	Back alignment and domain information

>KOG1271 consensus Methyltransferases [General function prediction only]	Back alignment and domain information

>PRK13256 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only]	Back alignment and domain information

>PRK10611 chemotaxis methyltransferase CheR; Provisional	Back alignment and domain information

>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase []	Back alignment and domain information

>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes	Back alignment and domain information

>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein	Back alignment and domain information

>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences	Back alignment and domain information

>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length	Back alignment and domain information

>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms]	Back alignment and domain information

>TIGR00478 tly hemolysin TlyA family protein	Back alignment and domain information

>PRK01581 speE spermidine synthase; Validated	Back alignment and domain information

>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases	Back alignment and domain information

>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional	Back alignment and domain information

>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02781 Probable caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family	Back alignment and domain information

>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription]	Back alignment and domain information

>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed	Back alignment and domain information

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional	Back alignment and domain information

>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT)	Back alignment and domain information

>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional	Back alignment and domain information

>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 []	Back alignment and domain information

>PTZ00338 dimethyladenosine transferase-like protein; Provisional	Back alignment and domain information

>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed	Back alignment and domain information

>PLN02823 spermine synthase	Back alignment and domain information

>TIGR00755 ksgA dimethyladenosine transferase	Back alignment and domain information

>PRK11727 23S rRNA mA1618 methyltransferase; Provisional	Back alignment and domain information

>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins	Back alignment and domain information

>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]	Back alignment and domain information

>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes	Back alignment and domain information

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed	Back alignment and domain information

>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed	Back alignment and domain information

>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family	Back alignment and domain information

>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG4122 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PF13679 Methyltransf_32: Methyltransferase domain	Back alignment and domain information

>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3)	Back alignment and domain information

>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PRK11524 putative methyltransferase; Provisional	Back alignment and domain information

>PLN02476 O-methyltransferase	Back alignment and domain information

>PLN02589 caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2	Back alignment and domain information

>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []	Back alignment and domain information

>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only]	Back alignment and domain information

>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		359
1m6e_X		359	Crystal Structure Of Salicylic Acid Carboxyl Methyl		4e-42
2eg5_A		372	The Structure Of Xanthosine Methyltransferase Lengt		8e-41
3b5i_A		374	Crystal Structure Of Indole-3-Acetic Acid Methyltra		1e-39
2efj_A		384	The Structure Of 1,7 Dimethylxanthine Methyltransfe		6e-37

>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359

Back alignment and structure

Iteration: 1

Score = 168 bits (426), Expect = 4e-42, Method: Compositional matrix adjust. Identities = 122/365 (33%), Positives = 176/365 (48%), Gaps = 33/365 (9%) Query: 11 MMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYT-VRIADLGCSVG 69 M GG G SYA NS QR + K + AI Y D T + IADLGCS G Sbjct: 9 MKGGAGENSYAMNSFIQRQVISITKPITEAAIT-----ALYSGDTVTTRLAIADLGCSSG 63 Query: 70 PNTFISVQNIIEALEFKFQNLSLP-VPDFQVFFNDHTENDFNTLFRTLPPRK-----YYA 123 PN +V +I+ +E + + P++Q+F ND NDFN +FR+LP + Sbjct: 64 PNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIENDVDGVCFI 123 Query: 124 AGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFM-KGVH 182 GVPGSF+GRLFP++TLH ++S ++ WLS+ P +E N+G+I + V Sbjct: 124 NGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVP------IGIESNKGNIYMANTCPQSVL 177 Query: 183 ETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDL 242 + QF+ D L RA+E+VPGG MV +++ G A T + L L + Sbjct: 178 NAYYKQFQEDHALFLRCRAQEVVPGGRMVLTIL-GRRSEDRASTECCLIWQLLAMALNQM 236 Query: 243 AKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMRHKTFPAQFYLS 302 G+I EEK FN+P Y P E+E+ I + G F ++ ++ + T S Sbjct: 237 VSEGLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDHIEASEIYWSSCTKDGDGGGS 296 Query: 303 ----------HLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVV 352 +RAV E L+ HFGE ++E++F+ E +S K I V V Sbjct: 297 VEEEGYNVARCMRAVAEPLLLDHFGEAIIEDVFHRYKLLIIERMSKEKTKF---INVIVS 353 Query: 353 LKRIS 357 L R S Sbjct: 354 LIRKS 358

PyMOL of 1m6e

>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372

Back alignment and structure

>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374

Back alignment and structure

>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		359
3b5i_A		374	S-adenosyl-L-methionine:salicylic acid carboxyl me	3e-87
1m6e_X		359	S-adenosyl-L-methionnine:salicylic acid carboxyl m	2e-84
2efj_A		384	3,7-dimethylxanthine methyltransferase; SAM-depend	4e-84

>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374	Back alignment and structure

 Score =  267 bits (683), Expect = 3e-87
 Identities = 103/382 (26%), Positives = 169/382 (44%), Gaps = 33/382 (8%)

Query: 1   MAVDEVVTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVR 60
           M ++ +    M GG G  SYA+NS  Q     +   L+ E + N     S    +     
Sbjct: 1   MKLERL--LSMKGGKGQDSYANNSLAQAMHARSMLHLLEETLENVHLNSS---ASPPPFT 55

Query: 61  IADLGCSVGPNTFISVQNIIEALEFKFQNLSLPVPDFQVFFNDHTENDFNTLFRTLP--- 117
             DLGCS G NT   +  I++ +  +F    +  P+F  FF+D   NDFNTLF+ LP   
Sbjct: 56  AVDLGCSSGANTVHIIDFIVKHISKRFDAAGIDPPEFTAFFSDLPSNDFNTLFQLLPPLV 115

Query: 118 -------------PRKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKS 164
                         R Y+ AGVPGSF+ RLFP  T+   +S  ++HWLS+ P+     +S
Sbjct: 116 SNTCMEECLAADGNRSYFVAGVPGSFYRRLFPARTIDFFHSAFSLHWLSQVPESVTDRRS 175

Query: 165 LEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFA 224
             +N+G +      +     ++ QF++D    L ARA E+  GG M    +   S  P  
Sbjct: 176 AAYNRGRVFIHGAGEKTTTAYKRQFQADLAEFLRARAAEVKRGGAMFLVCLGRTSVDPTD 235

Query: 225 DTVQGATYN-FLGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERM 283
               G  +         DL + G+++ EK   FN+P Y P +++ + ++  NG FA++++
Sbjct: 236 QGGAGLLFGTHFQDAWDDLVREGLVAAEKRDGFNIPVYAPSLQDFKEVVDANGSFAIDKL 295

Query: 284 QQLDQPMRHKT-------FPAQFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEIL 336
                                + + S  R+V   L+  H GEEL   +F+ +        
Sbjct: 296 VVYKGGSPLVVNEPDDASEVGRAFASSCRSVAGVLVEAHIGEELSNKLFSRV----ESRA 351

Query: 337 SIHNGKLHKEIEVFVVLKRISK 358
           + H   +   ++ F ++  +S 
Sbjct: 352 TSHAKDVLVNLQFFHIVASLSF 373

PyMOL of 3b5i

>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359	Back alignment and structure

>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		359
1m6e_X		359	S-adenosyl-L-methionnine:salicylic acid carboxyl m	100.0
2efj_A		384	3,7-dimethylxanthine methyltransferase; SAM-depend	100.0
3b5i_A		374	S-adenosyl-L-methionine:salicylic acid carboxyl me	100.0
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	99.72
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	99.68
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	99.68
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	99.45
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	99.42
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	99.36
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	99.35
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	99.33
3f4k_A		257	Putative methyltransferase; structural genomics, P	99.32
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	99.31
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	99.29
3ege_A		261	Putative methyltransferase from antibiotic biosyn	99.28
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	99.28
1xxl_A		239	YCGJ protein; structural genomics, protein structu	99.27
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	99.27
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	99.27
2aot_A		292	HMT, histamine N-methyltransferase; classic methyl	99.26
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	99.25
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	99.25
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	99.25
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	99.24
4hg2_A		257	Methyltransferase type 11; structural genomics, PS	99.23
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	99.21
3lcc_A		235	Putative methyl chloride transferase; halide methy	99.18
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	99.18
2g72_A		289	Phenylethanolamine N-methyltransferase; HET: SAM F	99.18
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	99.17
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	99.15
2p7i_A		250	Hypothetical protein; putative methyltransferase,	99.14
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	99.13
2a14_A		263	Indolethylamine N-methyltransferase; SGC,INMT, str	99.13
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	99.13
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	99.12
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	99.12
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	99.12
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	99.12
1pjz_A		203	Thiopurine S-methyltransferase; polymorphism, S-ad	99.1
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	99.1
3cc8_A		230	Putative methyltransferase; structural genomics, j	99.09
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	99.08
3ocj_A		305	Putative exported protein; structural genomics, PS	99.07
1vlm_A		219	SAM-dependent methyltransferase; possible histamin	99.06
3bkx_A		275	SAM-dependent methyltransferase; YP_807781.1, cycl	99.05
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	99.05
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	99.03
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	99.03
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	99.01
3i53_A		332	O-methyltransferase; CO-complex, rossmann-like fol	99.01
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	99.01
3bgv_A		313	MRNA CAP guanine-N7 methyltransferase; alternative	99.01
3gwz_A		369	MMCR; methyltransferase, mitomycin, S-adenosyl met	99.0
3lst_A		348	CALO1 methyltransferase; calicheamicin, enediyne,	99.0
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	98.99
3mcz_A		352	O-methyltransferase; adomet_mtases, S-adenosylmeth	98.99
2qe6_A		274	Uncharacterized protein TFU_2867; putative methylt	98.99
2ip2_A		334	Probable phenazine-specific methyltransferase; pyo	98.98
4e2x_A		416	TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s	98.98
3reo_A		368	(ISO)eugenol O-methyltransferase; directed evoluti	98.96
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	98.96
3pfg_A		263	N-methyltransferase; N,N-dimethyltransferase, SAM	98.95
2r3s_A		335	Uncharacterized protein; methyltransferase domain,	98.94
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	98.94
3dp7_A		363	SAM-dependent methyltransferase; structural genomi	98.94
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	98.94
3jwg_A		219	HEN1, methyltransferase type 12; 1.90A {Clostridiu	98.94
3g2m_A		299	PCZA361.24; SAM-dependent methyltransferase, glyco	98.94
3jwh_A		217	HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena	98.93
3p9c_A		364	Caffeic acid O-methyltransferase; S-adenosylmethio	98.9
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	98.9
4a6d_A		353	Hydroxyindole O-methyltransferase; melatonin, circ	98.89
3i9f_A		170	Putative type 11 methyltransferase; structural gen	98.88
2vdw_A		302	Vaccinia virus capping enzyme D1 subunit; nucleoti	98.88
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	98.88
1qzz_A		374	RDMB, aclacinomycin-10-hydroxylase; anthracycline,	98.87
3bxo_A		239	N,N-dimethyltransferase; desosamine, sugar, carboh	98.87
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	98.86
3giw_A		277	Protein of unknown function DUF574; rossmann-fold	98.85
2zfu_A		215	Nucleomethylin, cerebral protein 1; nucleolar prot	98.85
1tw3_A		360	COMT, carminomycin 4-O-methyltransferase; anthracy	98.83
1fp1_D		372	Isoliquiritigenin 2'-O-methyltransferase; protein-	98.82
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	98.79
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	98.79
3ggd_A		245	SAM-dependent methyltransferase; YP_325210.1, stru	98.78
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	98.77
1x19_A		359	CRTF-related protein; methyltransferase, bacterioc	98.74
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	98.74
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	98.73
3opn_A		232	Putative hemolysin; structural genomics, PSI-2, pr	98.72
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	98.72
3g07_A		292	7SK snRNA methylphosphate capping enzyme; structur	98.72
3hp7_A		291	Hemolysin, putative; structural genomics, APC64019	98.71
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	98.71
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	98.68
2ld4_A		176	Anamorsin; methyltransferase-like fold, alpha/beta	98.66
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	98.66
1zg3_A		358	Isoflavanone 4'-O-methyltransferase; rossman fold,	98.65
1fp2_A		352	Isoflavone O-methyltransferase; protein-product co	98.65
3mq2_A		218	16S rRNA methyltransferase; methyltranferase, ribo	98.61
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	98.58
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	98.58
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	98.55
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	98.52
3iv6_A		261	Putative Zn-dependent alcohol dehydrogenase; alpha	98.5
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	98.46
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	98.44
3q7e_A		349	Protein arginine N-methyltransferase 1; HET: SAH;	98.44
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	98.43
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	98.42
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	98.41
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	98.41
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	98.4
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	98.35
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	98.33
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	98.33
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	98.32
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	98.32
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	98.31
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	98.3
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	98.3
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	98.3
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	98.29
2fca_A		213	TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac	98.29
3lpm_A		259	Putative methyltransferase; structural genomics, p	98.24
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	98.23
2fyt_A		340	Protein arginine N-methyltransferase 3; structural	98.23
3p2e_A		225	16S rRNA methylase; methyltransferase, transferase	98.23
4dcm_A		375	Ribosomal RNA large subunit methyltransferase G; 2	98.22
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	98.22
3ckk_A		235	TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-	98.2
2b3t_A		276	Protein methyltransferase HEMK; translation termin	98.2
1af7_A		274	Chemotaxis receptor methyltransferase CHER; chemot	98.2
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	98.17
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	98.17
4dzr_A		215	Protein-(glutamine-N5) methyltransferase, release	98.17
3sso_A		419	Methyltransferase; macrolide, natural product, ros	98.15
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	98.14
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	98.13
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	98.12
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	98.12
2yxd_A		183	Probable cobalt-precorrin-6Y C(15)-methyltransfer	98.12
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	98.09
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	98.08
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	98.08
1g6q_1		328	HnRNP arginine N-methyltransferase; SAM-binding do	98.07
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	98.07
3fzg_A		200	16S rRNA methylase; methyltransferase, plasmid, tr	98.07
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	98.06
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	98.06
3htx_A		950	HEN1; HEN1, small RNA methyltransferase, protein-R	98.05
2esr_A		177	Methyltransferase; structural genomics, hypothetic	98.05
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	97.97
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	97.96
2frn_A		278	Hypothetical protein PH0793; structural genomics,	97.94
4hc4_A		376	Protein arginine N-methyltransferase 6; HRMT1L6, S	97.93
3uwp_A		438	Histone-lysine N-methyltransferase, H3 lysine-79;	97.93
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	97.93
3gdh_A		241	Trimethylguanosine synthase homolog; M7G, CAP, dim	97.92
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	97.91
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	97.91
2b25_A		336	Hypothetical protein; structural genomics, methyl	97.9
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	97.9
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	97.87
1dl5_A		317	Protein-L-isoaspartate O-methyltransferase; isoasp	97.86
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	97.85
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	97.85
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	97.83
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	97.83
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	97.83
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	97.82
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	97.81
3fpf_A		298	Mtnas, putative uncharacterized protein; thermonic	97.81
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	97.8
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	97.8
3u81_A		221	Catechol O-methyltransferase; neurotransmitter deg	97.78
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	97.77
2h00_A		254	Methyltransferase 10 domain containing protein; st	97.75
2y1w_A		348	Histone-arginine methyltransferase CARM1; histone	97.74
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	97.7
1u2z_A		433	Histone-lysine N-methyltransferase, H3 lysine-79 s	97.68
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	97.68
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	97.67
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	97.66
1ws6_A		171	Methyltransferase; structural genomics, riken stru	97.66
2wa2_A		276	Non-structural protein 5; transferase, S-adenosyl-	97.66
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	97.65
3bzb_A		281	Uncharacterized protein; RED ALGA, protein structu	97.62
2xyq_A		290	Putative 2'-O-methyl transferase; transferase-vira	97.62
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	97.62
2gpy_A		233	O-methyltransferase; structural genomics, PSI, pro	97.61
2oxt_A		265	Nucleoside-2'-O-methyltransferase; flavivirus, vir	97.6
1ixk_A		315	Methyltransferase; open beta sheet; 1.90A {Pyrococ	97.59
2p41_A		305	Type II methyltransferase; vizier, viral enzymes i	97.59
3tfw_A		248	Putative O-methyltransferase; PSI-biology, nysgrc,	97.58
2bm8_A		236	Cephalosporin hydroxylase CMCI; cephamycin biosynt	97.56
1sqg_A		429	SUN protein, FMU protein; rossmann-fold, mixed bet	97.54
3tma_A		354	Methyltransferase; thump domain; 2.05A {Thermus th	97.5
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	97.5
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	97.5
3r3h_A		242	O-methyltransferase, SAM-dependent; structural gen	97.46
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	97.45
3b3j_A		480	Histone-arginine methyltransferase CARM1; protein	97.41
3duw_A		223	OMT, O-methyltransferase, putative; alternating of	97.41
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	97.37
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	97.37
2o07_A		304	Spermidine synthase; structural genomics, structur	97.34
3ajd_A		274	Putative methyltransferase MJ0026; tRNA, M5C, ross	97.33
2igt_A		332	SAM dependent methyltransferase; alpha-beta sandwi	97.31
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	97.31
2pt6_A		321	Spermidine synthase; transferase, structural genom	97.31
1zq9_A		285	Probable dimethyladenosine transferase; SGC, struc	97.3
2frx_A		479	Hypothetical protein YEBU; rossmann-type S-adenosy	97.3
3kr9_A		225	SAM-dependent methyltransferase; class I rossmann-	97.29
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	97.28
3tr6_A		225	O-methyltransferase; cellular processes; HET: SAH;	97.27
2hnk_A		239	SAM-dependent O-methyltransferase; modified rossma	97.26
3lec_A		230	NADB-rossmann superfamily protein; PSI, MCSG, stru	97.26
1sui_A		247	Caffeoyl-COA O-methyltransferase; rossmann fold, p	97.25
3lcv_B		281	Sisomicin-gentamicin resistance methylase SGM; ant	97.23
2i7c_A		283	Spermidine synthase; transferase, structural genom	97.2
2yxl_A		450	PH0851 protein, 450AA long hypothetical FMU protei	97.18
3m6w_A		464	RRNA methylase; rRNA methyltransferase, 5-methylcy	97.17
1ne2_A		200	Hypothetical protein TA1320; structural genomics,	97.14
3c3p_A		210	Methyltransferase; NP_951602.1, structural genomic	97.14
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	97.13
3c3y_A		237	Pfomt, O-methyltransferase; plant secondary metabo	97.1
1nv8_A		284	HEMK protein; class I adoMet-dependent methyltrans	97.1
3frh_A		253	16S rRNA methylase; methyltransferase domain, heli	97.09
3a27_A		272	TYW2, uncharacterized protein MJ1557; wybutosine m	97.07
2f8l_A		344	Hypothetical protein LMO1582; structural genomics,	97.0
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	96.92
3cbg_A		232	O-methyltransferase; cyanobacterium; HET: SAH FER	96.91
2avd_A		229	Catechol-O-methyltransferase; structural genomics,	96.88
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	96.82
2ih2_A		421	Modification methylase TAQI; DNA, DNA methyltransf	96.8
3tm4_A		373	TRNA (guanine N2-)-methyltransferase TRM14; rossma	96.76
3m4x_A		456	NOL1/NOP2/SUN family protein; mtase domain, PUA do	96.73
3gnl_A		244	Uncharacterized protein, DUF633, LMOF2365_1472; st	96.72
2cmg_A		262	Spermidine synthase; transferase, putrescine amino	96.66
2qm3_A		373	Predicted methyltransferase; putative methyltransf	96.65
2b78_A		385	Hypothetical protein SMU.776; structure genomics,	96.58
2as0_A		396	Hypothetical protein PH1915; RNA methyltransferase	96.51
3k6r_A		278	Putative transferase PH0793; structural genomics,	96.5
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	96.44
2yx1_A		336	Hypothetical protein MJ0883; methyl transferase, t	96.29
1yub_A		245	Ermam, rRNA methyltransferase; MLS antibiotics; NM	96.22
3gru_A		295	Dimethyladenosine transferase; rossman fold, ribos	96.08
4gqb_A		637	Protein arginine N-methyltransferase 5; TIM barrel	95.94
3evf_A		277	RNA-directed RNA polymerase NS5; NS5 methyltransfe	95.91
2h1r_A		299	Dimethyladenosine transferase, putative; SGC toron	95.91
3tqs_A		255	Ribosomal RNA small subunit methyltransferase A; p	95.87
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	95.82
2okc_A		445	Type I restriction enzyme stysji M protein; NP_813	95.78
3khk_A		544	Type I restriction-modification system methylation	95.58
4azs_A		569	Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15	95.44
1qam_A		244	ERMC' methyltransferase; rRNA methyltransferase ER	95.32
3ua3_A		745	Protein arginine N-methyltransferase 5; TIM-barrel	95.16
2jjq_A		425	Uncharacterized RNA methyltransferase pyrab10780;	94.96
2qfm_A		364	Spermine synthase; spermidine aminopropyltransfera	94.94
3ldu_A		385	Putative methylase; structural genomics, PSI-2, pr	94.64
3s1s_A		878	Restriction endonuclease bpusi; PD--(D/E)XK cataly	94.5
3lkd_A		542	Type I restriction-modification system methyltrans	94.37
3fut_A		271	Dimethyladenosine transferase; methyltransferase,	94.37
3gcz_A		282	Polyprotein; flavivirus, RNA capping, methyltransf	94.3
1uwv_A		433	23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m	94.25
3ldg_A		384	Putative uncharacterized protein SMU.472; YPSC, me	94.25
3k0b_A		393	Predicted N6-adenine-specific DNA methylase; methy	94.14
2dul_A		378	N(2),N(2)-dimethylguanosine tRNA methyltransferas;	93.91
2b9e_A		309	NOL1/NOP2/SUN domain family, member 5 isoform 2; m	93.32
2ar0_A		541	M.ecoki, type I restriction enzyme ecoki M protein	92.54
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	91.54
3ftd_A		249	Dimethyladenosine transferase; KSGA, rossmann-like	91.42
1qyr_A		252	KSGA, high level kasugamycin resistance protein, S	91.36
3eld_A		300	Methyltransferase; flavivirus, RNA capping, guanyl	91.31
3uzu_A		279	Ribosomal RNA small subunit methyltransferase A; s	91.26
2wk1_A		282	NOVP; transferase, O-methyltransferase, novobiocin	90.25
2zig_A		297	TTHA0409, putative modification methylase; methylt	90.18
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	89.56
3lkz_A		321	Non-structural protein 5; flavivirus, methyltransf	85.77
2px2_A		269	Genome polyprotein [contains: capsid protein C (co	85.33
3o4f_A		294	Spermidine synthase; aminopropyltransferase, polya	84.62
2qy6_A		257	UPF0209 protein YFCK; structural genomics, unknown	83.99
4auk_A		375	Ribosomal RNA large subunit methyltransferase M; Y	82.59
2k4m_A		153	TR8_protein, UPF0146 protein MTH_1000; alpha+beta,	82.39

>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35	Back alignment and structure

Probab=100.00  E-value=9.4e-92  Score=687.29  Aligned_cols=340  Identities=34%  Similarity=0.531  Sum_probs=308.0

Q ss_pred             ccc-eeeeccCCCCccchHHhhHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCcceEEEeecCCCCcccHHHHHHHHHH
Q 018250            4 DEV-VTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVRIADLGCSVGPNTFISVQNIIEA   82 (359)
Q Consensus         4 ~~~-~~~~M~gG~g~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~~~~~~~~~~~~~IaDlGCs~G~nt~~~~~~ii~~   82 (359)
                      |++ ++|||+||+|++||++||.+|++++..++|++++||.+++....    .+++++|||||||+|+||+.+++.||++
T Consensus         1 m~~~~~~~m~gg~G~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~~~----~~~~~~IaDlGCs~G~Nt~~~v~~ii~~   76 (359)
T 1m6e_X            1 MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDT----VTTRLAIADLGCSSGPNALFAVTELIKT   76 (359)
T ss_dssp             CCCHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSSS----SSSEECCEEESCCSSTTTTTGGGTTHHH
T ss_pred             CCcccccccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhhccC----CCCceEEEecCCCCCcchHHHHHHHHHH
Confidence            344 67999999999999999999999999999999999998664211    2578999999999999999999999999


Q ss_pred             HHHHhhcCCC-CCCCceEEecCCCCCchHHHHHhCCC-----CcccccccCcccccCCCCCCceeEEEecCcccccCCCC
Q 018250           83 LEFKFQNLSL-PVPDFQVFFNDHTENDFNTLFRTLPP-----RKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTP  156 (359)
Q Consensus        83 ~~~~~~~~~~-~~p~~~v~~nDLp~NDFn~lf~~l~~-----~~~~~~~vpgsfy~~l~p~~s~d~~~S~~alHWLs~~p  156 (359)
                      |+++|.+.+. +.|++||++||||+||||+||++|+.     .+||++|||||||+||||++|+|++||++||||||++|
T Consensus        77 i~~~~~~~~~~~~pe~~v~~nDLp~NDFntlF~~L~~~~~~~~~~f~~gvpgSFy~rlfp~~S~d~v~Ss~aLHWls~~p  156 (359)
T 1m6e_X           77 VEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVP  156 (359)
T ss_dssp             HHHHHHSSSCSSCCEEEEEEEECTTSCHHHHHTTTTTSCSCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCC
T ss_pred             HHHHHHhcCCCCCCceEEEecCCCchHHHHHHHhcchhcccCCCEEEEecchhhhhccCCCCceEEEEehhhhhhcccCc
Confidence            9999976654 68999999999999999999999985     46999999999999999999999999999999999999


Q ss_pred             cccccccccccCCCceeecCC-CHHHHHHHHHHHHHHHHHHHHHHHHhhccCceeEEEeccCCCCCCCCCcchhHHHHHH
Q 018250          157 KVNMLEKSLEWNQGSIKCTRF-MKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFL  235 (359)
Q Consensus       157 ~~~~~~~~~~~n~g~i~~~~~-~~~~~~~y~~Q~~~D~~~fL~~Ra~EL~pGG~lvl~~~g~~~~~~~~~~~~~~~~~~l  235 (359)
                      +.+.+      |||+|||+++ ||+|.+||++||++||..||++|++||||||+||++++|+++.++.++. .+.+|+.|
T Consensus       157 ~~l~~------nkg~i~~~~~~p~~v~~ay~~Qf~~D~~~FL~~Ra~EL~pGG~mvl~~~gr~~~~~~~~~-~~~~~~~l  229 (359)
T 1m6e_X          157 IGIES------NKGNIYMANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTE-CCLIWQLL  229 (359)
T ss_dssp             SCCCC------CTTTTSSCSSSCCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSSTT-TSTTTHHH
T ss_pred             hhhhc------cCCceEecCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCceEEEEEecCCCCCccccc-hHHHHHHH
Confidence            99887      9999999865 7889999999999999999999999999999999999999998766553 45678999


Q ss_pred             HHHHHHHHHcCCCChhhhccCCccccCCCHHHHHHHHHhCCceeEeEEEEeecCCCCCC----------CChhHHHHHHH
Q 018250          236 GSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMRHKT----------FPAQFYLSHLR  305 (359)
Q Consensus       236 ~~al~~lv~eGli~~e~~d~f~~P~y~ps~~E~~~~i~~~G~F~i~~le~~~~~~~~~~----------~~~~~v~~~iR  305 (359)
                      .++|++||.+|+|+++++|+|++|||+||.+||+++|+++|+|+|+++|.+++.....+          ..++.+++++|
T Consensus       230 ~~al~~mv~eGli~~ek~d~f~~P~y~ps~~E~~~~ie~~G~F~i~~~e~~~~~~~~~~~~~d~~~~~~~~g~~~a~~~R  309 (359)
T 1m6e_X          230 AMALNQMVSEGLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDHIEASEIYWSSCTKDGDGGGSVEEEGYNVARCMR  309 (359)
T ss_dssp             HHHHHHHHHTTCSCCSTTGGGCCCCBCCCSHHHHHHHHHTTTBCCEEEEEEEEETTCCSSCTTCCSSTTTTTTHHHHHHH
T ss_pred             HHHHHHHHHccccchhhhhccCCCccCCCHHHHHHHHHHcCCceEEEEEEEeeccCcccchhhhhhhhhHhHhHhhhhhh
Confidence            99999999999999999999999999999999999999999999999999865322110          23578999999


Q ss_pred             HHhhhhhhhccCHHHHHHHHHHHHHHHHHHhhhhhcCCcceEEEEEEEEecc
Q 018250          306 AVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLKRIS  357 (359)
Q Consensus       306 a~~~~~l~~~~~e~i~delf~r~~~~~~~~~~~~~~~~~~~~~~~~~l~r~~  357 (359)
                      |+.+|++.+|||++++|++|+||++++.++++.   ...++++++++|+|+.
T Consensus       310 a~~e~ll~~hfG~~i~d~lf~ry~~~~~~~~~~---~~~~~~~~~~~L~k~~  358 (359)
T 1m6e_X          310 AVAEPLLLDHFGEAIIEDVFHRYKLLIIERMSK---EKTKFINVIVSLIRKS  358 (359)
T ss_dssp             HHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHS---SCCEEEEEEEEEEBCC
T ss_pred             hhcchhhHHhccHHHHHHHHHHHHHHHHHHHhh---CCCceEEEEEEEEeCC
Confidence            999999999999999999999999999998875   4578999999999985

PyMOL of 1m6e

>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A*	Back alignment and structure

>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana}	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans}	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ...	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei}	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42	Back alignment and structure

>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A*	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*	Back alignment and structure

>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A*	Back alignment and structure

>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora}	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca}	Back alignment and structure

>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa}	Back alignment and structure

>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A*	Back alignment and structure

>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A*	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A*	Back alignment and structure

>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme}	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus}	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A	Back alignment and structure

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*	Back alignment and structure

>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A	Back alignment and structure

>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A*	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A*	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus}	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A*	Back alignment and structure

>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A*	Back alignment and structure

>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}	Back alignment and structure

>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A*	Back alignment and structure

>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A*	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A*	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}	Back alignment and structure

>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus}	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A*	Back alignment and structure

>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A*	Back alignment and structure

>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP}	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides}	Back alignment and structure

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A*	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A*	Back alignment and structure

>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A*	Back alignment and structure

>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli}	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A*	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A*	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli}	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana}	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens}	Back alignment and structure

>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A*	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A*	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ...	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54	Back alignment and structure

>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A*	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae}	Back alignment and structure

>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A*	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans}	Back alignment and structure

>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus}	Back alignment and structure

>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38	Back alignment and structure

>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A*	Back alignment and structure

>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A*	Back alignment and structure

>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A	Back alignment and structure

>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus}	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp}	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus}	Back alignment and structure

>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A	Back alignment and structure

>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24	Back alignment and structure

>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli}	Back alignment and structure

>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A*	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}	Back alignment and structure

>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae}	Back alignment and structure

>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*	Back alignment and structure

>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A*	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii}	Back alignment and structure

>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A*	Back alignment and structure

>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32	Back alignment and structure

>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca}	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum}	Back alignment and structure

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*	Back alignment and structure

>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A*	Back alignment and structure

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus}	Back alignment and structure

>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP}	Back alignment and structure

>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*	Back alignment and structure

>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*	Back alignment and structure

>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A*	Back alignment and structure

>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}	Back alignment and structure

>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A*	Back alignment and structure

>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51	Back alignment and structure

>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A*	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A*	Back alignment and structure

>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24	Back alignment and structure

>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A*	Back alignment and structure

>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A*	Back alignment and structure

>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A*	Back alignment and structure

>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum}	Back alignment and structure

>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}	Back alignment and structure

>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45	Back alignment and structure

>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei}	Back alignment and structure

>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A*	Back alignment and structure

>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A	Back alignment and structure

>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A	Back alignment and structure

>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A*	Back alignment and structure

>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile}	Back alignment and structure

>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus}	Back alignment and structure

>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}	Back alignment and structure

>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A*	Back alignment and structure

>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus}	Back alignment and structure

>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A*	Back alignment and structure

>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans}	Back alignment and structure

>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A*	Back alignment and structure

>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38	Back alignment and structure

>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B*	Back alignment and structure

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A*	Back alignment and structure

>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B*	Back alignment and structure

>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A	Back alignment and structure

>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A*	Back alignment and structure

>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei}	Back alignment and structure

>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus}	Back alignment and structure

>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus}	Back alignment and structure

>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A*	Back alignment and structure

>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli}	Back alignment and structure

>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli}	Back alignment and structure

>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A*	Back alignment and structure

>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		359
d1m6ex_		359	c.66.1.35 (X:) Salicylic acid carboxyl methyltrans	1e-100

>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

 Score =  299 bits (766), Expect = e-100
 Identities = 119/372 (31%), Positives = 176/372 (47%), Gaps = 33/372 (8%)

Query: 1   MAVDEVVTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVR 60
           M V +V    M GG G  SYA NS  QR  +   K +   AI       +     +  + 
Sbjct: 1   MDVRQV--LHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDT----VTTRLA 54

Query: 61  IADLGCSVGPNTFISVQNIIEALEFKFQNLS-LPVPDFQVFFNDHTENDFNTLFRTLPP- 118
           IADLGCS GPN   +V  +I+ +E   + +     P++Q+F ND   NDFN +FR+LP  
Sbjct: 55  IADLGCSSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIE 114

Query: 119 ----RKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSI-K 173
                  +  GVPGSF+GRLFP++TLH ++S  ++ WLS+ P        +E N+G+I  
Sbjct: 115 NDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPI------GIESNKGNIYM 168

Query: 174 CTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYN 233
                + V   +  QF+ D    L  RA+E+VPGG MV +++   S      T     + 
Sbjct: 169 ANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRA-STECCLIWQ 227

Query: 234 FLGSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMRHK 293
            L   L  +   G+I EEK   FN+P Y P   E+E+ I + G F ++ ++  +      
Sbjct: 228 LLAMALNQMVSEGLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDHIEASEIYWSSC 287

Query: 294 TFP----------AQFYLSHLRAVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKL 343
           T                   +RAV E L+  HFGE ++E++F+       E +S    K 
Sbjct: 288 TKDGDGGGSVEEEGYNVARCMRAVAEPLLLDHFGEAIIEDVFHRYKLLIIERMSKEKTKF 347

Query: 344 HKEIEVFVVLKR 355
              I V V L R
Sbjct: 348 ---INVIVSLIR 356

PyMOL of d1m6ex_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		359
d1m6ex_		359	Salicylic acid carboxyl methyltransferase (SAMT) {	100.0
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	99.48
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	99.43
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	99.43
d2a14a1		257	Indolethylamine N-methyltransferase, INMT {Human (	99.38
d1vlma_		208	Possible histamine N-methyltransferase TM1293 {The	99.37
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	99.37
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	99.34
d1xtpa_		254	Hypothetical protein Lmaj004091aaa (LmjF30.0810) {	99.33
d2fk8a1		280	Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri	99.32
d1jqea_		280	Histamine methyltransferase {Human (Homo sapiens)	99.3
d2ex4a1		222	Adrenal gland protein AD-003 (C9orf32) {Human (Hom	99.29
d1tw3a2		253	Carminomycin 4-O-methyltransferase {Streptomyces p	99.25
d2g72a1		263	Phenylethanolamine N-methyltransferase, PNMTase {H	99.24
d1nkva_		245	Hypothetical Protein YjhP {Escherichia coli [TaxId	99.2
d1kpia_		291	CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	99.18
d1pjza_		201	Thiopurine S-methyltransferase {Pseudomonas syring	99.15
d1kpga_		285	CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	99.12
d2p7ia1		225	Hypothetical protein ECA1738 {Erwinia carotovora [	99.06
d2bzga1		229	Thiopurine S-methyltransferase {Human (Homo sapien	99.05
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	99.02
d1qzza2		256	Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu	99.02
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	98.96
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	98.93
d1y8ca_		246	Putative methyltransferase CAC2371 {Clostridium ac	98.9
d2i6ga1		198	Putative methyltransferase TehB {Salmonella typhim	98.89
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	98.87
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	98.85
d1fp1d2		244	Chalcone O-methyltransferase {Alfalfa (Medicago sa	98.85
d1kyza2		243	Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra	98.7
d1fp2a2		244	Isoflavone O-methyltransferase {Alfalfa (Medicago	98.59
d1xvaa_		292	Glycine N-methyltransferase {Rat (Rattus norvegicu	98.56
d2fcaa1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil	98.53
d1g8sa_		230	Fibrillarin homologue {Archaeon Methanococcus jann	98.53
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	98.43
d1yzha1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep	98.43
d1g6q1_		328	Arginine methyltransferase, HMT1 {Baker's yeast (S	98.38
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	98.38
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	98.36
d1oria_		316	Protein arginine N-methyltransferase 1, PRMT1 {Rat	98.36
d2fyta1		311	Protein arginine N-methyltransferase 3, PRMT3 {Hum	98.23
d1i1na_		224	Protein-L-isoaspartyl O-methyltransferase {Human (	98.21
d1nt2a_		209	Fibrillarin homologue {Archaeon Archaeoglobus fulg	98.19
d1g8aa_		227	Fibrillarin homologue {Archaeon Pyrococcus horikos	98.16
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	98.15
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	98.11
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	98.09
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	98.07
d1nw3a_		328	Catalytic, N-terminal domain of histone methyltran	97.95
d2b3ta1		274	N5-glutamine methyltransferase, HemK {Escherichia	97.74
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	97.73
d1o54a_		266	Hypothetical protein TM0748 {Thermotoga maritima [	97.68
d1u2za_		406	Catalytic, N-terminal domain of histone methyltran	97.6
d1af7a2		193	Chemotaxis receptor methyltransferase CheR, C-term	97.6
d1r18a_		223	Protein-L-isoaspartyl O-methyltransferase {Fruit f	97.48
d1jg1a_		215	Protein-L-isoaspartyl O-methyltransferase {Archaeo	97.32
d2b25a1		324	Hypothetical protein FLJ20628 {Human (Homo sapiens	97.25
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	97.01
d2frna1		260	Hypothetical protein PH0793 {Pyrococcus horikoshii	96.59
d1ws6a1		171	Methyltransferase TTHA0928 {Thermus thermophilus [	96.55
d2as0a2		324	Hypothetical protein PH1915, middle and C-terminal	96.5
d2h00a1		250	Methyltransferase 10 domain containing protein MET	96.38
d2esra1		152	Putative methyltransferase SPy1538 {Streptococcus	96.32
d1m6ya2		192	TM0872, methyltransferase domain {Thermotoga marit	95.85
d2igta1		309	Putative methyltransferase Atu0340 {Agrobacterium	95.67
d2f8la1		328	Hypothetical protein Lmo1582 {Listeria monocytogen	95.6
d1ne2a_		197	Hypothetical protein Ta1320 {Archaeon Thermoplasma	95.46
d2fpoa1		183	Methylase YhhF {Escherichia coli [TaxId: 562]}	95.4
d1nv8a_		271	N5-glutamine methyltransferase, HemK {Thermotoga m	95.12
d1wy7a1		201	Hypothetical protein PH1948 {Archaeon Pyrococcus h	94.99
d2b78a2		317	Hypothetical protein SMu776, middle and C-terminal	94.87
d2ih2a1		223	DNA methylase TaqI, N-terminal domain {Thermus aqu	94.59
d2cl5a1		214	Catechol O-methyltransferase, COMT {Rat (Rattus no	93.71
d1qama_		235	rRNA adenine dimethylase {Bacillus subtilis, Ermc'	92.88
d2ifta1		183	Putative methylase HI0767 {Haemophilus influenzae	92.56
d1ej0a_		180	RNA methyltransferase FtsJ {Escherichia coli [TaxI	91.65
d2avda1		219	COMT domain-containing protein 1, COMTD1 {Human (H	90.59
d1yuba_		245	rRNA adenine dimethylase {Streptococcus pneumoniae	90.57
d1uira_		312	Spermidine synthase {Thermus thermophilus [TaxId:	89.86
d1mjfa_		276	Putative spermidine synthetase PF0127 (SpeE) {Arch	88.96
d2okca1		425	Type I restriction enzyme StySJI M protein {Bacter	88.35
d1g60a_		256	Methyltransferase mboII {Moraxella bovis [TaxId: 4	88.31
d1eg2a_		279	m.RsrI N6 adenosine-specific DNA methyltransferase	87.63
d1susa1		227	Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag	87.61
d1sqga2		284	Ribosomal RNA small subunit methyltransferase B, R	87.34
d1qyra_		252	High level kasugamycin resistance protein KsgA {Es	85.34

>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

Probab=100.00  E-value=1.3e-97  Score=724.38  Aligned_cols=340  Identities=34%  Similarity=0.532  Sum_probs=308.6

Q ss_pred             ccc-eeeeccCCCCccchHHhhHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCcceEEEeecCCCCcccHHHHHHHHHH
Q 018250            4 DEV-VTFPMMGGDGTCSYAHNSQFQRGTVDAAKELVREAIVNKLDVGSYGYDNSYTVRIADLGCSVGPNTFISVQNIIEA   82 (359)
Q Consensus         4 ~~~-~~~~M~gG~g~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~~~~~~~~~~~~~IaDlGCs~G~nt~~~~~~ii~~   82 (359)
                      |++ ++|||+||+|++||++||.+|++++..++|+|++||.+++....    .+++++|||||||+|+||+.+|+.||++
T Consensus         1 m~~~~~l~M~gG~G~~SYa~NS~~Q~~~i~~~kp~leeai~~~~~~~~----~~~~~~IADlGCS~G~Ntl~~v~~iI~~   76 (359)
T d1m6ex_           1 MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDT----VTTRLAIADLGCSSGPNALFAVTELIKT   76 (359)
T ss_dssp             CCCHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSSS----SSSEECCEEESCCSSTTTTTGGGTTHHH
T ss_pred             CCccEeeccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHhcccCCC----CCCceEEEEeCCCCCccHHHHHHHHHHH
Confidence            556 78999999999999999999999999999999999999764332    3678999999999999999999999999


Q ss_pred             HHHHhhcCCC-CCCCceEEecCCCCCchHHHHHhCCC-----CcccccccCcccccCCCCCCceeEEEecCcccccCCCC
Q 018250           83 LEFKFQNLSL-PVPDFQVFFNDHTENDFNTLFRTLPP-----RKYYAAGVPGSFHGRLFPKSTLHVVNSFNAMHWLSKTP  156 (359)
Q Consensus        83 ~~~~~~~~~~-~~p~~~v~~nDLp~NDFn~lf~~l~~-----~~~~~~~vpgsfy~~l~p~~s~d~~~S~~alHWLs~~p  156 (359)
                      |+++|++.+. +.|+|||+|||||+||||+||++||.     ..||++|||||||+||||++|+||+||++||||||++|
T Consensus        77 i~~~~~~~~~~~~pe~qvf~nDLP~NDFNtLF~~L~~~~~~~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~alHWLS~vP  156 (359)
T d1m6ex_          77 VEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVP  156 (359)
T ss_dssp             HHHHHHSSSCSSCCEEEEEEEECTTSCHHHHHTTTTTSCSCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCC
T ss_pred             HHHHHHhcCCCCCCeEEEEeCCCCcchHHHHHHhccccccCCCCeEEEecCCchhhhcCCCCceEEeeehhhhhhhhcCC
Confidence            9999987543 57999999999999999999999986     46999999999999999999999999999999999999


Q ss_pred             cccccccccccCCCceeecC-CCHHHHHHHHHHHHHHHHHHHHHHHHhhccCceeEEEeccCCCCCCCCCcchhHHHHHH
Q 018250          157 KVNMLEKSLEWNQGSIKCTR-FMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFL  235 (359)
Q Consensus       157 ~~~~~~~~~~~n~g~i~~~~-~~~~~~~~y~~Q~~~D~~~fL~~Ra~EL~pGG~lvl~~~g~~~~~~~~~~~~~~~~~~l  235 (359)
                      +.+.+      |+|+||+.+ ++++|.+||++||++||.+||++||+||+|||+||++++||++.++.+ ++.+.+|++|
T Consensus       157 ~~l~~------n~~~i~~~~~~~~~v~~ay~~Qf~~D~~~FL~~Ra~ELv~GG~mvl~~~gr~~~~~~~-~~~~~~~~~l  229 (359)
T d1m6ex_         157 IGIES------NKGNIYMANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRAS-TECCLIWQLL  229 (359)
T ss_dssp             SCCCC------CTTTTSSCSSSCCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSS-TTTSTTTHHH
T ss_pred             ccccC------CCCcEEEcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcEEEEEEeccCCCCCCC-CccchHHHHH
Confidence            98764      888999875 589999999999999999999999999999999999999999877654 3456789999


Q ss_pred             HHHHHHHHHcCCCChhhhccCCccccCCCHHHHHHHHHhCCceeEeEEEEeecCCC-CCC---------CChhHHHHHHH
Q 018250          236 GSCLWDLAKMGVISEEKARTFNVPAYFPYVEELESLIQRNGHFAMERMQQLDQPMR-HKT---------FPAQFYLSHLR  305 (359)
Q Consensus       236 ~~al~~lv~eGli~~e~~d~f~~P~y~ps~~E~~~~i~~~G~F~i~~le~~~~~~~-~~~---------~~~~~v~~~iR  305 (359)
                      .++|++||.||+|++|++|+||+|+|+||.+|++++|+++|+|+|+++|.++.+.. +.+         ..++.+++++|
T Consensus       230 ~~al~dmv~eGlI~eek~dsfn~P~Y~ps~eEv~~~ie~~gsF~i~~~e~~~~~~~~~~~~~~~~~d~~~~~~~~a~~~R  309 (359)
T d1m6ex_         230 AMALNQMVSEGLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDHIEASEIYWSSCTKDGDGGGSVEEEGYNVARCMR  309 (359)
T ss_dssp             HHHHHHHHHTTCSCCSTTGGGCCCCBCCCSHHHHHHHHHTTTBCCEEEEEEEEETTCCSSCTTCCSSTTTTTTHHHHHHH
T ss_pred             HHHHHHHHHcCCCCHHHHHhccCccccCCHHHHHHHhccCCCeeeeeeEeeecccccccccccccccHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999864311 110         24578999999


Q ss_pred             HHhhhhhhhccCHHHHHHHHHHHHHHHHHHhhhhhcCCcceEEEEEEEEecc
Q 018250          306 AVLEGLIGKHFGEELLENIFNHINTKEAEILSIHNGKLHKEIEVFVVLKRIS  357 (359)
Q Consensus       306 a~~~~~l~~~~~e~i~delf~r~~~~~~~~~~~~~~~~~~~~~~~~~l~r~~  357 (359)
                      ||.+|++.+|||++++|+||+||++++++++++   ...++++++++|+||.
T Consensus       310 A~~e~~l~~hfg~~i~D~lF~r~~~~v~~~~~~---~~~~~~~~~~sL~rK~  358 (359)
T d1m6ex_         310 AVAEPLLLDHFGEAIIEDVFHRYKLLIIERMSK---EKTKFINVIVSLIRKS  358 (359)
T ss_dssp             HHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHS---SCCEEEEEEEEEEBCC
T ss_pred             HHHHHHHHHHcChHHHHHHHHHHHHHHHhhHhh---cCCceEEEEEEEEecC
Confidence            999999999999999999999999999999986   4478999999999986

PyMOL of d1m6ex_

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}	Back information, alignment and structure

>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]}	Back information, alignment and structure

>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]}	Back information, alignment and structure

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]}	Back information, alignment and structure

>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure