Citrus Sinensis ID: 018294

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNSQLRSLYQTVSNRVS
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccccEEEEccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHEHHcccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHccccHHHHHHHHHHHHHcccEEEEEEccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKScqredgtddqkkgSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKsaiphpriMGIIRecggkmhmaERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMesevnpfdgqeakpykndpeILAMTNLIAAYQRNEIIEFEKILKSNrktimddpfIRNYIEDLLKNVRTQVLLKLIkpytriripfiskelnvpekDVEQLLVSLILDNRIDGHIDQVNRLlergdrskgmkKYTAIDKWNSQLRSLYQTVSNRVS
MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEaknerlwfktNLKLCKIWFDMGEYGRMSKILKELHKSCqredgtddqkkgsqLLEVYAIEIQMYTETKNNKKLKQLYQKALaiksaiphpriMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKsnrktimdDPFIRNYIEDLLKNVRTQVLLKlikpytriripfiskelnvpekDVEQLLVSLIldnridghidqvnrllergdrskgmkkytaidkwnsqlrslyqtvsnrvs
MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETknnkklkqlyqkalaikSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNSQLRSLYQTVSNRVS
*****REMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKEL******************LLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVN************DPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLER*******KKYTAIDKWNSQLR***********
*MDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEV**************PEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRS***KKYTAIDKWNSQLRSLYQTVSNRV*
MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHK************KGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNSQLRSLY********
MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNSQLRSLYQTVSNRV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNSQLRSLYQTVSNRVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query358 2.2.26 [Sep-21-2011]
Q8W207439 COP9 signalosome complex yes no 0.997 0.813 0.876 0.0
P61203443 COP9 signalosome complex yes no 0.994 0.803 0.670 1e-144
P61202443 COP9 signalosome complex yes no 0.994 0.803 0.670 1e-144
P61201443 COP9 signalosome complex yes no 0.994 0.803 0.670 1e-144
Q54HL6449 COP9 signalosome complex yes no 0.997 0.795 0.673 1e-144
Q6IR75441 COP9 signalosome complex N/A no 0.994 0.807 0.670 1e-144
Q6IQT4443 COP9 signalosome complex yes no 0.994 0.803 0.664 1e-143
Q94899444 COP9 signalosome complex yes no 0.994 0.801 0.620 1e-131
O01422495 COP9 signalosome complex yes no 0.924 0.668 0.571 1e-114
Q5B3U7506 COP9 signalosome complex yes no 0.966 0.683 0.516 1e-111
>sp|Q8W207|CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana GN=CSN2 PE=1 SV=1 Back     alignment and function desciption
 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/357 (87%), Positives = 335/357 (93%)

Query: 1   MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNE 60
           MM+AY EMLTYIKSAVTRNYSEKCINNIMDFVSGSASQN  LL+EFYQTTLKALEEAKNE
Sbjct: 82  MMEAYTEMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNTGLLQEFYQTTLKALEEAKNE 141

Query: 61  RLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMY 120
           RLWFKTNLKLC IWFD+GEY RM+KILKELHKSCQ+EDGTDDQKKGSQLLEVYAIEIQ+Y
Sbjct: 142 RLWFKTNLKLCNIWFDIGEYRRMTKILKELHKSCQKEDGTDDQKKGSQLLEVYAIEIQIY 201

Query: 121 TETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNY 180
           TETK+NKKLKQLY KALAIKSAIPHPRIMGIIRECGGKMHMAERQW +AATDFFEAFKNY
Sbjct: 202 TETKDNKKLKQLYHKALAIKSAIPHPRIMGIIRECGGKMHMAERQWEEAATDFFEAFKNY 261

Query: 181 DEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIE 240
           DEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIE
Sbjct: 262 DEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIE 321

Query: 241 FEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDV 300
           FE+ILKSNR+TIMDDPFIRNY+EDLLK VRTQVLLKLIKPYT+I IPFISKELNVPE DV
Sbjct: 322 FERILKSNRRTIMDDPFIRNYMEDLLKKVRTQVLLKLIKPYTKIGIPFISKELNVPETDV 381

Query: 301 EQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNSQLRSLYQTVSNRV 357
            +LLVSLILD+RIDGHID++NR L RGD   G K + A+DKWNSQL+SL   +++RV
Sbjct: 382 TELLVSLILDSRIDGHIDEMNRYLLRGDSGNGRKLHKAVDKWNSQLKSLSSNITSRV 438
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex.
Arabidopsis thaliana (taxid: 3702)
>sp|P61203|CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus GN=Cops2 PE=2 SV=1 Back     alignment and function description
>sp|P61202|CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus GN=Cops2 PE=1 SV=1 Back     alignment and function description
>sp|P61201|CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens GN=COPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q54HL6|CSN2_DICDI COP9 signalosome complex subunit 2 OS=Dictyostelium discoideum GN=csn2 PE=1 SV=1 Back     alignment and function description
>sp|Q6IR75|CSN2_XENLA COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis GN=csn2 PE=2 SV=1 Back     alignment and function description
>sp|Q6IQT4|CSN2_DANRE COP9 signalosome complex subunit 2 OS=Danio rerio GN=cops2 PE=2 SV=1 Back     alignment and function description
>sp|Q94899|CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster GN=alien PE=1 SV=2 Back     alignment and function description
>sp|O01422|CSN2_CAEEL COP9 signalosome complex subunit 2 OS=Caenorhabditis elegans GN=csn-2 PE=1 SV=2 Back     alignment and function description
>sp|Q5B3U7|CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnB PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
255583651439 cop9 signalosome complex subunit, putati 0.997 0.813 0.980 0.0
224106658439 predicted protein [Populus trichocarpa] 1.0 0.815 0.977 0.0
224120594439 predicted protein [Populus trichocarpa] 0.997 0.813 0.977 0.0
225440232439 PREDICTED: COP9 signalosome complex subu 1.0 0.815 0.941 0.0
297741725440 unnamed protein product [Vitis vinifera] 1.0 0.813 0.941 0.0
115435976439 Os01g0279200 [Oryza sativa Japonica Grou 1.0 0.815 0.935 0.0
56783671433 putative COP9 signalosome complex subuni 1.0 0.826 0.935 0.0
242057017439 hypothetical protein SORBIDRAFT_03g01126 1.0 0.815 0.930 0.0
356503363439 PREDICTED: COP9 signalosome complex subu 1.0 0.815 0.935 0.0
388510618439 unknown [Lotus japonicus] 1.0 0.815 0.932 0.0
>gi|255583651|ref|XP_002532580.1| cop9 signalosome complex subunit, putative [Ricinus communis] gi|223527689|gb|EEF29797.1| cop9 signalosome complex subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/357 (98%), Positives = 356/357 (99%)

Query: 1   MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNE 60
           MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNF LL+EFYQTTLKALEEAKNE
Sbjct: 82  MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFGLLQEFYQTTLKALEEAKNE 141

Query: 61  RLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMY 120
           RLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMY
Sbjct: 142 RLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMY 201

Query: 121 TETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNY 180
           TETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWA+AATDFFEAFKNY
Sbjct: 202 TETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWAEAATDFFEAFKNY 261

Query: 181 DEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIE 240
           DEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEI+E
Sbjct: 262 DEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEILE 321

Query: 241 FEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDV 300
           FEKILKSNR+TIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDV
Sbjct: 322 FEKILKSNRRTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDV 381

Query: 301 EQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNSQLRSLYQTVSNRV 357
           EQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWN+QLRSLYQT+SNRV
Sbjct: 382 EQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNTQLRSLYQTISNRV 438

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106658|ref|XP_002314240.1| predicted protein [Populus trichocarpa] gi|118481037|gb|ABK92472.1| unknown [Populus trichocarpa] gi|222850648|gb|EEE88195.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120594|ref|XP_002330981.1| predicted protein [Populus trichocarpa] gi|222872773|gb|EEF09904.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225440232|ref|XP_002283810.1| PREDICTED: COP9 signalosome complex subunit 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741725|emb|CBI32857.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|115435976|ref|NP_001042746.1| Os01g0279200 [Oryza sativa Japonica Group] gi|113532277|dbj|BAF04660.1| Os01g0279200 [Oryza sativa Japonica Group] gi|218187979|gb|EEC70406.1| hypothetical protein OsI_01398 [Oryza sativa Indica Group] gi|222618201|gb|EEE54333.1| hypothetical protein OsJ_01306 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|56783671|dbj|BAD81083.1| putative COP9 signalosome complex subunit 2 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242057017|ref|XP_002457654.1| hypothetical protein SORBIDRAFT_03g011260 [Sorghum bicolor] gi|241929629|gb|EES02774.1| hypothetical protein SORBIDRAFT_03g011260 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|356503363|ref|XP_003520479.1| PREDICTED: COP9 signalosome complex subunit 2-like [Glycine max] Back     alignment and taxonomy information
>gi|388510618|gb|AFK43375.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
TAIR|locus:2059289439 FUS12 "FUSCA 12" [Arabidopsis 0.997 0.813 0.834 8.6e-159
UNIPROTKB|E2REA8443 COPS2 "Uncharacterized protein 0.994 0.803 0.636 7.2e-123
UNIPROTKB|P61201443 COPS2 "COP9 signalosome comple 0.994 0.803 0.636 7.2e-123
MGI|MGI:1330276443 Cops2 "COP9 (constitutive phot 0.994 0.803 0.636 7.2e-123
RGD|628791443 Cops2 "COP9 signalosome subuni 0.994 0.803 0.636 7.2e-123
UNIPROTKB|P61203443 Cops2 "COP9 signalosome comple 0.994 0.803 0.636 7.2e-123
ZFIN|ZDB-GENE-040625-15443 cops2 "COP9 constitutive photo 0.994 0.803 0.631 1.5e-122
UNIPROTKB|G3X736450 COPS2 "Uncharacterized protein 1.0 0.795 0.628 6.5e-122
DICTYBASE|DDB_G0289361449 csn2 "proteasome component reg 0.997 0.795 0.634 1.1e-121
FB|FBgn0013746444 alien "alien" [Drosophila mela 0.994 0.801 0.586 4.6e-112
TAIR|locus:2059289 FUS12 "FUSCA 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1547 (549.6 bits), Expect = 8.6e-159, P = 8.6e-159
 Identities = 298/357 (83%), Positives = 319/357 (89%)

Query:     1 MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNE 60
             MM+AY EMLTYIKSAVTRNYSEKCINNIMDFVSGSASQN  LL+EFYQTTLKALEEAKNE
Sbjct:    82 MMEAYTEMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNTGLLQEFYQTTLKALEEAKNE 141

Query:    61 RLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMY 120
             RLWFKTNLKLC IWFD+GEY RM+KILKELHKSCQ+EDGTDDQKKGSQLLEVYAIEIQ+Y
Sbjct:   142 RLWFKTNLKLCNIWFDIGEYRRMTKILKELHKSCQKEDGTDDQKKGSQLLEVYAIEIQIY 201

Query:   121 TETXXXXXXXXXXXXXXXXXSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNY 180
             TET                 SAIPHPRIMGIIRECGGKMHMAERQW +AATDFFEAFKNY
Sbjct:   202 TETKDNKKLKQLYHKALAIKSAIPHPRIMGIIRECGGKMHMAERQWEEAATDFFEAFKNY 261

Query:   181 DEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIE 240
             DEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIE
Sbjct:   262 DEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIE 321

Query:   241 FEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDV 300
             FE+ILKSNR+TIMDDPFIRNY+EDLLK VRTQVLLKLIKPYT+I IPFISKELNVPE DV
Sbjct:   322 FERILKSNRRTIMDDPFIRNYMEDLLKKVRTQVLLKLIKPYTKIGIPFISKELNVPETDV 381

Query:   301 EQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNSQLRSLYQTVSNRV 357
              +LLVSLILD+RIDGHID++NR L RGD   G K + A+DKWNSQL+SL   +++RV
Sbjct:   382 TELLVSLILDSRIDGHIDEMNRYLLRGDSGNGRKLHKAVDKWNSQLKSLSSNITSRV 438
GO:0005634 "nucleus" evidence=ISM;TAS
GO:0030163 "protein catabolic process" evidence=TAS
GO:0008180 "signalosome" evidence=TAS;IPI
GO:0009640 "photomorphogenesis" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010388 "cullin deneddylation" evidence=RCA;IMP
GO:0005829 "cytosol" evidence=IDA
UNIPROTKB|E2REA8 COPS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61201 COPS2 "COP9 signalosome complex subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1330276 Cops2 "COP9 (constitutive photomorphogenic) homolog, subunit 2 (Arabidopsis thaliana)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|628791 Cops2 "COP9 signalosome subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P61203 Cops2 "COP9 signalosome complex subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-15 cops2 "COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3X736 COPS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289361 csn2 "proteasome component region PCI (PINT) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0013746 alien "alien" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O01422CSN2_CAEELNo assigned EC number0.57140.92450.6686yesno
Q54HL6CSN2_DICDINo assigned EC number0.67310.99720.7951yesno
Q5B3U7CSN2_EMENINo assigned EC number0.51670.96640.6837yesno
Q8W207CSN2_ARATHNo assigned EC number0.87670.99720.8132yesno
Q94899CSN2_DROMENo assigned EC number0.62010.99440.8018yesno
P61201CSN2_HUMANNo assigned EC number0.67030.99440.8036yesno
P61203CSN2_RATNo assigned EC number0.67030.99440.8036yesno
P61202CSN2_MOUSENo assigned EC number0.67030.99440.8036yesno
Q6IQT4CSN2_DANRENo assigned EC number0.66480.99440.8036yesno
Q6IR75CSN2_XENLANo assigned EC number0.67030.99440.8072N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
pfam01399100 pfam01399, PCI, PCI domain 6e-24
COG5159421 COG5159, RPN6, 26S proteasome regulatory complex c 5e-21
smart0075388 smart00753, PAM, PCI/PINT associated module 2e-16
smart0008888 smart00088, PINT, motif in proteasome subunits, In 2e-16
pfam10075144 pfam10075, PCI_Csn8, COP9 signalosome, subunit CSN 3e-11
>gnl|CDD|216479 pfam01399, PCI, PCI domain Back     alignment and domain information 
 Score = 93.8 bits (234), Expect = 6e-24
 Identities = 34/100 (34%), Positives = 58/100 (58%), Gaps = 1/100 (1%)

Query: 226 MTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIR 285
             +L+ A+   ++ +FE+IL  N +  + D  +   +EDL + +R   L +L KPY+ I 
Sbjct: 1   YRDLLRAFYSGDLSDFEEILADN-EDELLDDGLAELLEDLRRKIRELNLRRLAKPYSSIS 59

Query: 286 IPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLE 325
           +  ++K L +   +VE++L  LI D RI G IDQVN ++ 
Sbjct: 60  LSDLAKLLGLSVDEVEKILSKLIRDGRIRGKIDQVNGIVV 99

This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15). Length = 100
>gnl|CDD|227488 COG5159, RPN6, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module Back     alignment and domain information
>gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>gnl|CDD|220553 pfam10075, PCI_Csn8, COP9 signalosome, subunit CSN8 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 358
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 100.0
KOG1463411 consensus 26S proteasome regulatory complex, subun 100.0
COG5159421 RPN6 26S proteasome regulatory complex component [ 100.0
KOG1498439 consensus 26S proteasome regulatory complex, subun 100.0
KOG0687393 consensus 26S proteasome regulatory complex, subun 100.0
COG5071439 RPN5 26S proteasome regulatory complex component [ 99.97
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 99.96
COG5187412 RPN7 26S proteasome regulatory complex component, 99.96
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 99.96
KOG2908380 consensus 26S proteasome regulatory complex, subun 99.96
KOG2758432 consensus Translation initiation factor 3, subunit 99.9
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 99.83
KOG2581493 consensus 26S proteasome regulatory complex, subun 99.77
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 99.6
smart0075388 PAM PCI/PINT associated module. 99.6
KOG2582422 consensus COP9 signalosome, subunit CSN3 [Posttran 99.58
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 99.44
KOG2753378 consensus Uncharacterized conserved protein, conta 99.26
COG5600413 Transcription-associated recombination protein [DN 99.22
KOG2688394 consensus Transcription-associated recombination p 99.07
KOG1076843 consensus Translation initiation factor 3, subunit 99.07
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.86
KOG2072 988 consensus Translation initiation factor 3, subunit 97.73
PF10075143 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro 97.73
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 97.65
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.49
KOG3250258 consensus COP9 signalosome, subunit CSN7 [Posttran 97.16
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.89
PF03399204 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; I 96.73
KOG1861540 consensus Leucine permease transcriptional regulat 96.63
KOG2003840 consensus TPR repeat-containing protein [General f 96.62
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.6
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.25
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.14
PF09756188 DDRGK: DDRGK domain; InterPro: IPR019153 This is a 96.02
KOG2908380 consensus 26S proteasome regulatory complex, subun 96.0
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.82
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 95.81
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.8
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.54
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.49
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 95.45
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.33
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 95.22
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.21
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 95.16
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.99
KOG1586288 consensus Protein required for fusion of vesicles 94.92
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 94.92
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 94.82
PRK10370198 formate-dependent nitrite reductase complex subuni 94.77
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 94.76
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 94.72
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 94.68
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 94.63
PRK15359144 type III secretion system chaperone protein SscB; 94.56
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.29
PRK11788389 tetratricopeptide repeat protein; Provisional 94.26
KOG2003 840 consensus TPR repeat-containing protein [General f 93.97
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 93.93
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 93.57
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 93.44
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 93.42
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 93.16
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 93.15
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 92.91
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 92.81
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 92.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 92.4
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 92.07
KOG3054299 consensus Uncharacterized conserved protein [Funct 91.98
PRK1543178 ferrous iron transport protein FeoC; Provisional 91.87
KOG2300629 consensus Uncharacterized conserved protein [Funct 91.74
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 91.56
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 91.55
PRK11788389 tetratricopeptide repeat protein; Provisional 91.54
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 91.47
PF1337173 TPR_9: Tetratricopeptide repeat 91.32
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 91.19
PRK10803263 tol-pal system protein YbgF; Provisional 91.1
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 91.02
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 91.01
COG3355126 Predicted transcriptional regulator [Transcription 90.8
PF12688120 TPR_5: Tetratrico peptide repeat 90.64
KOG1585308 consensus Protein required for fusion of vesicles 90.45
PRK11189296 lipoprotein NlpI; Provisional 90.09
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 90.08
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 89.99
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 89.94
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 89.79
cd05804355 StaR_like StaR_like; a well-conserved protein foun 89.6
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 89.49
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 89.25
KOG1129478 consensus TPR repeat-containing protein [General f 88.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 88.69
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 88.69
COG2976207 Uncharacterized protein conserved in bacteria [Fun 88.53
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 88.06
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 87.98
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 87.86
PRK10803263 tol-pal system protein YbgF; Provisional 87.82
PRK15331165 chaperone protein SicA; Provisional 87.78
PF13512142 TPR_18: Tetratricopeptide repeat 87.78
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 87.03
PRK06266178 transcription initiation factor E subunit alpha; V 86.88
KOG4414197 consensus COP9 signalosome, subunit CSN8 [Posttran 86.65
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 86.2
COG4105254 ComL DNA uptake lipoprotein [General function pred 85.96
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 85.68
KOG2076 895 consensus RNA polymerase III transcription factor 85.56
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 85.44
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 85.44
PF03704146 BTAD: Bacterial transcriptional activator domain; 85.32
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 85.16
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 85.03
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 85.0
KOG3677525 consensus RNA polymerase I-associated factor - PAF 84.96
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 84.91
COG1497 260 Predicted transcriptional regulator [Transcription 84.79
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 84.12
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 83.96
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 83.86
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 83.63
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 83.49
PRK15174656 Vi polysaccharide export protein VexE; Provisional 83.48
PF1337173 TPR_9: Tetratricopeptide repeat 83.23
PRK12370553 invasion protein regulator; Provisional 83.14
COG2976207 Uncharacterized protein conserved in bacteria [Fun 82.76
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 82.72
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 82.39
KOG0553304 consensus TPR repeat-containing protein [General f 82.3
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 82.29
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 82.25
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 82.23
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 82.1
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 82.08
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 81.85
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 81.77
PRK10857164 DNA-binding transcriptional regulator IscR; Provis 81.69
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 81.47
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 81.35
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 81.04
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 80.79
COG4700251 Uncharacterized protein conserved in bacteria cont 80.69
PRK11920153 rirA iron-responsive transcriptional regulator; Re 80.54
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 80.3
PRK11014141 transcriptional repressor NsrR; Provisional 80.15
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=7.6e-72  Score=488.34  Aligned_cols=355  Identities=72%  Similarity=1.130  Sum_probs=344.2

Q ss_pred             ChHHHHHHHhhhhhhcchhhhHHHHHHHHHHhcCCCCCChhHHHHHHHHHHHHHHHhhhhhhHHHhhhhhHHHHhhhchH
Q 018294            1 MMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEY   80 (358)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~r~~~~~~~~la~~~~~~g~~   80 (358)
                      |+++|+||++|++|+|+|||++|+|+.++|+++.+.  +.+.++.||++|++.++.+.|+|+||+++.+|+++|++.|+|
T Consensus        84 Mm~~Y~qlLTYIkSAVTrNySEKsIN~IlDyiStS~--~m~LLQ~FYeTTL~ALkdAKNeRLWFKTNtKLgkl~fd~~e~  161 (440)
T KOG1464|consen   84 MMERYKQLLTYIKSAVTRNYSEKSINSILDYISTSK--NMDLLQEFYETTLDALKDAKNERLWFKTNTKLGKLYFDRGEY  161 (440)
T ss_pred             HHHHHHHHHHHHHHHHhccccHHHHHHHHHHHhhhh--hhHHHHHHHHHHHHHHHhhhcceeeeeccchHhhhheeHHHH
Confidence            789999999999999999999999999999999644  488999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHhcccCCCCcchhhhhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHhhhccCCChhhhHHHhhhhhhhH
Q 018294           81 GRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMH  160 (358)
Q Consensus        81 ~~a~~~l~~l~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~d~~~a~~~l~~a~~~~~~~~~~~~~~~i~~~~g~~~  160 (358)
                      ....+++.++++.|...+|.+|..++++++|+|++++++|..++|..+++.+|.++..+.+++|+|.++|.|++|+|.+|
T Consensus       162 ~kl~KIlkqLh~SCq~edGedD~kKGtQLLEiYAlEIQmYT~qKnNKkLK~lYeqalhiKSAIPHPlImGvIRECGGKMH  241 (440)
T KOG1464|consen  162 TKLQKILKQLHQSCQTEDGEDDQKKGTQLLEIYALEIQMYTEQKNNKKLKALYEQALHIKSAIPHPLIMGVIRECGGKMH  241 (440)
T ss_pred             HHHHHHHHHHHHHhccccCchhhhccchhhhhHhhHhhhhhhhcccHHHHHHHHHHHHhhccCCchHHHhHHHHcCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcHHHHHHHHHHHhhhhhhhcchhHHHHHHHHHHHHHhhCCCCCCcCCcccccCCCCccHHHHHHHHHHHHhCCHHH
Q 018294          161 MAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIE  240 (358)
Q Consensus       161 ~~~~~y~~A~~~f~e~~~~~~~~~~~~~~~~l~y~~l~~lL~~~~~~~~~~~~~~~~~~~p~~~~l~~L~~af~~~d~~~  240 (358)
                      +.+|+|.+|...|||+|.+|++.|+|++..||+|++||.+|..+++|||+++++++|+++|++-+|..|+.||.+.|+.+
T Consensus       242 lreg~fe~AhTDFFEAFKNYDEsGspRRttCLKYLVLANMLmkS~iNPFDsQEAKPyKNdPEIlAMTnlv~aYQ~NdI~e  321 (440)
T KOG1464|consen  242 LREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVAAYQNNDIIE  321 (440)
T ss_pred             cccchHHHHHhHHHHHHhcccccCCcchhHHHHHHHHHHHHHHcCCCCCcccccCCCCCCHHHHHHHHHHHHHhcccHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhhhcCChhHHHHHHHHHHHHHHHHHHHhcccccccchhhHHhHhCCChHHHHHHHHHhhhcCccceeeecc
Q 018294          241 FEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQV  320 (358)
Q Consensus       241 f~~~l~~~~~~l~~D~~l~~~~~~L~~~i~~~~l~~~~~~y~~I~l~~la~~l~l~~~~vE~~l~~lI~~g~i~akID~~  320 (358)
                      |+.++..++..++.|||+..|+.+|.++||..+++++++||++|.+++|++.+++|+.+||.+|+.+|.+..|+|+||++
T Consensus       322 FE~Il~~~~~~IM~DpFIReh~EdLl~niRTQVLlkLIkPYt~i~Ipfis~~Lnv~~~dV~~LLV~~ILD~~i~g~Ide~  401 (440)
T KOG1464|consen  322 FERILKSNRSNIMDDPFIREHIEDLLRNIRTQVLLKLIKPYTNIGIPFISKELNVPEADVESLLVSCILDDTIDGRIDEV  401 (440)
T ss_pred             HHHHHHhhhccccccHHHHHHHHHHHHHHHHHHHHHHhccccccCchhhHhhcCCCHHHHHHHHHHHHhccccccchHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEEEccCCccc-hHHHHHHHHHHHHHHHHHHHhhhc
Q 018294          321 NRLLERGDRSKGM-KKYTAIDKWNSQLRSLYQTVSNRV  357 (358)
Q Consensus       321 ~g~v~~~~~~~~~-~~~~~l~~w~~~i~~l~~~v~~~~  357 (358)
                      ++.+.+.+..... ..+..+..|.+++++|...|.+||
T Consensus       402 n~~l~~~~~~~s~~k~~~al~kW~~ql~Sl~~~i~sr~  439 (440)
T KOG1464|consen  402 NQYLELDKSKNSGSKLYKALDKWNNQLKSLQSNIVSRV  439 (440)
T ss_pred             hhHhccCccCCcchHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            9999997755433 469999999999999999999987

>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2753 consensus Uncharacterized conserved protein, contains PCI domain [General function prediction only] Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8 Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3250 consensus COP9 signalosome, subunit CSN7 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF03399 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; InterPro: IPR005062 This large family includes diverse proteins involved in large complexes [, , ] Back     alignment and domain information
>KOG1861 consensus Leucine permease transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15431 ferrous iron transport protein FeoC; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>KOG4414 consensus COP9 signalosome, subunit CSN8 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3677 consensus RNA polymerase I-associated factor - PAF67 [Translation, ribosomal structure and biogenesis; Transcription] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG1497 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK11920 rirA iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
3txm_A394 Crystal Structure Of Rpn6 From Drosophila Melanogas 2e-18
4b4t_Q434 Near-Atomic Resolution Structural Model Of The Yeas 1e-12
>pdb|3TXM|A Chain A, Crystal Structure Of Rpn6 From Drosophila Melanogaster, Gd(3+) Complex Length = 394 Back     alignment and structure 
Iteration: 1

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/324 (24%), Positives = 158/324 (48%), Gaps = 29/324 (8%)
Query: 14  SAVTRNYSEKCINNIMD-FVSGSASQNFSLLREFYQTTLKALEEAKNE-RLWFKTNL--K 69
           S++++  + K + +++D F+   A     +     Q     +E AK E R + + +L  +
Sbjct: 50  SSISKAKAAKLVRSLVDMFLDMDAGTGIEV-----QLCKDCIEWAKQEKRTFLRQSLEAR 104
Query: 70  LCKIWFDMGEYGRM----SKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETXX 125
           L  ++FD   Y       +++L+EL K        DD+   + L+EV  +E + Y     
Sbjct: 105 LIALYFDTALYTEALALGAQLLRELKK-------LDDK---NLLVEVQLLESKTYHALSN 154
Query: 126 XXXXXXXXXXXXXXXSAI-PHPRIMGIIRECGGKMHMA-ERQWADAATDFFEAFKNYDEA 183
                          +AI   P++ G +    G +H A ER +  A + F+EAF+ +D  
Sbjct: 155 LPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSV 214
Query: 184 GNQRRIQCLKYLVLANMLM--ESEVNPF-DGQEAKPYKNDPEILAMTNLIAAYQRNEIIE 240
            + + +  LKY++L  +++    +VN    G+ A  Y +  +I AM ++  A  +  + +
Sbjct: 215 DSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITY-SGRDIDAMKSVAEASHKRSLAD 273
Query: 241 FEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDV 300
           F+  LK  +K + +D  ++ ++  L   +  Q L ++I+PY+R+++  +++ + +P   V
Sbjct: 274 FQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESIQLPMPQV 333
Query: 301 EQLLVSLILDNRIDGHIDQVNRLL 324
           E+ L  +ILD +  G +DQ   +L
Sbjct: 334 EKKLSQMILDKKFSGILDQGEGVL 357
>pdb|4B4T|Q Chain Q, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 2e-86
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 6e-31
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 9e-09
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
 Score =  265 bits (678), Expect = 2e-86
 Identities = 69/365 (18%), Positives = 163/365 (44%), Gaps = 14/365 (3%)

Query: 1   MMDAYREMLTYIK---SAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEA 57
                 +++   +   S++++  + K + +++D           +  +  +  ++  ++ 
Sbjct: 34  KAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFL-DMDAGTGIEVQLCKDCIEWAKQE 92

Query: 58  KNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEI 117
           K   L      +L  ++FD   Y     +  +L +  ++ D  +       L+EV  +E 
Sbjct: 93  KRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKLDDKN------LLVEVQLLES 146

Query: 118 QMYTETKNNKKLKQLYQKALAIKSAI-PHPRIMGIIRECGGKMHM-AERQWADAATDFFE 175
           + Y    N  K +     A    +AI   P++ G +    G +H   ER +  A + F+E
Sbjct: 147 KTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYE 206

Query: 176 AFKNYDEAGNQRRIQCLKYLVLANMLME--SEVNPFDGQEAKPYKNDPEILAMTNLIAAY 233
           AF+ +D   + + +  LKY++L  +++    +VN     +     +  +I AM ++  A 
Sbjct: 207 AFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEAS 266

Query: 234 QRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKEL 293
            +  + +F+  LK  +K + +D  ++ ++  L   +  Q L ++I+PY+R+++  +++ +
Sbjct: 267 HKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESI 326

Query: 294 NVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSKGMKKYTAIDKWNSQLRSLYQTV 353
            +P   VE+ L  +ILD +  G +DQ   +L   + +   K Y  + +    +  +  T+
Sbjct: 327 QLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERVLETIQSMGKVVDTL 386

Query: 354 SNRVS 358
             +  
Sbjct: 387 YQKAK 391
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Length = 84 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 100.0
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 100.0
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 100.0
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 100.0
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 99.97
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 99.9
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 99.86
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 99.83
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 99.71
3chm_A169 COP9 signalosome complex subunit 7; heat/ARM repea 99.37
4b0z_A229 RPN12, 26S proteasome regulatory subunit RPN12; pr 98.63
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.96
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.96
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.95
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.94
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.86
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.85
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.82
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.81
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.77
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.74
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.7
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.68
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.67
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.63
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.61
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.6
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.59
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.56
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.56
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.5
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.48
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.41
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.41
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.38
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.33
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.28
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.25
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.25
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.22
4b4t_T274 26S proteasome regulatory subunit RPN12; hydrolase 97.19
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.03
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 97.0
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.99
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.96
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.87
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.87
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.83
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.81
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.77
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.77
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.69
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.65
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.64
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.58
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.58
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.52
3u4t_A272 TPR repeat-containing protein; structural genomics 96.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.48
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.43
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.38
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.37
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.36
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.36
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.32
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.23
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.16
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.01
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.01
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.0
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.96
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.92
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.91
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 95.9
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.87
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 95.85
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 95.82
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.75
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.74
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 95.71
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.69
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.67
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.67
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.65
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.65
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.59
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.51
1rz4_A226 Eukaryotic translation initiation factor 3 subuni; 95.51
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 95.5
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.5
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 95.46
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.45
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 95.41
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.41
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.38
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.37
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.37
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.34
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.34
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 95.27
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.27
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.24
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.22
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.21
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.13
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.13
3u4t_A272 TPR repeat-containing protein; structural genomics 95.06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 94.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.96
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 94.93
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 94.93
3k9i_A117 BH0479 protein; putative protein binding protein, 94.82
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.81
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.8
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 94.76
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 94.76
4g1t_A 472 Interferon-induced protein with tetratricopeptide 94.66
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 94.46
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.45
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.45
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 94.4
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 94.2
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 94.17
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 93.99
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 93.95
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 93.94
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 93.68
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 93.67
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 93.52
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 93.41
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.41
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 93.36
2gw1_A 514 Mitochondrial precursor proteins import receptor; 93.27
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 93.27
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 93.25
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 93.23
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 93.22
2gw1_A514 Mitochondrial precursor proteins import receptor; 93.2
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 92.9
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 92.61
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 92.53
2kat_A115 Uncharacterized protein; NESG, structure, structur 92.4
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 92.28
2kat_A115 Uncharacterized protein; NESG, structure, structur 92.19
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 92.12
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 92.09
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 91.85
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 91.76
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 91.66
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 91.65
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 91.3
3k9i_A117 BH0479 protein; putative protein binding protein, 91.21
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 91.2
1sfx_A109 Conserved hypothetical protein AF2008; structural 91.18
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 91.15
3qww_A433 SET and MYND domain-containing protein 2; methyltr 90.99
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 90.99
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 90.95
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 90.87
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 90.73
3t5v_A316 Nuclear mRNA export protein SAC3; PCI, mRNA nuclea 90.73
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 90.64
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 90.52
2jt1_A77 PEFI protein; solution structure, winged helix-tur 90.47
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 90.36
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 90.14
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 90.04
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 89.68
2l6j_A111 TPR repeat-containing protein associated with HSP; 89.42
1qbj_A81 Protein (double-stranded RNA specific adenosine D 89.4
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 89.25
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 89.08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 89.03
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 88.99
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 88.51
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 88.44
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 88.36
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 88.18
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 87.88
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 87.84
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 87.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 87.41
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 87.39
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 87.38
3q49_B137 STIP1 homology and U box-containing protein 1; E3 87.27
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 87.22
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 87.13
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 87.11
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 86.91
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 86.9
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 86.87
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 86.15
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 86.09
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 85.57
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 85.3
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 85.08
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 85.04
3f6o_A118 Probable transcriptional regulator, ARSR family pr 84.45
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 84.3
4g1t_A472 Interferon-induced protein with tetratricopeptide 83.92
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 83.81
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 83.6
2kko_A108 Possible transcriptional regulatory protein (possi 82.98
3r0a_A123 Putative transcriptional regulator; structural gen 82.75
3jth_A98 Transcription activator HLYU; transcription factor 82.48
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 82.39
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 82.22
2oqg_A114 Possible transcriptional regulator, ARSR family P; 82.13
2gxg_A146 146AA long hypothetical transcriptional regulator; 81.92
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 81.87
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 81.76
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 81.58
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 81.53
2nnn_A140 Probable transcriptional regulator; structural gen 81.41
1xd7_A145 YWNA; structural genomics, protein structure initi 81.38
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 81.28
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 81.25
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 81.13
3oop_A143 LIN2960 protein; protein structure initiative, PSI 80.91
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 80.62
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 80.5
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 80.29
3lwf_A159 LIN1550 protein, putative transcriptional regulato 80.25
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 80.23
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
Probab=100.00  E-value=3.3e-61  Score=460.12  Aligned_cols=339  Identities=23%  Similarity=0.406  Sum_probs=292.9

Q ss_pred             hHHHHHHHhhhhhhcchhhhHHHHHHHHHHhcCCCCCChhHHHHHHHHHHHHHHHhhhhh-hHHH--hhhhhHHHHhhhc
Q 018294            2 MDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNER-LWFK--TNLKLCKIWFDMG   78 (358)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~r-~~~~--~~~~la~~~~~~g   78 (358)
                      .+.+.+++|++ +.++|+|++|+|++++|.++.+|+  .  ...++++|+++++|+.++| .|+|  ++.+||++|++.|
T Consensus        39 ~~~~~~~~~~~-~~~~kak~~k~v~~l~~~~~~~~~--~--~~~~~~~~~~~~~~a~~~~r~flr~~l~~kL~~l~~~~~  113 (394)
T 3txn_A           39 ADLIKVTRPFL-SSISKAKAAKLVRSLVDMFLDMDA--G--TGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTA  113 (394)
T ss_dssp             HHHHHHTTTGG-GGSCHHHHHHHHHHHHHHHTTSCC--C--HHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHH-HHhchHHHHHHHHHHHHHHhcCCC--c--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            35678889999 999999999999999999999886  3  5888999999999999885 6777  5569999999999


Q ss_pred             hHhHHHHHHHHHHHhcccCCCCcchhhhhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHhhhccC-CChhhhHHHhhhhh
Q 018294           79 EYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAI-PHPRIMGIIRECGG  157 (358)
Q Consensus        79 ~~~~a~~~l~~l~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~d~~~a~~~l~~a~~~~~~~-~~~~~~~~i~~~~g  157 (358)
                      +|.+|.+++.+++.+|...   |+   +.+++|++++++++|..++|+.+++.+|++|+++.+++ ++|.+++.+++|+|
T Consensus       114 ~y~~a~~~i~~l~~~~~~~---dd---~~~llev~lle~~~~~~~~n~~k~k~~l~~a~~~~~ai~~~p~i~a~i~~~~G  187 (394)
T 3txn_A          114 LYTEALALGAQLLRELKKL---DD---KNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSG  187 (394)
T ss_dssp             CHHHHHHHHHHHHHHHTTS---SC---THHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHhcc---cc---chhHHHHHHHHHHHHHHhccHHHHHHHHHHHHhhhccCCCCHHHHHHHHHHhh
Confidence            9999999999999999864   34   58999999999999999999999999999999999998 68999999999999


Q ss_pred             hhHh-hhhcHHHHHHHHHHHhhhhhhhcchhHHHHHHHHHHHHHhhCCC--CCCcCC-cccccCCCCccHHHHHHHHHHH
Q 018294          158 KMHM-AERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESE--VNPFDG-QEAKPYKNDPEILAMTNLIAAY  233 (358)
Q Consensus       158 ~~~~-~~~~y~~A~~~f~e~~~~~~~~~~~~~~~~l~y~~l~~lL~~~~--~~~~~~-~~~~~~~~~p~~~~l~~L~~af  233 (358)
                      ++|+ .+|+|.+|+.+|+++|++|++.+++++.++++|++||+||+.+.  ++++.+ +....| .+|+++|+..|+.+|
T Consensus       188 i~~l~~~rdyk~A~~~F~eaf~~f~~~~~~~~~~~lkYlvL~aLl~~~r~el~~~l~~~~~~~~-~~pei~~l~~L~~a~  266 (394)
T 3txn_A          188 ILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITY-SGRDIDAMKSVAEAS  266 (394)
T ss_dssp             HHHHHTTSCHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHTTCGGGHHHHHHSHHHHTT-CSHHHHHHHHHHHHH
T ss_pred             HHHHHhccCHHHHHHHHHHHHhcccccccHHHHHHHHHHHHHHHHcCCHHHHHHHhcccccccc-CCccHHHHHHHHHHH
Confidence            9999 99999999999999999999999999999999999999998763  334333 334556 589999999999999


Q ss_pred             HhCCHHHHHHHHHHhhhhhcCChhHHHHHHHHHHHHHHHHHHHhcccccccchhhHHhHhCCChHHHHHHHHHhhhcCcc
Q 018294          234 QRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRI  313 (358)
Q Consensus       234 ~~~d~~~f~~~l~~~~~~l~~D~~l~~~~~~L~~~i~~~~l~~~~~~y~~I~l~~la~~l~l~~~~vE~~l~~lI~~g~i  313 (358)
                      +++|+..|..+++.+++.+..|+++++|+..|+++||+++++++++||++|+|++||+.||+|++++|.+|++||.+|+|
T Consensus       267 ~~~dl~~f~~iL~~~~~~l~~D~~l~~h~~~L~~~Ir~~~L~~i~~pYsrIsl~~iA~~l~ls~~evE~~L~~lI~dg~I  346 (394)
T 3txn_A          267 HKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKF  346 (394)
T ss_dssp             HTTCHHHHHHHHHHSTTTTTTSHHHHHHHHHHHHHHHHHHHHHHHTTCSEEEHHHHHHHHTCCHHHHHHHHHHHHHTTSS
T ss_pred             HhCCHHHHHHHHHHHHHHHhcChHHHHHHHHHHHHHHHHHHHHHhHhhceeeHHHHHHHHCcCHHHHHHHHHHHHHCCCe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeeccCCEEEEccCCccchHHHH----HHHHHHHHHHHHHH
Q 018294          314 DGHIDQVNRLLERGDRSKGMKKYTA----IDKWNSQLRSLYQT  352 (358)
Q Consensus       314 ~akID~~~g~v~~~~~~~~~~~~~~----l~~w~~~i~~l~~~  352 (358)
                      +|+|||++|+|++.++++.+.+|++    +.+|+..|++|.+.
T Consensus       347 ~a~IDq~~giv~~~~~~~r~~~y~~ale~l~~ls~vVd~L~~~  389 (394)
T 3txn_A          347 SGILDQGEGVLIVFEETPVDKTYERVLETIQSMGKVVDTLYQK  389 (394)
T ss_dssp             CEEEETTTTEEEECCC---------------------------
T ss_pred             eEEEcCCCCEEEECCCcchhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999888776765    45688888777654
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4b4t_T 26S proteasome regulatory subunit RPN12; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1rz4_A Eukaryotic translation initiation factor 3 subuni; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} SCOP: a.4.5.53 a.118.1.18 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3t5v_A Nuclear mRNA export protein SAC3; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1xd7_A YWNA; structural genomics, protein structure initiative, winged HE binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 358
d1ufma_84 a.4.5.47 (A:) COP9 signalosome complex subunit 4, 1e-12
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 60.9 bits (148), Expect = 1e-12
 Identities = 16/61 (26%), Positives = 29/61 (47%)

Query: 265 LLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLL 324
           L + V    LL   K Y  I    +   L +P    E++   +I + R++G IDQ++ ++
Sbjct: 12  LDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIV 71

Query: 325 E 325
            
Sbjct: 72  H 72

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 99.68
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.17
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.5
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.97
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1wi9a_72 Hypothetical protein C20orf116 homolog {Mouse (Mus 96.92
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.9
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.86
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.81
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.71
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.58
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.51
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.41
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.4
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.18
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 95.97
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.9
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 95.57
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.31
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 95.08
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.03
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 94.05
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 93.61
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 93.39
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 93.23
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 92.82
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 92.52
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 92.17
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.04
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 91.98
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 91.84
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 91.79
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 91.63
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 90.93
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 90.21
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 89.54
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 88.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 88.5
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 87.86
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 87.75
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 87.32
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 86.78
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 86.73
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 85.92
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 84.63
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 84.57
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 83.22
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 83.18
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 82.72
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 81.44
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 80.51
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.68  E-value=2.2e-17  Score=120.85  Aligned_cols=68  Identities=25%  Similarity=0.398  Sum_probs=64.8

Q ss_pred             HHHHHHHHHHHHHhcccccccchhhHHhHhCCChHHHHHHHHHhhhcCccceeeeccCCEEEEccCCc
Q 018294          264 DLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSK  331 (358)
Q Consensus       264 ~L~~~i~~~~l~~~~~~y~~I~l~~la~~l~l~~~~vE~~l~~lI~~g~i~akID~~~g~v~~~~~~~  331 (358)
                      -|++++++|||+.+.++|++|+|++||+.|++|++++|.+|++||.+|+|+|+|||++|+|+|..++.
T Consensus        11 ~L~~~i~Ehni~~is~~Y~~Isl~~la~~l~l~~~evE~~l~~mI~~~~i~akIDq~~g~V~F~~~e~   78 (84)
T d1ufma_          11 ILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREA   78 (84)
T ss_dssp             CCCHHHHHHHHHHHHHSCSEEEHHHHHHHTTSCHHHHHHHHHHHHHTTSSCEEEETTTTEEEECCSSC
T ss_pred             HHHHHHHHHHHHHHHHhhceeeHHHHHHHHCCCHHHHHHHHHHHHhcCeEEEEEeCCCCEEEECCCCc
Confidence            47789999999999999999999999999999999999999999999999999999999999987654
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure