Citrus Sinensis ID: 018317

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MDGNKDDALKCFKIGKEALESGDRARAIKFLSKARRLDPSLPVDDIISSIESDPNTNPNGPSAEPNSKPSDQSTIRHRGPSTGASPSASSSTSPAYTEEQIAIVRQIKKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQPRTHTRAARGFNGFYDSDIDAEEIFRNFFFGGMPPARTQFRHFNFGQGVATGTADRNGSDGFNLRALIQLLPVILIILLQFLPSSDPIYALSRSYPYEYKFTTERGVNFYVKSSKFEQDYPVGSVQRVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKETPHCDMWQKFQYSPA
ccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEcccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccc
ccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHEEcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHccccccccEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEcccccEEEEEEccccEEEEEccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccc
MDGNKDDALKCFKIGKEALESGDRARAIKFLSKarrldpslpvddiissiesdpntnpngpsaepnskpsdqstirhrgpstgaspsassstspayteEQIAIVRQIKKTKDFYEILGVERSCTVEDVRKSYRKLSLkvhpdknkapgaEEAFKAVSKAFQClsndesrkkyditgsdepvyqprthtraargfngfydsdidaEEIFRNfffggmppartqfrhfnfgqgvatgtadrngsdgfnLRALIQLLPVILIILLQflpssdpiyalsrsypyeykfttergvnFYVKSskfeqdypvgsvqrVRLEKQVEKDYFTILAQNCRLEIQRQQWgfiketphcdmwqkfqyspa
mdgnkddalKCFKIgkealesgdrARAIKFlskarrldpslpVDDIISsiesdpntnpngpSAEPNSKPSDQSTIRHRgpstgaspsassstspaytEEQIAIVRQIKKTKDFYeilgversctvedvRKSYRKLslkvhpdknkapGAEEAFKAVSKAFqclsndesrkkyditgsdepvyqprthtraargfNGFYDSDIDAEEIFRNFFFGGMPPARTQFRHFNFGQGVATGTADRNGSDGFNLRALIQLLPVILIILLQFLPSSDPIYALSRSYPYEYKFTTERGVNFYVKSSkfeqdypvgsvqrVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKETPHCDMWQKFQYSPA
MDGNKDDALKCFKIGKEALESGDRARAIKFLSKARRLDPSLPVDDIISSIESDPNTNPNGPSAEPNSKPSDQSTIRHRgpstgaspsassstspaYTEEQIAIVRQIKKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQPRTHTRAARGFNGFYDSDIDAEEIFRNFFFGGMPPARTQFRHFNFGQGVATGTADRNGSDGFNLRAliqllpviliillqflpSSDPIYALSRSYPYEYKFTTERGVNFYVKSSKFEQDYPVGSVQRVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKETPHCDMWQKFQYSPA
**********CFKI*************************************************************************************QIAIVRQIKKTKDFYEILGVERSCTVEDVRKSYRKL****************************************************TRAARGFNGFYDSDIDAEEIFRNFFFGGMPPARTQFRHFNFGQGVATGTADRNGSDGFNLRALIQLLPVILIILLQFLPSSDPIYALSRSYPYEYKFTTERGVNFYVKSSKFEQDYPVGSVQRVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKETPHCDMWQKFQ****
**GNKDDALKCFKIGKEALESGDRARAIKFLSKARRLDPSLPVDDII********************************************************VRQIKKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYD************************YDSDIDAEEIFRNFFFGGM**********************************IQLLPVILIILLQFLPSSDPIY***********FTTERGVNFYVKSSKFE***********RLEKQVEKDYFTILAQNCRLEIQRQQWGFIKETPHCDMW*KF*****
MDGNKDDALKCFKIGKEALESGDRARAIKFLSKARRLDPSLPVDDIISSIESD*******************************************TEEQIAIVRQIKKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQPRTHTRAARGFNGFYDSDIDAEEIFRNFFFGGMPPARTQFRHFNFGQGVATGTADRNGSDGFNLRALIQLLPVILIILLQFLPSSDPIYALSRSYPYEYKFTTERGVNFYVKSSKFEQDYPVGSVQRVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKETPHCDMWQKFQYSPA
****KDDALKCFKIGKEALESGDRARAIKFLSKARRLDPSLPVDDIISSIESD*****************************************AYTEEQIAIVRQIKKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD****************NGFYDSDIDAEEIFRNFFFGGMPPARTQFRHFNFGQG***********DGFNLRALIQLLPVILIILLQFLPSSDPIYALSRSYPYEYKFTTERGVNFYVKSSKFEQDYPVGSVQRVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKETPHCDMWQKFQYS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGNKDDALKCFKIGKEALESGDRARAIKFLSKARRLDPSLPVDDIISSIESDPNTNPNGPSAEPNSKPSDQSTIRHRGPSTGASPSASSSTSPAYTEEQIAIVRQIKKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQPRTHTRAARGFNGFYDSDIDAEEIFRNFFFGGMPPARTQFRHFNFGQGVATGTADRNGSDGFNLRALIQLLPVILIILLQFLPSSDPIYALSRSYPYEYKFTTERGVNFYVKSSKFEQDYPVGSVQRVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKETPHCDMWQKFQYSPA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query358 2.2.26 [Sep-21-2011]
Q9FH28354 Chaperone protein dnaJ 49 no no 0.899 0.909 0.384 4e-56
Q7ZXQ8371 DnaJ homolog subfamily B N/A no 0.893 0.862 0.363 1e-51
Q58DR2370 DnaJ homolog subfamily B yes no 0.955 0.924 0.364 2e-51
Q9NXW2375 DnaJ homolog subfamily B yes no 0.952 0.909 0.363 3e-51
Q28I38375 DnaJ homolog subfamily B yes no 0.902 0.861 0.356 6e-51
Q9QYI4376 DnaJ homolog subfamily B yes no 0.966 0.920 0.358 7e-50
Q8TBM8379 DnaJ homolog subfamily B no no 0.885 0.836 0.368 9e-49
Q5R6H3379 DnaJ homolog subfamily B no no 0.885 0.836 0.368 3e-48
Q149L6379 DnaJ homolog subfamily B no no 0.893 0.844 0.366 7e-48
Q0IIE8379 DnaJ homolog subfamily B no no 0.896 0.846 0.370 1e-46
>sp|Q9FH28|DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana GN=ATJ49 PE=2 SV=2 Back     alignment and function desciption
 Score =  219 bits (557), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 140/364 (38%), Positives = 211/364 (57%), Gaps = 42/364 (11%)

Query: 1   MDGNKDDALKCFKIGKEALESGDRARAIKFLSKARRLDPSLPVDDIISSIESDPNTNPNG 60
           MDGNKDDA +C +I ++A+ SGD+ RA+KF++ A+RL+PSL VD+++++ ++  + + N 
Sbjct: 1   MDGNKDDASRCLRIAEDAIVSGDKERALKFINMAKRLNPSLSVDELVAACDNLDSVSRN- 59

Query: 61  PSAEPNSKPSDQSTIRHRGPSTGASPSASSSTSPAYTEEQIAIVRQIKKTKDFYEILGVE 120
                       S++  +  +         +    YTEE + +VR I +  D+Y ILG+E
Sbjct: 60  ------------SSVSEKLKTMDGDDDKLETGKMKYTEENVDLVRNIIRNNDYYAILGLE 107

Query: 121 RSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGS--- 177
           ++C+V+++RK+YRKLSLKVHPDKNKAPG+EEAFK VSKAF CLS+  SR+++D  G    
Sbjct: 108 KNCSVDEIRKAYRKLSLKVHPDKNKAPGSEEAFKKVSKAFTCLSDGNSRRQFDQVGIVDE 167

Query: 178 -DEPVYQPRTHTRAARGFNGFYDSDIDAEEIFRNFF------FGGMPPART-----QFRH 225
            D    + R   R     N F+D + D EEIFR  F      F      RT     QFR 
Sbjct: 168 FDHVQRRNRRPRRRYNTRNDFFDDEFDPEEIFRTVFGQQREVFRASHAYRTRQPRNQFRE 227

Query: 226 FNFGQGVATGTADRNGSDGFNLRALIQLLPVILIILLQFLPSSDPIYALSRSYPYEYKFT 285
                             G +   +IQ+LP  L++LL +LP S+P Y+L ++  Y+   T
Sbjct: 228 EEINVA------------GPSCLTIIQILPFFLLLLLAYLPFSEPDYSLHKNQSYQIPKT 275

Query: 286 TERG-VNFYVKS-SKFEQDYPVGSVQRVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKE 343
           T+   ++FYV+S S F++ +P+ S  R  LE  V K+Y   L Q+CR+E+Q+++W     
Sbjct: 276 TQNTEISFYVRSASAFDEKFPLSSSARANLEGNVIKEYKHFLFQSCRIELQKRRWNKKIP 335

Query: 344 TPHC 347
           TPHC
Sbjct: 336 TPHC 339
Have a continuous role in plant development probably in the structural organization of compartments.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 Back     alignment and function description
>sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 Back     alignment and function description
>sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 Back     alignment and function description
>sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 Back     alignment and function description
>sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=2 SV=2 Back     alignment and function description
>sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=2 SV=1 Back     alignment and function description
>sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 Back     alignment and function description
>sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 Back     alignment and function description
>sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
225445466357 PREDICTED: chaperone protein dnaJ 49 iso 0.983 0.985 0.691 1e-134
224088053353 predicted protein [Populus trichocarpa] 0.958 0.971 0.642 1e-129
255566987363 Protein HLJ1, putative [Ricinus communis 0.980 0.966 0.669 1e-129
449464606361 PREDICTED: chaperone protein dnaJ 49-lik 0.974 0.966 0.665 1e-127
356516957364 PREDICTED: chaperone protein dnaJ 49-lik 0.977 0.961 0.635 1e-126
17473565367 dnaJ-like protein [Arabidopsis thaliana] 0.980 0.956 0.601 1e-121
15230279367 DnaJ/Hsp40 domain-containing protein [Ar 0.980 0.956 0.598 1e-120
297817058365 hypothetical protein ARALYDRAFT_486177 [ 0.974 0.956 0.593 1e-119
356508321365 PREDICTED: chaperone protein dnaJ 49-lik 0.986 0.967 0.628 1e-119
388496322359 unknown [Medicago truncatula] 0.980 0.977 0.627 1e-112
>gi|225445466|ref|XP_002285124.1| PREDICTED: chaperone protein dnaJ 49 isoform 1 [Vitis vinifera] gi|359484662|ref|XP_003633140.1| PREDICTED: chaperone protein dnaJ 49 isoform 2 [Vitis vinifera] gi|359484664|ref|XP_003633141.1| PREDICTED: chaperone protein dnaJ 49 isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 246/356 (69%), Positives = 303/356 (85%), Gaps = 4/356 (1%)

Query: 1   MDGNKDDALKCFKIGKEALESGDRARAIKFLSKARRLDPSLPVDDIISSIESDPNTN--P 58
           MDGNKD+ALKC KIGK+ALE+GDRARA+KF++KARRLDP+LPVDD++S+IE +   +  P
Sbjct: 1   MDGNKDEALKCLKIGKDALEAGDRARALKFVTKARRLDPNLPVDDLLSAIERETGQSETP 60

Query: 59  NGPSAEPNSKPSDQSTIRHRGPSTGASPSASSSTSPAYTEEQIAIVRQIKKTKDFYEILG 118
            G + +  SK SD  ++RHR PS+  S ++SSS+S AYTEEQI+IVRQ+KK KD+YE+LG
Sbjct: 61  AGGANDEASKASDHPSVRHRVPSS-GSSASSSSSSVAYTEEQISIVRQVKKKKDYYEVLG 119

Query: 119 VERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSD 178
           +E+SCTVED+RK+YRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSN+ESRKKYD+ GSD
Sbjct: 120 LEKSCTVEDIRKAYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNEESRKKYDLVGSD 179

Query: 179 EPVYQPRTHTRAARGFNGFYDSDIDAEEIFRNFFFGGMPPARTQFRHFNFGQGVATGTAD 238
           EPVY+    TR A GFNGFYD D+DAEEIFRNFFFGGMP A TQFR F FG G+ T T +
Sbjct: 180 EPVYERHPATRRANGFNGFYDGDVDAEEIFRNFFFGGMPQATTQFRGFAFGPGMGTRTGN 239

Query: 239 RNGSDGFNLRALIQLLPVILIILLQFLPSSDPIYALSRSYPYEYKFTTERGVNFYVKSSK 298
            N S GFN+RALIQLLPV++I+LL FLPSS+P+YA +RSYPYEY+F T++GVN+YVKS+K
Sbjct: 240 -NDSGGFNIRALIQLLPVLIILLLNFLPSSEPMYAFARSYPYEYRFVTQKGVNYYVKSTK 298

Query: 299 FEQDYPVGSVQRVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKETPHCDMWQKFQ 354
           FEQDYP  S +RV  E +VE++YF +L+QNCR E+QR QWGFI+ETPHCDM ++F+
Sbjct: 299 FEQDYPSNSHERVAFEARVEREYFALLSQNCRHELQRLQWGFIRETPHCDMLKQFE 354

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224088053|ref|XP_002308307.1| predicted protein [Populus trichocarpa] gi|222854283|gb|EEE91830.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255566987|ref|XP_002524476.1| Protein HLJ1, putative [Ricinus communis] gi|223536264|gb|EEF37916.1| Protein HLJ1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449464606|ref|XP_004150020.1| PREDICTED: chaperone protein dnaJ 49-like [Cucumis sativus] gi|449522191|ref|XP_004168111.1| PREDICTED: chaperone protein dnaJ 49-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356516957|ref|XP_003527157.1| PREDICTED: chaperone protein dnaJ 49-like [Glycine max] Back     alignment and taxonomy information
>gi|17473565|gb|AAL38258.1| dnaJ-like protein [Arabidopsis thaliana] gi|27311873|gb|AAO00902.1| dnaJ-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15230279|ref|NP_191293.1| DnaJ/Hsp40 domain-containing protein [Arabidopsis thaliana] gi|30694626|ref|NP_850714.1| DnaJ/Hsp40 domain-containing protein [Arabidopsis thaliana] gi|6735313|emb|CAB68140.1| dnaJ-like protein [Arabidopsis thaliana] gi|222423897|dbj|BAH19912.1| AT3G57340 [Arabidopsis thaliana] gi|332646122|gb|AEE79643.1| DnaJ/Hsp40 domain-containing protein [Arabidopsis thaliana] gi|332646123|gb|AEE79644.1| DnaJ/Hsp40 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297817058|ref|XP_002876412.1| hypothetical protein ARALYDRAFT_486177 [Arabidopsis lyrata subsp. lyrata] gi|297322250|gb|EFH52671.1| hypothetical protein ARALYDRAFT_486177 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356508321|ref|XP_003522906.1| PREDICTED: chaperone protein dnaJ 49-like [Glycine max] Back     alignment and taxonomy information
>gi|388496322|gb|AFK36227.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
TAIR|locus:2082538367 AT3G57340 [Arabidopsis thalian 0.980 0.956 0.564 7.2e-107
TAIR|locus:2166404294 AT5G05750 [Arabidopsis thalian 0.754 0.918 0.565 1e-77
TAIR|locus:2155184354 AT5G49060 [Arabidopsis thalian 0.555 0.562 0.449 1.8e-58
UNIPROTKB|Q58DR2370 DNAJB12 "DnaJ homolog subfamil 0.963 0.932 0.334 5e-44
MGI|MGI:1931881376 Dnajb12 "DnaJ (Hsp40) homolog, 0.969 0.922 0.324 1.3e-43
UNIPROTKB|Q9NXW2375 DNAJB12 "DnaJ homolog subfamil 0.955 0.912 0.331 2.8e-43
UNIPROTKB|Q8TBM8379 DNAJB14 "DnaJ homolog subfamil 0.910 0.860 0.346 3.6e-41
UNIPROTKB|Q0IIE8379 DNAJB14 "DnaJ homolog subfamil 0.913 0.862 0.341 4.6e-41
ZFIN|ZDB-GENE-070410-128369 dnajb12b "DnaJ (Hsp40) homolog 0.905 0.878 0.331 1.2e-40
MGI|MGI:1917854379 Dnajb14 "DnaJ (Hsp40) homolog, 0.905 0.854 0.350 2.6e-40
TAIR|locus:2082538 AT3G57340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1057 (377.1 bits), Expect = 7.2e-107, P = 7.2e-107
 Identities = 211/374 (56%), Positives = 269/374 (71%)

Query:     1 MDGNKDDALKCFKIGKEALESGDRARAIKFLSKARRLDPSLPVDDIISSI---ESD-PNT 56
             MDGNKDDALKC KI K A+E+GDR RA+KFL+KARRLDP+LP+DD++S +   +SD P +
Sbjct:     1 MDGNKDDALKCLKICKSAMEAGDRPRALKFLAKARRLDPNLPIDDLVSELNNNKSDEPGS 60

Query:    57 --NPNGPSAEPNSKPSDQSTIRHRXXXXXXXXXXXXXXXXXYTEEQIAIVRQIKKTKDFY 114
               +P   +A+ +S  SD+ ++R R                 YTEEQI+IVR+IK  KD+Y
Sbjct:    61 AKSPGSAAAKDSSNSSDRPSLRQRGSSTTSSSSSMS-----YTEEQISIVRKIKSKKDYY 115

Query:   115 EILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDI 174
             EILG+E +C+V+DVRK+YRKLSLKVHPDKN+APG+EEAFK+VSKAFQCLSNDE+RKKYD+
Sbjct:   116 EILGLESNCSVDDVRKAYRKLSLKVHPDKNQAPGSEEAFKSVSKAFQCLSNDEARKKYDV 175

Query:   175 TGSDEPVYQPRTHTRAARGFNG--FYDSDIDAEEIFRNFF----FGG--MPPARTQFRHF 226
             +GSDEP+YQPR   R+  GFNG  +Y+ + D  EIFR+FF    FGG  MPPA  QFR F
Sbjct:   176 SGSDEPIYQPRRSARS-NGFNGGYYYEDEFDPNEIFRSFFGGGGFGGGGMPPATAQFRSF 234

Query:   227 NFGQGVATGTADRNGSD--GFNLRAXXXXXXXXXXXXXXXXXSSDPIYALSRSYPYEYKF 284
             NFG      TA+ N +   GFN R                  SS P+Y LS +YPY+YKF
Sbjct:   235 NFG-ATRQRTANNNQAPDAGFNARILLQLLPVVFILLLNFMPSSQPVYQLSATYPYQYKF 293

Query:   285 TTERGVNFYVKSSKFEQDYPVGSVQRVRLEKQVEKDYFTILAQNCRLEIQRQQWGFIKET 344
             TT++GVN++VKSSKFEQDYP  S  R  LE+QVE+DY +IL+QNCR E+QR+QWGF++ET
Sbjct:   294 TTQKGVNYFVKSSKFEQDYPRDSNDRHTLEEQVERDYVSILSQNCRYEMQRKQWGFVRET 353

Query:   345 PHCDMWQKFQYSPA 358
             PHCDM ++F  + A
Sbjct:   354 PHCDMMRRFDTAAA 367
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2166404 AT5G05750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155184 AT5G49060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DR2 DNAJB12 "DnaJ homolog subfamily B member 12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1931881 Dnajb12 "DnaJ (Hsp40) homolog, subfamily B, member 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NXW2 DNAJB12 "DnaJ homolog subfamily B member 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TBM8 DNAJB14 "DnaJ homolog subfamily B member 14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IIE8 DNAJB14 "DnaJ homolog subfamily B member 14" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-128 dnajb12b "DnaJ (Hsp40) homolog, subfamily B, member 12b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1917854 Dnajb14 "DnaJ (Hsp40) homolog, subfamily B, member 14" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58DR2DJB12_BOVINNo assigned EC number0.36410.95530.9243yesno
Q9QYI4DJB12_MOUSENo assigned EC number0.35890.96640.9202yesno
Q28I38DJB14_XENTRNo assigned EC number0.35630.90220.8613yesno
Q9NXW2DJB12_HUMANNo assigned EC number0.36310.95250.9093yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-28
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-27
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-24
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 3e-23
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-22
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 3e-22
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-20
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-20
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-20
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 3e-20
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 4e-20
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 7e-20
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-19
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-18
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 2e-18
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-18
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 4e-18
pfam09320107 pfam09320, DUF1977, Domain of unknown function (DU 4e-18
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-17
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 1e-17
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 2e-16
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-15
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 1e-15
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-15
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 3e-15
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 6e-15
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 6e-15
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 7e-15
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 8e-15
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 9e-15
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-14
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 3e-14
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 4e-14
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 3e-13
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 6e-13
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 7e-12
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 3e-10
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-09
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 5e-06
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 6e-04
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 0.002
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 0.003
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  113 bits (284), Expect = 2e-28
 Identities = 42/114 (36%), Positives = 60/114 (52%), Gaps = 8/114 (7%)

Query: 108 KKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKA-PGAEEAFKAVSKAFQCLSND 166
              +D+YEILGV +  + E+++K+YRKL+ K HPD+N     AEE FK +++A++ LS+ 
Sbjct: 1   MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDP 60

Query: 167 ESRKKYDITGSDEPVYQPRTHTRAARGFNGFYDSDIDAEEIFRNFFFGGMPPAR 220
           E R  YD  G                G  GF     D  +IF +FF GG    R
Sbjct: 61  EKRAAYDQFGHAGFK-------AGGFGGFGFGGFGGDFGDIFEDFFGGGGGGRR 107

Length = 371
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|150099 pfam09320, DUF1977, Domain of unknown function (DUF1977) Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 358
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.95
PF09320107 DUF1977: Domain of unknown function (DUF1977); Int 99.92
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.87
PRK14296 372 chaperone protein DnaJ; Provisional 99.87
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.86
PRK14288 369 chaperone protein DnaJ; Provisional 99.86
PRK14286 372 chaperone protein DnaJ; Provisional 99.85
PRK14276 380 chaperone protein DnaJ; Provisional 99.84
PRK14299291 chaperone protein DnaJ; Provisional 99.84
PRK14287 371 chaperone protein DnaJ; Provisional 99.84
PRK14280 376 chaperone protein DnaJ; Provisional 99.84
PRK14285 365 chaperone protein DnaJ; Provisional 99.83
PRK14298 377 chaperone protein DnaJ; Provisional 99.83
PRK14278 378 chaperone protein DnaJ; Provisional 99.82
PRK14297 380 chaperone protein DnaJ; Provisional 99.82
PRK14294 366 chaperone protein DnaJ; Provisional 99.82
PRK14282 369 chaperone protein DnaJ; Provisional 99.82
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.82
PRK14277 386 chaperone protein DnaJ; Provisional 99.81
PRK14291 382 chaperone protein DnaJ; Provisional 99.81
PRK14279 392 chaperone protein DnaJ; Provisional 99.81
PRK14283 378 chaperone protein DnaJ; Provisional 99.8
PRK14292 371 chaperone protein DnaJ; Provisional 99.8
PRK14301 373 chaperone protein DnaJ; Provisional 99.8
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.79
PRK14281 397 chaperone protein DnaJ; Provisional 99.79
PRK14284 391 chaperone protein DnaJ; Provisional 99.78
PRK10767 371 chaperone protein DnaJ; Provisional 99.78
PRK14290 365 chaperone protein DnaJ; Provisional 99.78
PRK14295 389 chaperone protein DnaJ; Provisional 99.77
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
PRK14293 374 chaperone protein DnaJ; Provisional 99.76
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.76
PRK14300 372 chaperone protein DnaJ; Provisional 99.76
PRK14289 386 chaperone protein DnaJ; Provisional 99.75
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.73
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.68
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.64
PHA03102153 Small T antigen; Reviewed 99.64
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.64
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.59
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.58
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.55
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.52
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.5
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.49
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.47
PRK05014171 hscB co-chaperone HscB; Provisional 99.37
PRK01356166 hscB co-chaperone HscB; Provisional 99.35
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.31
PRK00294173 hscB co-chaperone HscB; Provisional 99.29
PRK03578176 hscB co-chaperone HscB; Provisional 99.27
PTZ00100116 DnaJ chaperone protein; Provisional 99.17
PHA02624 647 large T antigen; Provisional 99.15
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.09
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.96
PRK01773173 hscB co-chaperone HscB; Provisional 98.93
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.89
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.79
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.78
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.11
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.02
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.62
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 97.61
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.93
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.61
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.51
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.18
KOG0431453 consensus Auxilin-like protein and related protein 95.64
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.8
PF1342844 TPR_14: Tetratricopeptide repeat 94.79
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.45
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.04
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 93.61
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 92.6
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.5
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 92.18
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 91.92
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 91.78
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.08
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 91.01
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 88.37
KOG0553304 consensus TPR repeat-containing protein [General f 88.0
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 87.16
PF1337173 TPR_9: Tetratricopeptide repeat 86.93
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 85.83
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.09
cd0267979 MIT_spastin MIT: domain contained within Microtubu 81.13
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.95  E-value=4.1e-28  Score=237.68  Aligned_cols=101  Identities=42%  Similarity=0.700  Sum_probs=84.9

Q ss_pred             ccCChhhhhCcCCCCCHHHHHHHHHHHHHhhCCCCCC-CCChHHHHHHHHHHHHHcCChhhhhhhcccCCCCCCCCCCCC
Q 018317          109 KTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNK-APGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQPRTH  187 (358)
Q Consensus       109 ~~~d~Y~iLgv~~~a~~~eIkkayrklal~~HPDk~~-~~~a~~~fk~i~~Ay~vLsd~~kR~~YD~~g~~~~~~~~~~~  187 (358)
                      ..+|||+||||+++|+.+||||||||||++||||+|+ .++|+++||+|++||+|||||+||+.||+||..+......  
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~--   79 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGF--   79 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCc--
Confidence            3589999999999999999999999999999999999 8899999999999999999999999999999987651111  


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHhhCCCC
Q 018317          188 TRAARGFNGFYDSDIDAEEIFRNFFFGGM  216 (358)
Q Consensus       188 ~~~~~~~~g~~~~~~~~ed~F~~fFggg~  216 (358)
                        +++++++|.+   ++.|||..|||||.
T Consensus        80 --gg~g~~~fgg---~~~DIF~~~FgGg~  103 (371)
T COG0484          80 --GGFGFGGFGG---DFGDIFEDFFGGGG  103 (371)
T ss_pred             --CCCCcCCCCC---CHHHHHHHhhcCCC
Confidence              1112333321   78999999997654

>PF09320 DUF1977: Domain of unknown function (DUF1977); InterPro: IPR015399 This C-terminal domain is functionally uncharacterised and predominantly found in Dnaj-like proteins Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-18
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 6e-14
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-12
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 5e-12
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 8e-12
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 8e-12
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-10
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 3e-10
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 7e-10
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 7e-10
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 7e-10
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 8e-10
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 8e-10
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 9e-10
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 9e-10
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-09
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-09
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 5e-09
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 4e-08
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 4e-08
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 2e-07
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 7e-07
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 7e-07
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 7e-06
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 7e-06
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 4e-04
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%)
Query: 110 TKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESR 169
           + D+YEILGV R  + ED++K+YR+L+LK HPDKN APGA EAFKA+  A+  LSN E R
Sbjct: 6   SGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKR 65
Query: 170 KKYDITGS 177
           K+YD  GS
Sbjct: 66  KQYDQFGS 73
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-40
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 8e-29
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-26
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 2e-25
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-25
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 9e-25
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 3e-23
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 3e-23
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 4e-23
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-22
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-22
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 7e-22
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 9e-22
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-21
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-21
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-21
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-21
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-21
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 5e-21
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 5e-21
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 7e-20
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-19
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 1e-18
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 6e-17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-15
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-14
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-13
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 2e-12
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 5e-12
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 1e-10
2guz_A71 Mitochondrial import inner membrane translocase su 3e-09
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-09
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 7e-09
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-07
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
 Score =  136 bits (344), Expect = 2e-40
 Identities = 35/87 (40%), Positives = 57/87 (65%)

Query: 87  SASSSTSPAYTEEQIAIVRQIKKTKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKA 146
           S SS +S ++T+EQ   +R+I+ +KD +++LGV+   + ++V K+YRKL++ +HPDK  A
Sbjct: 3   SGSSGSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVA 62

Query: 147 PGAEEAFKAVSKAFQCLSNDESRKKYD 173
           PG+E+AFKAV  A   L  +       
Sbjct: 63  PGSEDAFKAVVNARTALLKNIKSGPSS 89
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.86
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.84
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.83
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.81
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.81
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.81
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.8
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.8
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.79
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.79
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.78
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.78
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.76
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.76
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.76
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.76
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.75
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.72
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.71
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.68
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.66
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.63
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.62
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.61
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.6
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.59
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.58
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.56
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.55
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.54
2guz_A71 Mitochondrial import inner membrane translocase su 99.52
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.51
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.44
2guz_B65 Mitochondrial import inner membrane translocase su 98.62
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 96.94
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 93.63
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 93.3
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 92.36
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 92.18
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 91.38
2l6j_A111 TPR repeat-containing protein associated with HSP; 90.97
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 90.56
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 90.29
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.11
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 90.0
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 89.84
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 89.56
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 89.32
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 89.11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 88.34
2l6j_A111 TPR repeat-containing protein associated with HSP; 87.98
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 87.57
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 87.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 87.26
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 87.17
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 86.84
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 86.43
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 86.07
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 85.97
2kat_A115 Uncharacterized protein; NESG, structure, structur 85.78
3q49_B137 STIP1 homology and U box-containing protein 1; E3 85.66
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 85.54
3k9i_A117 BH0479 protein; putative protein binding protein, 85.32
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 85.1
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 84.7
1pc2_A152 Mitochondria fission protein; unknown function; NM 84.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 84.61
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 84.42
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 84.08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 84.06
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 82.82
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 82.71
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 82.3
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 82.28
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 81.89
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 81.8
1om2_A95 Protein (mitochondrial import receptor subunit TOM 81.62
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 80.96
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 80.96
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 80.95
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 80.74
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 80.61
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 80.37
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 80.12
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 80.1
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
Probab=99.86  E-value=2e-22  Score=164.60  Aligned_cols=97  Identities=33%  Similarity=0.640  Sum_probs=68.1

Q ss_pred             cCChhhhhCcCCCCCHHHHHHHHHHHHHhhCCCCCC-CCChHHHHHHHHHHHHHcCChhhhhhhcccCCCCCCCCCCCCC
Q 018317          110 TKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNK-APGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQPRTHT  188 (358)
Q Consensus       110 ~~d~Y~iLgv~~~a~~~eIkkayrklal~~HPDk~~-~~~a~~~fk~i~~Ay~vLsd~~kR~~YD~~g~~~~~~~~~~~~  188 (358)
                      ..|||+||||+++++.++||++||+|++++|||+++ .+.+++.|+.|++||++|+||.+|..||.+|..+......   
T Consensus         2 ~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~~~~~---   78 (103)
T 1bq0_A            2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGM---   78 (103)
T ss_dssp             CCCSTTTTSSCSSCCHHHHHHHHHHHHTTTCTTTCTTTCTHHHHHHHHTTTTTSTTCSHHHHHTTTSTTTSSCSCC----
T ss_pred             CCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHCCHHHHHHHHHHhhhhhcccCc---
Confidence            469999999999999999999999999999999998 4788999999999999999999999999999876542111   


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHhhCC
Q 018317          189 RAARGFNGFYDSDIDAEEIFRNFFFG  214 (358)
Q Consensus       189 ~~~~~~~g~~~~~~~~ed~F~~fFgg  214 (358)
                       +.+   ++ ...+++.++|..||++
T Consensus        79 -~~~---~~-~~~~~~~~~f~~~f~~   99 (103)
T 1bq0_A           79 -GGG---GF-GGGADFSDIFGDVFGD   99 (103)
T ss_dssp             --------------------------
T ss_pred             -CCC---CC-CCCCCHHHHHHHHHHh
Confidence             011   11 1122456788888764
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 358
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 3e-15
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-14
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 7e-14
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-13
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-13
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-13
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-11
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 4e-11
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSP40
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.8 bits (165), Expect = 3e-15
 Identities = 29/68 (42%), Positives = 49/68 (72%)

Query: 111 KDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRK 170
           KD+Y+ LG+ R  + E+++++YR+ +L+ HPDKNK PGAEE FK +++A+  LS+   R+
Sbjct: 3   KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKRE 62

Query: 171 KYDITGSD 178
            +D  G +
Sbjct: 63  IFDRYGEE 70
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.85
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.78
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.76
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.67
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.63
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.55
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.53
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.94
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 93.63
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 93.09
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 93.06
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 92.96
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 92.21
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 91.13
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 88.32
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 87.41
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 87.02
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 86.65
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 86.41
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 85.72
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 85.01
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 84.79
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 84.33
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 84.04
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 83.99
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 83.97
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 82.73
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 81.57
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 80.96
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 80.5
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 80.23
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.85  E-value=4.6e-22  Score=151.85  Aligned_cols=71  Identities=37%  Similarity=0.760  Sum_probs=65.8

Q ss_pred             cCChhhhhCcCCCCCHHHHHHHHHHHHHhhCCCCCCC-CChHHHHHHHHHHHHHcCChhhhhhhcccCCCCC
Q 018317          110 TKDFYEILGVERSCTVEDVRKSYRKLSLKVHPDKNKA-PGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEP  180 (358)
Q Consensus       110 ~~d~Y~iLgv~~~a~~~eIkkayrklal~~HPDk~~~-~~a~~~fk~i~~Ay~vLsd~~kR~~YD~~g~~~~  180 (358)
                      .+|||+||||+++||.++||+|||+|++++|||+++. +.+++.|+.|++||+||+||.+|..||.+|..+.
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            4799999999999999999999999999999999974 5677889999999999999999999999997653
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure