Citrus Sinensis ID: 018343

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MTRRCSHCSNNGHNSRTCPTRGGGSSPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHYHSSSSAAASPNPDSPLSDHVRDPNHLTDGYLSDDPAHGSGSSNRRCERKKGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPSPLARESDNTSSQPSLNLSLSTEFEPMEAVCKETEKDSEEPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHPILKPIPILPKEPVNVDQLVCMSQLSIGETERGLREPSPLSLKLLGEPSRQSAFHANAPVSRSDLSKGKTTPIQAV
cccccccccccccccccccccccccccccccEEEEEEEEccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccEEEEEEEEEcccHHHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHccccccccccccEEcccHHHHHHHHHHHHHHHcccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEc
mtrrcshcsnnghnsrtcptrgggsspgvgglKLFGvrltdgsiikksasmgnlsalhyhssssaaaspnpdsplsdhvrdpnhltdgylsddpahgsgssnrrcerkkgvpwteEEHRLFLIGLqklgkgdwrgiarnyvmsrtptqvASHAQKYFIRQSNATRRKRRSSLFDMvaddmatdtppvpeeqvmlpsplaresdntssqpslnlslstefepmEAVCKEtekdseepvidlneftpmvssffpaympvpytywphnaatgeedkdagtsgnhpilkpipilpkepvnvdQLVCMSqlsigeterglrepsplslkllgepsrqsafhanapvsrsdlskgkttpiqav
mtrrcshcsnnghnsrtcptrgggssPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHYHSSSSAAASPNPDSPLSDHVRDPNHLTDgylsddpahgsgssnrrcerkkgvpwteeeHRLFLIglqklgkgdWRGIARNYVMSRTPTQVASHAQkyfirqsnatrrkrRSSLFDMVADDMATDTPPVPEEQVMLPSPLaresdntssqpslnlslsteFEPMEAVCKEtekdseepviDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHPILKPIPILPKEPVNVDQLVCMSQLSigeterglrepSPLSLKLLGEPSRQSafhanapvsrsdlskgkttpiqav
MTRRCSHCSNNGHNSRTCPTRgggsspgvggLKLFGVRLTDGSIIKKSASMGnlsalhyhssssaaaspnpdsplsdHVRDPNHLTDGYLSDDPAHGSGSSNRRCERKKGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPSPLARESDNTSSQPSLNLSLSTEFEPMEAVCKETEKDSEEPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHpilkpipilpkEPVNVDQLVCMSQLSIGETERGLREPSPLSLKLLGEPSRQSAFHANAPVSRSDLSKGKTTPIQAV
*****************************GGLKLFGVRLTDGSII******************************************************************PWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFI******************************************************************************VIDLNEFTPMVSSFFPAYMPVPYTYWPHNA****************ILKPIPILPKEPVNVDQLVCMSQL***************************************************
*TRRCSHCSNNGHNSRTC************GLKLFGV*******************************************************************************EHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYF*********************************************************************************************************************************IPILPK*****************************************************************
**************SRTCPTRGGGSSPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHY*****************DHVRDPNHLTDGYLSDD******************PWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPS***************NLSLSTEFEPM************EPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATG********SGNHPILKPIPILPKEPVNVDQLVCMSQLSIG*********SPLSLKLLGEPSRQSA***********************
*****************************GGLKLFGVRLTDGSIIKKSAS***********************************************************GVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSN***********************************************************************EEPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNA*************NHPILKPIPILPKEPVNVDQLVC*******************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRRCSHCSNNGHNSRTCPTRGGGSSPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHYHSSSSAAASPNPDSPLSDHVRDPNHLTDGYLSDDPAHGSGSSNRRCERKKGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPSPLARESDNTSSQPSLNLSLSTEFEPMEAVCKETEKDSEEPVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAATGEEDKDAGTSGNHPILKPIPILPKEPVNVDQLVCMSQLSIGETERGLREPSPLSLKLLGEPSRQSAFHANAPVSRSDLSKGKTTPIQAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query357 2.2.26 [Sep-21-2011]
Q8S9H7307 Transcription factor DIVA N/A no 0.302 0.351 0.540 3e-28
Q2V9B0297 Transcription factor MYB1 N/A no 0.448 0.538 0.488 7e-27
Q869R9 734 Myb-like protein J OS=Dic yes no 0.212 0.103 0.469 4e-14
Q54HX6 977 Myb-like protein I OS=Dic no no 0.179 0.065 0.446 2e-07
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.148 0.043 0.410 4e-06
Q6R0H0287 Transcription factor ASG4 no no 0.142 0.177 0.481 2e-05
Q54IF9 423 Myb-like protein G OS=Dic no no 0.156 0.132 0.454 3e-05
P92973 608 Protein CCA1 OS=Arabidops no no 0.126 0.074 0.425 0.0005
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function desciption
 Score =  126 bits (316), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 80/111 (72%), Gaps = 3/111 (2%)

Query: 84  HLTDGYLSDDPAHGSGSSNRR---CERKKGVPWTEEEHRLFLIGLQKLGKGDWRGIARNY 140
           H  DG+       G  SS+ R    ERKKGVPWTEEEH+LFL+GL+K GKGDWR I+RN+
Sbjct: 102 HGFDGFKQSYGTGGRKSSSGRPSEQERKKGVPWTEEEHKLFLMGLKKYGKGDWRNISRNF 161

Query: 141 VMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQ 191
           V++RTPTQVASHAQKYFIRQ +  + KRR+S+ D+   +++ +  P P+ +
Sbjct: 162 VITRTPTQVASHAQKYFIRQLSGGKDKRRASIHDITTVNLSDNQTPSPDNK 212
Involved in the dorsovental asymmetry of flowers. Promotes ventral identity.
Antirrhinum majus (taxid: 4151)
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function description
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
255549830381 DNA binding protein, putative [Ricinus c 0.977 0.916 0.673 1e-130
224070973377 predicted protein [Populus trichocarpa] 0.991 0.938 0.673 1e-130
171452360382 myb transcription factor [Bruguiera gymn 0.977 0.913 0.646 1e-127
351720685360 MYB transcription factor MYB52 [Glycine 0.980 0.972 0.637 1e-122
149727987353 MYB transcription factor MYB52 [Medicago 0.971 0.983 0.650 1e-121
357454797353 hypothetical protein MTR_2g100930 [Medic 0.971 0.983 0.647 1e-120
118488820369 unknown [Populus trichocarpa x Populus d 0.963 0.932 0.667 1e-120
449447817346 PREDICTED: uncharacterized protein LOC10 0.969 1.0 0.675 1e-119
225442479358 PREDICTED: uncharacterized protein LOC10 0.991 0.988 0.698 1e-118
351722226359 MYB transcription factor MYB62 [Glycine 0.955 0.949 0.638 1e-117
>gi|255549830|ref|XP_002515966.1| DNA binding protein, putative [Ricinus communis] gi|223544871|gb|EEF46386.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 262/389 (67%), Positives = 286/389 (73%), Gaps = 40/389 (10%)

Query: 1   MTRRCSHCSNNGHNSRTCPTRGG------------GSSPGVGGLKLFGVRLTDGSIIKKS 48
           MTRRCSHCSNNGHNSRTCPTR               S+  + G++LFGVRLTDGSIIKKS
Sbjct: 1   MTRRCSHCSNNGHNSRTCPTRSSTCSSAAGSGSASSSASSIAGVRLFGVRLTDGSIIKKS 60

Query: 49  ASMGNLSALHYHSSSSAAASPNPDSPLSDHVRDPNHLTDGYLSDDPAHGSGSSNRRCERK 108
           ASMGNLSA HYHSS  AAASPNPDSPLSDHVRD   + DGYLSDDPAH S S+NRR ERK
Sbjct: 61  ASMGNLSA-HYHSS--AAASPNPDSPLSDHVRD--SVQDGYLSDDPAHASCSTNRRGERK 115

Query: 109 KGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKR 168
           KGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYV+SRTPTQVASHAQKYFIRQ+NATRRKR
Sbjct: 116 KGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIRQTNATRRKR 175

Query: 169 RSSLFDMVADDMATDTPPVPEEQVMLPSPLARESDNTSSQPSLNLSLSTEFEPMEAV--- 225
           RSSLFDMV  DMAT+   VPEE   LPS    ++DN  + PSLNLS   E EPME     
Sbjct: 176 RSSLFDMVP-DMATEPQSVPEEH-ELPSGQLGDTDNADALPSLNLSFKPECEPMETASEE 233

Query: 226 --------------CKETEKDSEE---PVIDLNEFTPMVSSFFPAYMPVPYTYWPHNAAT 268
                          K+TE    E    V  L+EFTP +S F+PAYMP+PY +W  N A 
Sbjct: 234 PAEEPEEMLTGSSELKQTEHRLSEFAPAVPQLSEFTPFISGFYPAYMPIPYPFWSTNTAI 293

Query: 269 GEEDKDAGTSGNHPILKPIPILPKEPVNVDQLVCMSQLSIGETERGLREPSPLSLKLLGE 328
            EE     TS NH +LKP+PI PKEPVNVD+LV MS LSIGE ER  RE S LSLKL+GE
Sbjct: 294 PEEANTVETS-NHQVLKPVPIFPKEPVNVDELVGMSHLSIGEMERDHRELSRLSLKLIGE 352

Query: 329 PSRQSAFHANAPVSRSDLSKGKTTPIQAV 357
           PSRQSAFHANA VS SDLS+GK +PIQAV
Sbjct: 353 PSRQSAFHANASVSGSDLSQGKGSPIQAV 381

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224070973|ref|XP_002303311.1| predicted protein [Populus trichocarpa] gi|222840743|gb|EEE78290.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|171452360|dbj|BAG15871.1| myb transcription factor [Bruguiera gymnorhiza] Back     alignment and taxonomy information
>gi|351720685|ref|NP_001235649.1| MYB transcription factor MYB52 [Glycine max] gi|110931652|gb|ABH02825.1| MYB transcription factor MYB52 [Glycine max] Back     alignment and taxonomy information
>gi|149727987|gb|ABR28340.1| MYB transcription factor MYB52 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357454797|ref|XP_003597679.1| hypothetical protein MTR_2g100930 [Medicago truncatula] gi|355486727|gb|AES67930.1| hypothetical protein MTR_2g100930 [Medicago truncatula] Back     alignment and taxonomy information
>gi|118488820|gb|ABK96220.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|449447817|ref|XP_004141664.1| PREDICTED: uncharacterized protein LOC101214316 [Cucumis sativus] gi|449480623|ref|XP_004155948.1| PREDICTED: uncharacterized protein LOC101229963 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225442479|ref|XP_002283785.1| PREDICTED: uncharacterized protein LOC100241227 [Vitis vinifera] gi|297743200|emb|CBI36067.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351722226|ref|NP_001235701.1| MYB transcription factor MYB62 [Glycine max] gi|110931662|gb|ABH02830.1| MYB transcription factor MYB62 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
TAIR|locus:2094942387 AT3G16350 [Arabidopsis thalian 0.901 0.832 0.533 3e-95
TAIR|locus:2171519365 AT5G47390 [Arabidopsis thalian 0.613 0.6 0.508 5.4e-65
TAIR|locus:2020653261 AT1G70000 [Arabidopsis thalian 0.492 0.674 0.483 2e-40
TAIR|locus:2165106233 AT5G56840 [Arabidopsis thalian 0.235 0.360 0.659 1.9e-35
TAIR|locus:2151621317 AT5G61620 [Arabidopsis thalian 0.563 0.634 0.385 5e-35
TAIR|locus:2027181265 AT1G74840 [Arabidopsis thalian 0.355 0.479 0.548 3.2e-33
TAIR|locus:2011216285 AT1G19000 [Arabidopsis thalian 0.336 0.421 0.533 1e-29
UNIPROTKB|Q8S9H7307 DIVARICATA "Transcription fact 0.347 0.403 0.492 8.2e-28
TAIR|locus:2028461314 AT1G49010 [Arabidopsis thalian 0.358 0.407 0.507 1.3e-27
TAIR|locus:2042872298 AT2G38090 [Arabidopsis thalian 0.246 0.295 0.651 1.2e-26
TAIR|locus:2094942 AT3G16350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 785 (281.4 bits), Expect = 3.0e-95, Sum P(2) = 3.0e-95
 Identities = 184/345 (53%), Positives = 216/345 (62%)

Query:    32 LKLFGVRLTDGSIIKKSASMGXXXXXXXXXXXXX----------XXXXXXXXXXXXHVRD 81
             +KLFGVRLTDGSIIKKSASMG                                   H R 
Sbjct:    47 VKLFGVRLTDGSIIKKSASMGNLSALAVAAAAATHHRLSPSSPLATSNLNDSPLSDHARY 106

Query:    82 PN-HLTDGYLSDDPAHGSGSSNRRCERKKGVPWTEEEHRLFLIGLQKLGKGDWRGIARNY 140
              N H  +GYLSDDPAHGSGSS+RR ERK+GVPWTEEEHRLFL+GLQKLGKGDWRGI+RNY
Sbjct:   107 SNLHHNEGYLSDDPAHGSGSSHRRGERKRGVPWTEEEHRLFLVGLQKLGKGDWRGISRNY 166

Query:   141 VMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVADDMATDTPPVPEEQVMLPSPLAR 200
             V SRTPTQVASHAQKYFIR ++++RRKRRSSLFDMV D+M TD+ P  EEQ +  S  ++
Sbjct:   167 VTSRTPTQVASHAQKYFIRHTSSSRRKRRSSLFDMVTDEMVTDSSPTQEEQTLNGSSPSK 226

Query:   201 ESDNTSSQPSLNLSLS--TEFEPMEAVCKETEKDSEEPVIDLNEFTPMV--SSFFPAYMP 256
             E +  S  PSL LSL+  TE E + A     EK S+E +   N  +PM+    FFP   P
Sbjct:   227 EPEKKSYLPSLELSLNNTTEAEEVVATAPRQEK-SQEAIEPSNGVSPMLVPGGFFPPCFP 285

Query:   257 VPYTYW-PHNAATGEEDKDAGTSGN-HXXXXXXXXXXXEPVNVDQLVCMSQLSIGETERG 314
             V YT W P +    E   +A TS   H           E VN+D+LV MSQLSIG   R 
Sbjct:   286 VTYTIWLPASLHGTEHALNAETSSQQHQVLKPKPGFAKERVNMDELVGMSQLSIGMATRH 345

Query:   315 LRE--PSPLSLKLLGEPSRQSAFHANAPVSRSDLSKGKTTPIQAV 357
               E  PSPLSL+L  EPSR SAFH+N  V+ +DLSKG +  IQA+
Sbjct:   346 ETETSPSPLSLRL--EPSRPSAFHSNGSVNGADLSKGNSA-IQAI 387
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2171519 AT5G47390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020653 AT1G70000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165106 AT5G56840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151621 AT5G61620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027181 AT1G74840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011216 AT1G19000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 3e-18
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 9e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 6e-09
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 6e-05
COG5114 432 COG5114, COG5114, Histone acetyltransferase comple 4e-04
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 77.4 bits (191), Expect = 3e-18
 Identities = 26/57 (45%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 108 KKGVPWTEEEHRLFLIGLQKLGKGDW---RGIARNYVMSR-TPTQVASHAQKYFIRQ 160
           K  V WTE+ H  FL  +QKLG  DW   + I    V+   T  QVASH QKY ++Q
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|227445 COG5114, COG5114, Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 357
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.72
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.43
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.08
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.07
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.74
PLN03212249 Transcription repressor MYB5; Provisional 98.68
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.52
PLN03091 459 hypothetical protein; Provisional 98.47
KOG4329445 consensus DNA-binding protein [General function pr 98.46
KOG0724335 consensus Zuotin and related molecular chaperones 98.28
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.26
PLN03212249 Transcription repressor MYB5; Provisional 97.98
PLN03091 459 hypothetical protein; Provisional 97.88
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 97.81
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.8
KOG1279506 consensus Chromatin remodeling factor subunit and 97.52
KOG0048238 consensus Transcription factor, Myb superfamily [T 97.04
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.03
PLN03162526 golden-2 like transcription factor; Provisional 97.0
KOG4167907 consensus Predicted DNA-binding protein, contains 96.84
KOG0049 939 consensus Transcription factor, Myb superfamily [T 96.71
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 95.81
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.21
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 95.2
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 94.5
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 94.46
KOG4468 782 consensus Polycomb-group transcriptional regulator 94.1
PF1528840 zf-CCHC_6: Zinc knuckle 93.11
PF1439249 zf-CCHC_4: Zinc knuckle 92.92
PLN031421033 Probable chromatin-remodeling complex ATPase chain 92.44
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 92.44
COG5147 512 REB1 Myb superfamily proteins, including transcrip 92.41
KOG0724335 consensus Zuotin and related molecular chaperones 92.37
KOG1194 534 consensus Predicted DNA-binding protein, contains 91.65
smart0042668 TEA TEA domain. 91.21
KOG0051607 consensus RNA polymerase I termination factor, Myb 90.52
KOG3841 455 consensus TEF-1 and related transcription factor, 90.47
KOG0051607 consensus RNA polymerase I termination factor, Myb 90.33
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 85.28
KOG4282345 consensus Transcription factor GT-2 and related pr 85.27
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 83.58
COG5147 512 REB1 Myb superfamily proteins, including transcrip 81.84
smart0034326 ZnF_C2HC zinc finger. 81.6
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 81.55
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.72  E-value=8e-18  Score=127.59  Aligned_cols=53  Identities=49%  Similarity=0.711  Sum_probs=48.2

Q ss_pred             cCCCCCCHHHHHHHHHHHHHcCCCCH---HHHHhhhcCCC-CHHHHHHHHHHHHHHH
Q 018343          108 KKGVPWTEEEHRLFLIGLQKLGKGDW---RGIARNYVMSR-TPTQVASHAQKYFIRQ  160 (357)
Q Consensus       108 kk~~~WTeEEH~~FL~GL~kyGkGdW---k~IA~~~V~TR-Tp~QVrSHAQKYF~r~  160 (357)
                      |++..||+|||++||+||+.||.|+|   +.|++.++.+| |+.||+||+||||+++
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k~   57 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ   57 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHccC
Confidence            45689999999999999999999999   99997666788 9999999999999863

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-24
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 2e-19
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-15
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 6e-15
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 6e-13
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 3e-11
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 9e-11
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 6e-10
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 5e-09
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 6e-09
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 1e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 7e-07
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 4e-06
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 9e-06
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 9e-06
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 9e-06
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 7e-05
2crg_A70 Metastasis associated protein MTA3; transcription 7e-05
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 1e-04
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-04
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 8e-04
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 94.1 bits (234), Expect = 2e-24
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 106 ERKKGVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATR 165
                V WT EE  LF  GL K G+  W  I++  + SRT  QV S+A++YF  +     
Sbjct: 5   SSGYSVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKVKCGL 62

Query: 166 RKRRSS 171
            K   +
Sbjct: 63  DKETPN 68
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.6
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.47
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.46
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.45
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.43
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.42
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.36
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.32
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.31
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.26
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.26
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.24
2crg_A70 Metastasis associated protein MTA3; transcription 99.22
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.2
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.19
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.16
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.12
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.11
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.09
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.06
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.62
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.02
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.97
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.96
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.94
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.92
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.91
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.91
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.9
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.9
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.89
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.88
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.86
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.81
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.78
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.78
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.78
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.72
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.69
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.66
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.66
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.58
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.47
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.37
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.07
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.68
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.39
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.19
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.98
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.32
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.26
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.0
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 95.76
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 95.58
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.51
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 94.01
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 93.94
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 91.89
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 92.17
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 91.2
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 90.9
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 86.8
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 86.66
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 83.48
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 80.94
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 80.53
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 80.42
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.60  E-value=1.6e-15  Score=116.70  Aligned_cols=63  Identities=37%  Similarity=0.546  Sum_probs=58.1

Q ss_pred             CCCCCHHHHHHHHHHHHHcCCCCHHHHHhhhcCCCCHHHHHHHHHHHHHHHhhhhcccCcCcccc
Q 018343          110 GVPWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNATRRKRRSSLFD  174 (357)
Q Consensus       110 ~~~WTeEEH~~FL~GL~kyGkGdWk~IA~~~V~TRTp~QVrSHAQKYF~r~~~~~krKrR~Sl~D  174 (357)
                      ..+||+||+++|++++++||. +|..|| .+|++||..||+.||++||.++.+....+++.+||+
T Consensus         9 ~~~WT~eEd~~l~~~~~~~G~-~W~~Ia-~~~~~Rt~~q~k~r~~~~l~~~~~~g~~~~~~si~s   71 (72)
T 2cu7_A            9 SVKWTIEEKELFEQGLAKFGR-RWTKIS-KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKT   71 (72)
T ss_dssp             CCCCCHHHHHHHHHHHHHTCS-CHHHHH-HHHSSSCHHHHHHHHHHHHHHHSCSCTTCCCSCCCC
T ss_pred             CCCCCHHHHHHHHHHHHHHCc-CHHHHH-HHcCCCCHHHHHHHHHHHHHHHHhcCCCCCcccccc
Confidence            469999999999999999999 999999 599999999999999999999887777888888885
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 357
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 5e-17
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 6e-17
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 2e-08
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-08
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-07
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 4e-07
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-06
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-06
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 7e-05
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.001
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 72.3 bits (177), Expect = 5e-17
 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 3/59 (5%)

Query: 106 ERKKGVPWTEEEHRLFLIGLQKLGKGDWR--GIARNY-VMSRTPTQVASHAQKYFIRQS 161
           ++K  V WT E H  FL  +  LG        I     V   T   VASH QK+ +   
Sbjct: 3   QKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALK 61
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.56
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.56
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.45
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.32
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.31
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.29
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.24
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.24
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.23
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.19
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.19
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.17
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.02
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.88
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.75
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.4
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.22
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.62
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.89
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.59
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 90.7
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 87.98
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 84.45
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 83.06
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 81.47
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Transcriptional adaptor 2-like, TADA2L, isoform b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.56  E-value=1.3e-15  Score=108.03  Aligned_cols=45  Identities=31%  Similarity=0.654  Sum_probs=43.6

Q ss_pred             CCCHHHHHHHHHHHHHcCCCCHHHHHhhhcCCCCHHHHHHHHHHHH
Q 018343          112 PWTEEEHRLFLIGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYF  157 (357)
Q Consensus       112 ~WTeEEH~~FL~GL~kyGkGdWk~IA~~~V~TRTp~QVrSHAQKYF  157 (357)
                      .||+||+.+|++++++||.++|+.|| ++|++||+.||+.|+++||
T Consensus         3 ~Wt~eEd~~L~~~v~~~G~~nW~~Ia-~~~~~Rt~~Qcr~r~~~~f   47 (47)
T d1x41a1           3 SWTAQEEMALLEAVMDCGFGNWQDVA-NQMCTKTKEECEKHYMKYF   47 (47)
T ss_dssp             SSCHHHHHHHHHHHHHTCTTCHHHHH-HHHTTSCHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHCCccHHHHH-HHcCCCCHHHHHHHHHHhC
Confidence            49999999999999999999999999 6999999999999999998
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure