Citrus Sinensis ID: 018395
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 356 | ||||||
| 356539068 | 356 | PREDICTED: glutelin type-A 1-like [Glyci | 1.0 | 1.0 | 0.834 | 1e-176 | |
| 255580564 | 358 | nutrient reservoir, putative [Ricinus co | 1.0 | 0.994 | 0.831 | 1e-176 | |
| 356539076 | 356 | PREDICTED: glutelin type-A 1-like [Glyci | 1.0 | 1.0 | 0.831 | 1e-176 | |
| 356542499 | 356 | PREDICTED: glutelin type-A 1-like [Glyci | 1.0 | 1.0 | 0.828 | 1e-173 | |
| 388507332 | 356 | unknown [Lotus japonicus] | 0.997 | 0.997 | 0.825 | 1e-173 | |
| 359807097 | 356 | uncharacterized protein LOC100795038 [Gl | 1.0 | 1.0 | 0.825 | 1e-173 | |
| 357473729 | 356 | Glutelin type-A [Medicago truncatula] gi | 1.0 | 1.0 | 0.811 | 1e-172 | |
| 357470433 | 356 | Glutelin type-A [Medicago truncatula] gi | 1.0 | 1.0 | 0.811 | 1e-172 | |
| 225447318 | 356 | PREDICTED: 12S seed storage globulin 1 [ | 1.0 | 1.0 | 0.806 | 1e-171 | |
| 449465356 | 356 | PREDICTED: glutelin type-A 1-like [Cucum | 1.0 | 1.0 | 0.800 | 1e-171 |
| >gi|356539068|ref|XP_003538022.1| PREDICTED: glutelin type-A 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 624 bits (1608), Expect = e-176, Method: Compositional matrix adjust.
Identities = 297/356 (83%), Positives = 326/356 (91%)
Query: 1 MEIDLTPKLAKQVYGGNGGSYHAWCPNELPMLRQGNIGAAKLALEKNGFALPHYCDSARV 60
MEIDL+P+LAK+VY NGGSYHAW P+ELPML +GNIGAAKLAL+KNGFALP Y DS++V
Sbjct: 1 MEIDLSPQLAKKVYESNGGSYHAWSPSELPMLHEGNIGAAKLALQKNGFALPQYSDSSKV 60
Query: 61 AYVLQGSGVAGIVLPEKEEKVVAIKKGDGIALPFGVVTWWYNKEDTELVVLFLGDTSKGH 120
AYVLQGSGVAGIVLPE EEKV+AIKKGD +ALPFGV+TWWYNKEDTELVVLFLGDTSK H
Sbjct: 61 AYVLQGSGVAGIVLPESEEKVLAIKKGDALALPFGVITWWYNKEDTELVVLFLGDTSKAH 120
Query: 121 KAGEFTNFFLTGANGIFTGFSTEFVSRAWDLDENTVKTLVGKQTGKGIVKLDANAKLPEP 180
K GEFT+F+LTG+NGIFTGFSTEFV RAWDL+E VKTLVGKQ+G GIVKL+ N LPEP
Sbjct: 121 KTGEFTDFYLTGSNGIFTGFSTEFVGRAWDLEEKDVKTLVGKQSGNGIVKLEGNINLPEP 180
Query: 181 KKEHRDGMAFNCEEAPLDVDIKNGGRVVLLNTKNLPLVGEVGCGADLVRLDGKAMCSPGF 240
K+EHR GMA NCEEAPLDVDIKNGGRVV+LNTKNLPLVGEVG GADLVRLDGKAMCSPGF
Sbjct: 181 KEEHRKGMALNCEEAPLDVDIKNGGRVVVLNTKNLPLVGEVGLGADLVRLDGKAMCSPGF 240
Query: 241 SCDSALQVTYIVRGSGRAQIVGPDGKRVLETTVKAGNLFIVPRFYVVSKIADPDGLAWFS 300
SCDSA QVTYIVRGSGRAQ+VG DG+RVLETTVKAGNLFIVPRF+VVSKIAD DGL WFS
Sbjct: 241 SCDSAFQVTYIVRGSGRAQVVGADGRRVLETTVKAGNLFIVPRFFVVSKIADSDGLEWFS 300
Query: 301 IITTPNPIFTHLAGSIGTWKSLSPSVLEAAFNVPSDVEKQFRSKRANEAIFFPPPN 356
IITTPNP+FTHLAGSIGTWK+LSP+VL AAFNV + +E+ FRSKR +AIFFPPPN
Sbjct: 301 IITTPNPVFTHLAGSIGTWKALSPTVLRAAFNVDAGLEQLFRSKRNADAIFFPPPN 356
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255580564|ref|XP_002531106.1| nutrient reservoir, putative [Ricinus communis] gi|223529302|gb|EEF31271.1| nutrient reservoir, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356539076|ref|XP_003538026.1| PREDICTED: glutelin type-A 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356542499|ref|XP_003539704.1| PREDICTED: glutelin type-A 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388507332|gb|AFK41732.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|359807097|ref|NP_001241090.1| uncharacterized protein LOC100795038 [Glycine max] gi|255641424|gb|ACU20988.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357473729|ref|XP_003607149.1| Glutelin type-A [Medicago truncatula] gi|355508204|gb|AES89346.1| Glutelin type-A [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357470433|ref|XP_003605501.1| Glutelin type-A [Medicago truncatula] gi|355506556|gb|AES87698.1| Glutelin type-A [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225447318|ref|XP_002280191.1| PREDICTED: 12S seed storage globulin 1 [Vitis vinifera] gi|297739302|emb|CBI28953.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449465356|ref|XP_004150394.1| PREDICTED: glutelin type-A 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 356 | ||||||
| TAIR|locus:2026545 | 356 | AT1G07750 "AT1G07750" [Arabido | 1.0 | 1.0 | 0.783 | 3.1e-154 | |
| TAIR|locus:2065516 | 356 | AT2G28680 "AT2G28680" [Arabido | 1.0 | 1.0 | 0.783 | 6.7e-152 | |
| UNIPROTKB|Q9XHP0 | 459 | Q9XHP0 "11S globulin seed stor | 0.438 | 0.339 | 0.229 | 2.1e-22 | |
| UNIPROTKB|Q9M4Q7 | 353 | Q9M4Q7 "Seed storage protein" | 0.441 | 0.444 | 0.318 | 6.7e-22 | |
| TAIR|locus:2024234 | 455 | CRU2 "AT1G03880" [Arabidopsis | 0.410 | 0.320 | 0.248 | 2.3e-18 | |
| TAIR|locus:2024219 | 451 | AT1G03890 [Arabidopsis thalian | 0.617 | 0.487 | 0.243 | 3.9e-18 | |
| TAIR|locus:2121308 | 524 | CRU3 "AT4G28520" [Arabidopsis | 0.410 | 0.278 | 0.283 | 1.8e-16 | |
| TAIR|locus:2167654 | 472 | CRA1 "CRUCIFERINA" [Arabidopsi | 0.376 | 0.283 | 0.264 | 1.1e-15 | |
| TAIR|locus:2056568 | 511 | AT2G28490 [Arabidopsis thalian | 0.424 | 0.295 | 0.306 | 4.3e-13 | |
| TAIR|locus:2094404 | 486 | PAP85 [Arabidopsis thaliana (t | 0.387 | 0.283 | 0.302 | 1.9e-10 |
| TAIR|locus:2026545 AT1G07750 "AT1G07750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1504 (534.5 bits), Expect = 3.1e-154, P = 3.1e-154
Identities = 279/356 (78%), Positives = 313/356 (87%)
Query: 1 MEIDLTPKLAKQVYGGNGGSYHAWCPNELPMLRQGNIGAAKLALEKNGFALPHYCDSARV 60
ME+DLTPKL K+VYGG+GGSY AWCP ELPML+QGNIGAAKLALEKNGFA+P Y DS++V
Sbjct: 1 MELDLTPKLPKKVYGGDGGSYSAWCPEELPMLKQGNIGAAKLALEKNGFAVPRYSDSSKV 60
Query: 61 AYVLQGSGVAGIVLPEKEEKVVAIKKGDGIALPFGVVTWWYNKEDTELVVLFLGDTSKGH 120
AYVLQGSG AGIVLPEKEEKV+AIK+GD IALPFGVVTWW+N ED ELV+LFLG+T KGH
Sbjct: 61 AYVLQGSGTAGIVLPEKEEKVIAIKQGDSIALPFGVVTWWFNNEDPELVILFLGETHKGH 120
Query: 121 KAGEFTNFFLTGANGIFTGFSTEFVSRAWDLDENTVKTLVGKQTGKGIVKLDANAKLPEP 180
KAG+FT F+LTG NGIFTGFSTEFV RAWDLDENTVK LVG QTG GIVKLDA K+P+P
Sbjct: 121 KAGQFTEFYLTGTNGIFTGFSTEFVGRAWDLDENTVKKLVGSQTGNGIVKLDAGFKMPQP 180
Query: 181 KKEHRDGMAFNCEEAPLDVDIKNGGRVVLLNTKNLPLVGEVGCGADLVRLDGKAMCSPGF 240
K+E+R G NC EAPLDVDIK+GGRVV+LNTKNLPLVGEVG GADLVR+D +MCSPGF
Sbjct: 181 KEENRAGFVLNCLEAPLDVDIKDGGRVVVLNTKNLPLVGEVGFGADLVRIDAHSMCSPGF 240
Query: 241 SCDSALQVTYIVRGSGRAQIVGPDGKRVLETTVKAGNLFIVPRFYVVSKIADPDGLAWFS 300
SCDSALQVTYIV GSGR Q+VG DGKRVLET +KAG+LFIVPRF+VVSKIAD DG++WFS
Sbjct: 241 SCDSALQVTYIVGGSGRVQVVGGDGKRVLETHIKAGSLFIVPRFFVVSKIADADGMSWFS 300
Query: 301 IITTPNPIFTHLAGSIGTWKSLSPSVLEAAFNVPSDVEKQFRSKRANEAIFFPPPN 356
I+TTP+PIFTHLAG+ WKSLSP VL+AAF V +VEK FRS R + AIFFPP N
Sbjct: 301 IVTTPDPIFTHLAGNTSVWKSLSPEVLQAAFKVAPEVEKSFRSTRTSSAIFFPPSN 356
|
|
| TAIR|locus:2065516 AT2G28680 "AT2G28680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9XHP0 Q9XHP0 "11S globulin seed storage protein 2" [Sesamum indicum (taxid:4182)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9M4Q7 Q9M4Q7 "Seed storage protein" [Ricinus communis (taxid:3988)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024234 CRU2 "AT1G03880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024219 AT1G03890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121308 CRU3 "AT4G28520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167654 CRA1 "CRUCIFERINA" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056568 AT2G28490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094404 PAP85 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00026049001 | SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (356 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 356 | |||
| PLN00212 | 493 | PLN00212, PLN00212, glutelin; Provisional | 1e-40 | |
| smart00835 | 146 | smart00835, Cupin_1, Cupin | 2e-31 | |
| smart00835 | 146 | smart00835, Cupin_1, Cupin | 4e-19 | |
| pfam00190 | 139 | pfam00190, Cupin_1, Cupin | 6e-19 | |
| pfam00190 | 139 | pfam00190, Cupin_1, Cupin | 5e-13 |
| >gnl|CDD|215106 PLN00212, PLN00212, glutelin; Provisional | Back alignment and domain information |
|---|
Score = 148 bits (376), Expect = 1e-40
Identities = 94/396 (23%), Positives = 168/396 (42%), Gaps = 83/396 (20%)
Query: 41 KLALEKNGFALPHYCDSARVAYVLQGSGVAGIVLP------------------------- 75
+ +E G LP Y ++ + Y++QG G G+ P
Sbjct: 84 RRVIEPQGLLLPRYSNTPGLVYIIQGRGSMGLTFPGCPATYQQQFQQFLTEGQSQSQKFR 143
Query: 76 EKEEKVVAIKKGDGIALPFGVVTWWYNKEDTELVVLFLGDTSKGHKAGE--FTNFFLTGA 133
++ +K+ ++GD +ALP GV W+YN D +V L++ D + E F L G
Sbjct: 144 DEHQKIHQFRQGDVVALPAGVAHWFYNDGDAPVVALYVYDINNNANQLEPRQREFLLAGN 203
Query: 134 N-----------------GIFTGFSTEFVSRAWDLDENTVKTLVGKQTGKG-IVKLDANA 175
N IF+GFSTE +S A ++ K L + +G I+++
Sbjct: 204 NNRQQQVYGRSIEQHSGQNIFSGFSTELLSEALGINAQVAKRLQSQNDQRGEIIRVKNGL 263
Query: 176 KLPEP-----KKEHRDGMAFNCEEAP-------------LD---------VDIKN----- 203
+L +P +++ + ++ LD ++I+N
Sbjct: 264 QLLQPTLTQQQEQAQQQQQRLYQQVQYQQSQQTSGRWNGLDENFCTIKVRLNIENPSRAD 323
Query: 204 -----GGRVVLLNTKNLPLVGEVGCGADLVRLDGKAMCSPGFSCDSALQVTYIVRGSGRA 258
GR+ LN++ P++ + A V L A+ SP F +A V YI +G R
Sbjct: 324 TYNPRAGRITRLNSQKFPILNLIQMSATRVNLYQNALLSP-FWNVNAHSVVYITQGRARV 382
Query: 259 QIVGPDGKRVLETTVKAGNLFIVPRFYVVSKIADPDGLAWFSIITTPNPIFTHLAGSIGT 318
Q+V +GK V ++ G L I+P+ Y V K A+ +G + + T N + +H+AG
Sbjct: 383 QVVSNNGKTVFNGVLRPGQLLIIPQHYAVLKKAEREGCQYIAFKTNANAMVSHIAGKNSI 442
Query: 319 WKSLSPSVLEAAFNVPSDVEKQFRSKRANEAIFFPP 354
+++L V+ A+ + + ++ ++ R +E F P
Sbjct: 443 FRALPVDVIANAYRISREEARRLKNNRGDELGAFTP 478
|
Length = 493 |
| >gnl|CDD|214845 smart00835, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|214845 smart00835, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|215780 pfam00190, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|215780 pfam00190, Cupin_1, Cupin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| PLN00212 | 493 | glutelin; Provisional | 100.0 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 100.0 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 99.94 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 99.92 | |
| PLN00212 | 493 | glutelin; Provisional | 99.91 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 99.9 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 99.9 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 99.88 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 99.8 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 99.66 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 99.65 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 99.65 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 99.32 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 99.31 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 99.3 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 99.27 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 99.23 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 99.19 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 99.19 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 99.08 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 99.03 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 99.02 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 99.0 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 98.99 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 98.96 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 98.96 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 98.95 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 98.95 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 98.83 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 98.81 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 98.78 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 98.76 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 98.65 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 98.65 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 98.48 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 98.46 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 98.46 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 98.43 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 98.37 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 98.28 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 98.27 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 98.26 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 98.22 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 98.21 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 98.18 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 98.18 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 98.15 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 98.11 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 98.1 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 98.1 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 98.09 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 98.08 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 98.08 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 97.96 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 97.94 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 97.88 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 97.84 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 97.83 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 97.81 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 97.8 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 97.77 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 97.69 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 97.66 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 97.66 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 97.65 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 97.59 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 97.56 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 97.56 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 97.55 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 97.55 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 97.54 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 97.51 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 97.49 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 97.44 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 97.43 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 97.35 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 97.34 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 97.29 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 97.28 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 97.2 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 97.19 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 97.14 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 96.98 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 96.96 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 96.81 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 96.79 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 96.77 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 96.75 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 96.72 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 96.68 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 96.68 | |
| TIGR00218 | 302 | manA mannose-6-phosphate isomerase, class I. The n | 96.64 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 96.63 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 96.63 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 96.59 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 96.5 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 96.42 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 96.38 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 96.38 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 96.33 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 96.28 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 96.27 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 96.23 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 96.17 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 96.17 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 96.15 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 96.12 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 95.99 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 95.88 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 95.82 | |
| PF04962 | 261 | KduI: KduI/IolB family; InterPro: IPR021120 The Kd | 95.77 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 95.73 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 95.46 | |
| PF05995 | 175 | CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 | 95.32 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 94.95 | |
| PLN02288 | 394 | mannose-6-phosphate isomerase | 94.75 | |
| PF12852 | 186 | Cupin_6: Cupin | 94.66 | |
| PRK00924 | 276 | 5-keto-4-deoxyuronate isomerase; Provisional | 94.62 | |
| PF06172 | 139 | Cupin_5: Cupin superfamily (DUF985); InterPro: IPR | 94.55 | |
| KOG3706 | 629 | consensus Uncharacterized conserved protein [Funct | 94.4 | |
| PF13759 | 101 | 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB | 94.21 | |
| PF05726 | 104 | Pirin_C: Pirin C-terminal cupin domain; InterPro: | 94.19 | |
| COG1482 | 312 | ManA Phosphomannose isomerase [Carbohydrate transp | 93.97 | |
| PF05118 | 163 | Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl | 93.7 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 93.39 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 93.19 | |
| PF05726 | 104 | Pirin_C: Pirin C-terminal cupin domain; InterPro: | 93.09 | |
| PF02678 | 107 | Pirin: Pirin; InterPro: IPR003829 This entry repre | 93.03 | |
| PF12852 | 186 | Cupin_6: Cupin | 92.84 | |
| KOG3995 | 279 | consensus 3-hydroxyanthranilate oxygenase HAAO [Am | 92.4 | |
| PF09313 | 82 | DUF1971: Domain of unknown function (DUF1971); Int | 92.3 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 91.91 | |
| TIGR02466 | 201 | conserved hypothetical protein. This family consis | 91.87 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 91.75 | |
| COG2850 | 383 | Uncharacterized conserved protein [Function unknow | 91.6 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 91.41 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 91.06 | |
| COG3542 | 162 | Uncharacterized conserved protein [Function unknow | 91.0 | |
| PF05995 | 175 | CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 | 90.73 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 90.71 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 90.45 | |
| COG3508 | 427 | HmgA Homogentisate 1,2-dioxygenase [Secondary meta | 90.44 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 90.19 | |
| KOG3706 | 629 | consensus Uncharacterized conserved protein [Funct | 90.16 | |
| PF06865 | 94 | DUF1255: Protein of unknown function (DUF1255); In | 90.1 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 89.87 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 89.59 | |
| PLN02288 | 394 | mannose-6-phosphate isomerase | 89.58 | |
| COG2850 | 383 | Uncharacterized conserved protein [Function unknow | 89.25 | |
| PF09313 | 82 | DUF1971: Domain of unknown function (DUF1971); Int | 88.67 | |
| PF13464 | 77 | DUF4115: Domain of unknown function (DUF4115) | 88.59 | |
| PF13759 | 101 | 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB | 88.58 | |
| PF07847 | 200 | DUF1637: Protein of unknown function (DUF1637); In | 88.44 | |
| PRK10579 | 94 | hypothetical protein; Provisional | 88.39 | |
| COG1741 | 276 | Pirin-related protein [General function prediction | 88.37 | |
| PF07385 | 225 | DUF1498: Protein of unknown function (DUF1498); In | 87.44 | |
| TIGR00218 | 302 | manA mannose-6-phosphate isomerase, class I. The n | 87.41 | |
| PF06172 | 139 | Cupin_5: Cupin superfamily (DUF985); InterPro: IPR | 86.87 | |
| PF11142 | 63 | DUF2917: Protein of unknown function (DUF2917); In | 86.68 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 86.26 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 85.24 | |
| COG3718 | 270 | IolB Uncharacterized enzyme involved in inositol m | 84.4 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 83.73 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 83.61 | |
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 83.43 | |
| COG3806 | 216 | ChrR Transcriptional activator [Transcription] | 82.94 | |
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 82.79 | |
| TIGR02466 | 201 | conserved hypothetical protein. This family consis | 82.21 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 81.99 | |
| PF14525 | 172 | AraC_binding_2: AraC-binding-like domain | 81.96 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 80.92 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 80.81 | |
| PF06865 | 94 | DUF1255: Protein of unknown function (DUF1255); In | 80.78 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 80.66 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 80.54 |
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.4e-74 Score=567.04 Aligned_cols=349 Identities=26% Similarity=0.500 Sum_probs=317.3
Q ss_pred cCCCccccceeeCCCeEEEEeCCCCCCCcccCceEEEEEEecCCCcccCeeeCCCEEEEEEeCeEEEEEEcCCCc-----
Q 018395 4 DLTPKLAKQVYGGNGGSYHAWCPNELPMLRQGNIGAAKLALEKNGFALPHYCDSARVAYVLQGSGVAGIVLPEKE----- 78 (356)
Q Consensus 4 dl~~~~~~~~~~~~~G~i~~~~~~~~p~l~~~~~~~~~~~l~Pg~~~~pH~h~a~e~~yVl~G~~~~~vv~~~~~----- 78 (356)
.|++.+|+.++++++|.++.|+.. .+.|+|.++++.+++|+|+++.+||||++++++||++|+|+++++.|+|.
T Consensus 48 ~l~a~ep~~ri~se~G~~E~~~~~-~~q~~caGv~~~R~~i~p~gL~lP~y~na~~liyV~qG~G~~G~v~pGcpeT~~~ 126 (493)
T PLN00212 48 RLQAFEPLRKVRSEAGVTEYFDEK-NEQFQCTGVFVIRRVIEPQGLLLPRYSNTPGLVYIIQGRGSMGLTFPGCPATYQQ 126 (493)
T ss_pred ccccCCCchhhcccCceeeecCCC-ChhhcccceEEEEEEecCCcccCccccCCCeEEEEEeCeEEEEEEeCCCcchhhh
Confidence 478999999999999999999965 59999999999999999999999999999999999999999999987652
Q ss_pred --------------------eEEEEEcCCCEEEeCCCcEEEEEecCCCcEEEEEEeeCCCCCC---CCceeEEeeccc--
Q 018395 79 --------------------EKVVAIKKGDGIALPFGVVTWWYNKEDTELVVLFLGDTSKGHK---AGEFTNFFLTGA-- 133 (356)
Q Consensus 79 --------------------~~~~~l~~GDv~~iP~G~~H~~~N~g~e~l~~l~i~~~~~~~~---pg~~~~f~lag~-- 133 (356)
++++.|++|||++||+|++||++|+|++++++++++++++..| |+ +..|||||+
T Consensus 127 ~~~~~~~~~~~~~~~~~d~hqkv~~lr~GDViaiPaG~~hw~yN~Gd~~~v~v~~~d~~n~~Nqld~~-~r~F~LaG~~~ 205 (493)
T PLN00212 127 QFQQFLTEGQSQSQKFRDEHQKIHQFRQGDVVALPAGVAHWFYNDGDAPVVALYVYDINNNANQLEPR-QREFLLAGNNN 205 (493)
T ss_pred hcccccccccccccccccccccceEeccCCEEEECCCCeEEEEeCCCCcEEEEEEEeccccccccCCC-cceeeccCCCc
Confidence 2447999999999999999999999999999999999887655 53 579999996
Q ss_pred ---------------ccccccCcHHHHHhhccCCHHHHHHhhcccC-CceEEEcCCCCcCCCCCcc--------------
Q 018395 134 ---------------NGIFTGFSTEFVSRAWDLDENTVKTLVGKQT-GKGIVKLDANAKLPEPKKE-------------- 183 (356)
Q Consensus 134 ---------------~s~l~~~~~~vl~~af~~~~~~~~~l~~~q~-~~~iv~~~~~~~~~~p~~~-------------- 183 (356)
.++|++|++++|++|||++.++++||+.+|+ ++.||+++++++..+|..+
T Consensus 206 ~~~~~~~~~~~~~~~~nifsGF~~e~La~Afnv~~e~~~klq~~~d~rG~IVrv~~~l~~~~P~~~~~~e~~~~~~~~~~ 285 (493)
T PLN00212 206 RQQQVYGRSIEQHSGQNIFSGFSTELLSEALGINAQVAKRLQSQNDQRGEIIRVKNGLQLLQPTLTQQQEQAQQQQQRLY 285 (493)
T ss_pred cccccccccccccccCchhhcCCHHHHHHHHCCCHHHHHHHhccccCCccEEEECCCcccCCCchhhhhHHHHhhhhccc
Confidence 3599999999999999999999999998764 5899999987765555210
Q ss_pred --------c--------------CCCceeeccC-CCCCcccCCCcEEEEeCCCCCCCccccCceeEEEEecCCCeecccc
Q 018395 184 --------H--------------RDGMAFNCEE-APLDVDIKNGGRVVLLNTKNLPLVGEVGCGADLVRLDGKAMCSPGF 240 (356)
Q Consensus 184 --------~--------------~~~~~~~l~~-~~~~~~~~~gG~~~~~~~~~~p~l~~l~~s~~~v~l~~g~~~~PH~ 240 (356)
. +..+++||.. .+++++++.+|+++++++.+||+|++|+||+++++|.+|||++|||
T Consensus 286 ~~~~~~~~~~~~~~~ngleEt~c~~rlr~Ni~~p~~ad~y~~~~G~it~v~~~~~P~L~~L~LSa~rv~L~~gam~~PHw 365 (493)
T PLN00212 286 QQVQYQQSQQTSGRWNGLDENFCTIKVRLNIENPSRADTYNPRAGRITRLNSQKFPILNLIQMSATRVNLYQNALLSPFW 365 (493)
T ss_pred ccchhhhccccccCCCCccccccccccccccCCccccCccCCCceEEEEechhhCccccccCeeEEEEEEcCCcccCCee
Confidence 0 0124677763 5577889999999999999999999999999999999999999999
Q ss_pred cccCCeeEEEEEeceEEEEEEccCCceEEEEEecCCcEEEEcCCcEEEEeeCCCCeEEEEEEcCCCCceecccccccccc
Q 018395 241 SCDSALQVTYIVRGSGRAQIVGPDGKRVLETTVKAGNLFIVPRFYVVSKIADPDGLAWFSIITTPNPIFTHLAGSIGTWK 320 (356)
Q Consensus 241 h~~~A~ei~~v~~G~~~~~iv~~~g~~~~~~~l~~Gdv~vvP~g~~h~~~~~~~~~~~~~~~~~~~p~~~~laG~~s~l~ 320 (356)
|++ |++|+||++|+++++||+++|+++|+++|++||||||||||+|.+.|++++++|++|.+++++...++||++|+|+
T Consensus 366 n~n-A~eI~yV~rG~g~vqvV~~~g~~vf~~~L~~GdvfVVPqg~~v~~~A~~egfe~v~F~tna~~~~s~laG~~Sv~~ 444 (493)
T PLN00212 366 NVN-AHSVVYITQGRARVQVVSNNGKTVFNGVLRPGQLLIIPQHYAVLKKAEREGCQYIAFKTNANAMVSHIAGKNSIFR 444 (493)
T ss_pred cCC-CCEEEEEeecceEEEEEcCCCCEEEEEEEcCCCEEEECCCCeEEEeecCCceEEEEeecCCCccccccccHHHHHH
Confidence 999 9999999999999999999999999999999999999999999999999999999999999998889999999999
Q ss_pred CCCHHHHHHHcCCCHHHHHHHHhcCCCeEEecCCC
Q 018395 321 SLSPSVLEAAFNVPSDVEKQFRSKRANEAIFFPPP 355 (356)
Q Consensus 321 ~~p~~vl~~af~~~~~~~~~l~~~~~~~~~~~~p~ 355 (356)
+||.+||++||+++.+++++|+.++.+++++++|+
T Consensus 445 alp~eVla~Af~is~eea~~lk~n~~~e~~~~~p~ 479 (493)
T PLN00212 445 ALPVDVIANAYRISREEARRLKNNRGDELGAFTPR 479 (493)
T ss_pred hCCHHHHHHHcCCCHHHHHHHHhcccCceeecCCC
Confidence 99999999999999999999999988888999984
|
|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR00218 manA mannose-6-phosphate isomerase, class I | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02288 mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >PRK00924 5-keto-4-deoxyuronate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF06172 Cupin_5: Cupin superfamily (DUF985); InterPro: IPR009327 This is a family of uncharacterised proteins found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >KOG3706 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A | Back alignment and domain information |
|---|
| >PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02466 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
| >COG2850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >COG3542 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3706 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02288 mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >COG2850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins | Back alignment and domain information |
|---|
| >PF13464 DUF4115: Domain of unknown function (DUF4115) | Back alignment and domain information |
|---|
| >PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A | Back alignment and domain information |
|---|
| >PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine | Back alignment and domain information |
|---|
| >PRK10579 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1741 Pirin-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length | Back alignment and domain information |
|---|
| >TIGR00218 manA mannose-6-phosphate isomerase, class I | Back alignment and domain information |
|---|
| >PF06172 Cupin_5: Cupin superfamily (DUF985); InterPro: IPR009327 This is a family of uncharacterised proteins found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >COG3718 IolB Uncharacterized enzyme involved in inositol metabolism [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >COG3806 ChrR Transcriptional activator [Transcription] | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >TIGR02466 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >PF14525 AraC_binding_2: AraC-binding-like domain | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 356 | ||||
| 3qac_A | 465 | Structure Of Amaranth 11s Proglobulin Seed Storage | 6e-27 | ||
| 2evx_A | 459 | Crystal Structure Of Pumpkin Seed Globulin Length = | 2e-26 | ||
| 3ehk_A | 531 | Crystal Structure Of Pru Du Amandin, An Allergenic | 3e-23 | ||
| 1fxz_A | 476 | Crystal Structure Of Soybean Proglycinin A1ab1b Hom | 1e-22 | ||
| 1ucx_A | 476 | Crystal Structure Of Proglycinin C12g Mutant Length | 1e-22 | ||
| 1ud1_A | 476 | Crystal Structure Of Proglycinin Mutant C88s Length | 1e-22 | ||
| 3kgl_A | 466 | Crystal Structure Of Procruciferin, 11s Globulin Fr | 9e-16 | ||
| 3ksc_A | 496 | Crystal Structure Of Pea Prolegumin, An 11s Seed Gl | 6e-14 | ||
| 3ksc_A | 496 | Crystal Structure Of Pea Prolegumin, An 11s Seed Gl | 1e-08 | ||
| 3c3v_A | 510 | Crystal Structure Of Peanut Major Allergen Ara H 3 | 3e-10 | ||
| 2d5f_A | 493 | Crystal Structure Of Recombinant Soybean Proglycini | 5e-10 | ||
| 1od5_A | 492 | Crystal Structure Of Glycinin A3b4 Subunit Homohexa | 9e-10 | ||
| 1cau_A | 181 | Determination Of Three Crystal Structures Of Canava | 8e-05 | ||
| 2cau_A | 445 | Canavalin From Jack Bean Length = 445 | 8e-05 | ||
| 1dgr_A | 178 | Refined Crystal Structure Of Canavalin From Jack Be | 8e-05 |
| >pdb|3QAC|A Chain A, Structure Of Amaranth 11s Proglobulin Seed Storage Protein From Amaranthus Hypochondriacus L Length = 465 | Back alignment and structure |
|
| >pdb|2EVX|A Chain A, Crystal Structure Of Pumpkin Seed Globulin Length = 459 | Back alignment and structure |
| >pdb|3EHK|A Chain A, Crystal Structure Of Pru Du Amandin, An Allergenic Protein From Prunus Dulcis Length = 531 | Back alignment and structure |
| >pdb|1FXZ|A Chain A, Crystal Structure Of Soybean Proglycinin A1ab1b Homotrimer Length = 476 | Back alignment and structure |
| >pdb|1UCX|A Chain A, Crystal Structure Of Proglycinin C12g Mutant Length = 476 | Back alignment and structure |
| >pdb|1UD1|A Chain A, Crystal Structure Of Proglycinin Mutant C88s Length = 476 | Back alignment and structure |
| >pdb|3KGL|A Chain A, Crystal Structure Of Procruciferin, 11s Globulin From Brassica Napus Length = 466 | Back alignment and structure |
| >pdb|3KSC|A Chain A, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin From Pisum Sativum L. Length = 496 | Back alignment and structure |
| >pdb|3KSC|A Chain A, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin From Pisum Sativum L. Length = 496 | Back alignment and structure |
| >pdb|3C3V|A Chain A, Crystal Structure Of Peanut Major Allergen Ara H 3 Length = 510 | Back alignment and structure |
| >pdb|2D5F|A Chain A, Crystal Structure Of Recombinant Soybean Proglycinin A3b4 Subunit, Its Comparison With Mature Glycinin A3b4 Subunit, Responsible For Hexamer Assembly Length = 493 | Back alignment and structure |
| >pdb|1OD5|A Chain A, Crystal Structure Of Glycinin A3b4 Subunit Homohexamer Length = 492 | Back alignment and structure |
| >pdb|1CAU|A Chain A, Determination Of Three Crystal Structures Of Canavalin By Molecular Replacement Length = 181 | Back alignment and structure |
| >pdb|2CAU|A Chain A, Canavalin From Jack Bean Length = 445 | Back alignment and structure |
| >pdb|1DGR|A Chain A, Refined Crystal Structure Of Canavalin From Jack Bean Length = 178 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 356 | |||
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 1e-91 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 1e-12 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 3e-90 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 4e-85 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 3e-14 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 9e-84 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 9e-83 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 3e-16 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 8e-09 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 1e-67 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 3e-67 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 2e-62 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 3e-61 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 2e-10 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 2e-60 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 3e-11 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 6e-56 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 5e-32 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 8e-12 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 7e-50 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 4e-48 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 2e-43 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 3e-10 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 3e-43 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 1e-13 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 6e-43 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 3e-38 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 1e-09 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 5e-33 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 9e-09 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 1e-13 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 3e-06 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 1e-06 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 2e-06 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 2e-06 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 1e-05 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 2e-04 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 3e-04 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 5e-04 |
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 | Back alignment and structure |
|---|
Score = 281 bits (718), Expect = 1e-91
Identities = 97/439 (22%), Positives = 166/439 (37%), Gaps = 89/439 (20%)
Query: 4 DLTPKLAKQVYGGNGGSYHAWCPNELPMLRQGNIGAAKLALEKNGFALPHYCDSARVAYV 63
LT G W NE R + + +E +G LP + + + Y+
Sbjct: 18 RLTALEPTNRIQAERGLTEVWDSNE-QEFRCAGVSVIRRTIEPHGLLLPSFTSAPELIYI 76
Query: 64 LQGSGVAGIVLP-------------------------------------EKEEKVVAIKK 86
QG+G+ G+++P ++ +K+ +++
Sbjct: 77 EQGNGITGMMIPGCPETYESGSQQFQGGEDERIREQGSRKFGMRGDRFQDQHQKIRHLRE 136
Query: 87 GDGIALPFGVVTWWYNKEDTELVVLFLGDTSKGHKAGE---FTNFFLTG----------- 132
GD A+P GV W YN D LV + L DT+ + T F+L G
Sbjct: 137 GDIFAMPAGVSHWAYNNGDQPLVAVILIDTANHANQLDKNFPTRFYLAGKPQQEHSGEHQ 196
Query: 133 -----------ANGIFTGFSTEFVSRAWDLDENTVKTLVGKQTGKG-IVKLDANAKLPEP 180
IF GF T ++ ++ + E + L +Q +G IV++ + +P
Sbjct: 197 FSRESRRGERNTGNIFRGFETRLLAESFGVSEEIAQKLQAEQDDRGNIVRVQEGLHVIKP 256
Query: 181 KKEHRDG-----------------------MAFNCEE-APLDVDIKNGGRVVLLNTKNLP 216
+ +A N ++ + DV GR+ +N+ NLP
Sbjct: 257 PSRAWEEREQGSRGSRYLPNGVEETICSARLAVNVDDPSKADVYTPEAGRLTTVNSFNLP 316
Query: 217 LVGEVGCGADLVRLDGKAMCSPGFSCDSALQVTYIVRGSGRAQIVGPDGKRVLETTVKAG 276
++ + A L AM +P ++ + A + Y VRG GR QIV G+ V + + G
Sbjct: 317 ILRHLRLSAAKGVLYRNAMMAPHYNLN-AHNIMYCVRGRGRIQIVNDQGQSVFDEELSRG 375
Query: 277 NLFIVPRFYVVSKIADPDGLAWFSIITTPNPIFTHLAGSIGTWKSLSPSVLEAAFNVPSD 336
L +VP+ + + K A DG W S T+ N +F LAG +SL V+ + + +
Sbjct: 376 QLVVVPQNFAIVKQAFEDGFEWVSFKTSENAMFQSLAGRTSAIRSLPIDVVSNIYQISRE 435
Query: 337 VEKQFRSKRANEAIFFPPP 355
+ R +F
Sbjct: 436 EAFGLKFNRPETTLFRSSG 454
|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531 | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531 | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531 | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Length = 493 | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Length = 201 | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Length = 201 | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y Length = 93 | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Length = 79 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 100.0 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 100.0 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 100.0 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 100.0 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 100.0 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 100.0 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 100.0 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 100.0 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 100.0 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 100.0 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 100.0 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 100.0 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 100.0 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 100.0 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 100.0 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.97 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 99.96 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 99.96 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 99.96 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.95 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 99.95 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 99.95 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 99.95 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 99.95 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 99.95 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 99.94 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 99.94 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 99.94 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 99.93 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 99.93 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 99.91 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 99.91 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.89 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 99.87 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 99.85 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 99.84 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 99.83 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 99.81 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 99.79 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.77 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 99.77 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 99.76 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 99.75 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 99.73 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 99.72 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 99.71 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 99.7 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 99.63 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.55 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.53 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 99.4 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 99.32 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 99.32 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 99.32 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 99.31 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 99.31 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 99.3 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 99.3 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 99.28 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 99.26 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 99.26 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 99.25 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 99.25 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 99.25 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 99.24 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 99.24 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 99.23 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 99.23 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 99.23 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 99.22 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 99.2 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 99.19 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 99.17 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 99.17 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 99.16 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 99.14 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 99.13 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 99.12 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 99.11 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 99.11 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 99.1 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 99.1 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 99.1 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 99.09 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 99.07 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 99.05 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 99.05 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 99.03 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 99.03 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 99.03 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 99.03 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 99.02 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 99.0 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 98.98 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 98.98 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 98.98 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 98.97 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.96 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 98.95 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 98.94 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 98.94 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 98.91 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 98.9 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 98.89 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 98.89 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 98.89 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 98.84 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 98.83 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 98.83 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 98.83 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 98.81 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 98.81 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 98.79 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 98.78 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 98.78 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 98.77 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 98.77 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 98.76 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 98.76 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 98.76 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 98.76 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 98.76 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 98.75 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 98.73 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 98.73 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 98.73 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 98.73 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.72 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 98.67 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 98.67 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 98.67 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 98.65 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 98.65 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.64 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.63 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 98.62 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 98.6 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 98.57 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 98.52 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 98.51 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 98.51 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 98.49 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 98.48 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 98.48 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 98.47 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 98.47 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 98.46 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 98.41 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 98.39 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 98.38 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 98.36 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 98.36 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 98.36 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 98.3 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 98.27 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.26 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 98.24 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 98.18 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 98.17 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 98.17 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 98.16 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 98.11 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 98.11 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 98.06 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.06 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 98.06 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 98.01 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 98.0 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 97.92 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 97.91 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 97.89 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 97.86 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 97.83 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 97.83 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 97.83 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 97.72 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 97.68 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 97.68 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 97.66 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 97.63 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 97.59 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 97.56 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 97.54 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 97.53 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 97.43 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 97.39 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 97.37 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 97.36 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 97.35 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 97.32 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 97.31 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 97.29 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 97.17 | |
| 2p17_A | 277 | Pirin-like protein; GK1651, structural genomics, s | 97.14 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 97.13 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 97.11 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 97.08 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 96.98 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 96.96 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 96.94 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 96.9 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 96.83 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 96.81 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 96.79 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 96.79 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 96.76 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 96.72 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 96.71 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 96.68 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 96.65 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 96.62 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 96.54 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 96.46 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 96.45 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 96.44 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 96.43 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 96.25 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 96.25 | |
| 2wfp_A | 394 | Mannose-6-phosphate isomerase; APO-structure, meta | 96.2 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 96.15 | |
| 1zx5_A | 300 | Mannosephosphate isomerase, putative; STRU genomic | 96.08 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 96.08 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 96.06 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 96.03 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 96.0 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 95.99 | |
| 4hn1_A | 201 | Putative 3-epimerase in D-allose pathway; 3'-monoe | 95.98 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 95.97 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 95.91 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 95.87 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 95.83 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 95.75 | |
| 1j1l_A | 290 | Pirin; beta sandwich, cupin, iron, metatl binding | 95.72 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 95.7 | |
| 3m3i_A | 225 | Putative uncharacterized protein; PFAM:PF06172, st | 95.58 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 95.55 | |
| 3loi_A | 172 | Putative uncharacterized protein; beta barrel, unk | 95.47 | |
| 4hn1_A | 201 | Putative 3-epimerase in D-allose pathway; 3'-monoe | 95.45 | |
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 95.39 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 95.38 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 95.07 | |
| 3loi_A | 172 | Putative uncharacterized protein; beta barrel, unk | 95.05 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 94.99 | |
| 1xe7_A | 203 | YML079WP, hypothetical 22.5 kDa protein in TUB1-CP | 94.96 | |
| 3kmh_A | 246 | D-lyxose isomerase; cupin beta-barrel, structural | 94.96 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 94.89 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 94.85 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 94.84 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 94.83 | |
| 1xru_A | 282 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; | 94.75 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 94.59 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 94.56 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 94.49 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 94.44 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 94.41 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 94.13 | |
| 1znp_A | 154 | Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, | 94.05 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 93.91 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 93.87 | |
| 1e5r_A | 290 | Proline oxidase; oxidoreductase, oxygenase, 2-oxog | 93.87 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 93.86 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 93.79 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 93.74 | |
| 1ywk_A | 289 | 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer | 93.66 | |
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 93.65 | |
| 3rcq_A | 197 | Aspartyl/asparaginyl beta-hydroxylase; structural | 93.2 | |
| 3m3i_A | 225 | Putative uncharacterized protein; PFAM:PF06172, st | 93.08 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 92.91 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 92.9 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 92.06 | |
| 1znp_A | 154 | Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, | 91.94 | |
| 2oyz_A | 94 | UPF0345 protein VPA0057; unknown function, structu | 91.68 | |
| 1xe7_A | 203 | YML079WP, hypothetical 22.5 kDa protein in TUB1-CP | 91.02 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 90.2 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 89.53 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 89.05 | |
| 1j1l_A | 290 | Pirin; beta sandwich, cupin, iron, metatl binding | 89.03 | |
| 2rg4_A | 216 | Uncharacterized protein; rhodobacterales, oceanico | 88.22 | |
| 2p17_A | 277 | Pirin-like protein; GK1651, structural genomics, s | 87.65 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 87.43 | |
| 2qdr_A | 303 | Uncharacterized protein; double-stranded beta-heli | 87.4 | |
| 3hqx_A | 111 | UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC | 87.11 | |
| 3dl3_A | 119 | Tellurite resistance protein B; X-RAY NESG VFR98 Q | 87.06 | |
| 2wfp_A | 394 | Mannose-6-phosphate isomerase; APO-structure, meta | 86.49 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 86.18 | |
| 3dl3_A | 119 | Tellurite resistance protein B; X-RAY NESG VFR98 Q | 85.89 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 85.43 | |
| 3eo6_A | 106 | Protein of unknown function (DUF1255); AFE_2634, s | 83.9 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 83.7 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 83.13 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 82.57 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 82.56 | |
| 3kmh_A | 246 | D-lyxose isomerase; cupin beta-barrel, structural | 82.12 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 82.11 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 81.57 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 81.51 | |
| 2oyz_A | 94 | UPF0345 protein VPA0057; unknown function, structu | 81.4 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 80.98 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 80.76 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 80.74 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 80.7 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 80.56 | |
| 2z69_A | 154 | DNR protein; beta barrel, dimerization helix, tran | 80.05 |
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.5e-79 Score=605.65 Aligned_cols=349 Identities=24% Similarity=0.448 Sum_probs=321.3
Q ss_pred cCCCccccceeeCCCeEEEEeCCCCCCCcccCceEEEEEEecCCCcccCeeeCCCEEEEEEeCeEEEEEEcCCCce----
Q 018395 4 DLTPKLAKQVYGGNGGSYHAWCPNELPMLRQGNIGAAKLALEKNGFALPHYCDSARVAYVLQGSGVAGIVLPEKEE---- 79 (356)
Q Consensus 4 dl~~~~~~~~~~~~~G~i~~~~~~~~p~l~~~~~~~~~~~l~Pg~~~~pH~h~a~e~~yVl~G~~~~~vv~~~~~~---- 79 (356)
||+|.+|+.++++++|.++.|+..+ |.|++.++++++++|+||++.+||||++++++||++|+++++++.|+|.+
T Consensus 11 ~l~a~ep~~~~~se~G~~e~w~~~~-~~L~~~gvs~~r~~i~p~Gl~lPh~~~a~e~~~V~~G~g~~G~v~pgc~et~~~ 89 (466)
T 3kgl_A 11 QLNALEPSHVLKAEAGRIEVWDHHA-PQLRCSGVSFVRYIIESKGLYLPSFFSTAKLSFVAKGEGLMGRVVPGCAETFQD 89 (466)
T ss_dssp CCCCBCCSEEEEETTEEEEECCTTS-HHHHHHTEEEEEEEECTTEEEEEEEESSCEEEEEEECEEEEEEECTTCCCCEEE
T ss_pred cCCCCCCcceeeCCCcEEEEECCCC-hhhccCCeEEEEEEECCCCEeCCeeCCCCeEEEEEeCeEEEEEecCCCcchhhc
Confidence 8999999999999999999999876 89999999999999999999999999999999999999999999986533
Q ss_pred -------------------------------------------------------EEEEEcCCCEEEeCCCcEEEEEecC
Q 018395 80 -------------------------------------------------------KVVAIKKGDGIALPFGVVTWWYNKE 104 (356)
Q Consensus 80 -------------------------------------------------------~~~~l~~GDv~~iP~G~~H~~~N~g 104 (356)
++++|++||+++||+|++||++|+|
T Consensus 90 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~hqkv~~l~~GDvi~iPaG~~~~~~N~g 169 (466)
T 3kgl_A 90 SSVFQPGGGSPFGEGQGQGQQGQGQGHQGQGQGQQGQQGQQGQQSQGQGFRDMHQKVEHIRTGDTIATHPGVAQWFYNDG 169 (466)
T ss_dssp CCSSCCCC-----------------------------------------CCEEESCEEEEETTEEEEECTTCEEEEECCS
T ss_pred cccccccccccccccccccccccccccccccccccccccccccccccccccccceeeccccCCCEEEECCCCcEEEEeCC
Confidence 3459999999999999999999999
Q ss_pred CCcEEEEEEeeCCCCCC--CCceeEEeecccc----------------cccccCcHHHHHhhccCCHHHHHHhhcccC-C
Q 018395 105 DTELVVLFLGDTSKGHK--AGEFTNFFLTGAN----------------GIFTGFSTEFVSRAWDLDENTVKTLVGKQT-G 165 (356)
Q Consensus 105 ~e~l~~l~i~~~~~~~~--pg~~~~f~lag~~----------------s~l~~~~~~vl~~af~~~~~~~~~l~~~q~-~ 165 (356)
+++|+++|++++++..| ++.+++|||||+. |||++|++++|++|||++.++++||+++|+ .
T Consensus 170 ~e~L~~l~~~d~~n~~nQld~~~~~F~LaG~~~~~~~~~~~~~~~~~~ni~sGF~~e~La~Af~v~~e~~~kL~~~q~~~ 249 (466)
T 3kgl_A 170 NQPLVIVSVLDLASHQNQLDRNPRPFYLAGNNPQGQVWIEGREQQPQKNILNGFTPEVLAKAFKIDVRTAQQLQNQQDNR 249 (466)
T ss_dssp SSCEEEEEEEESSSTTCCSCSSCCEEESSCCBTTCCTTSTTCTTCCBCCGGGGSCHHHHHHHHTSCHHHHHHHTCTTCCS
T ss_pred CCcEEEEEEEcCCCcccccCCceeeeEecCCCccccccccccccccCCCccccCCHHHHHHHhCCCHHHHHHHhccccCc
Confidence 99999999999876554 4678999999986 999999999999999999999999998886 6
Q ss_pred ceEEEcCCCCcCCCCCccc------CC---------CceeeccC-CCCCcccCCCcEEEEeCCCCCCCccccCceeEEEE
Q 018395 166 KGIVKLDANAKLPEPKKEH------RD---------GMAFNCEE-APLDVDIKNGGRVVLLNTKNLPLVGEVGCGADLVR 229 (356)
Q Consensus 166 ~~iv~~~~~~~~~~p~~~~------~~---------~~~~~l~~-~~~~~~~~~gG~~~~~~~~~~p~l~~l~~s~~~v~ 229 (356)
+.||++++++..++|.... .+ .++|||.. .+++++++.||+++.+++.+||+|++|+||+++++
T Consensus 250 G~Iv~v~~~l~~~~p~~~~~~~~~~~~glee~~c~~r~~~Ni~~p~~~d~~~~~gG~v~~v~~~~fP~L~~lgiS~a~v~ 329 (466)
T 3kgl_A 250 GNIIRVQGPFSVIRPPLRSQRPQEEVNGLEETICSARCTDNLDDPSNADVYKPQLGYISTLNSYDLPILRFLRLSALRGS 329 (466)
T ss_dssp CSEEECCSCCCCCCCCC--------------CCSSCCCEEETTCGGGEEEEETTTEEEEEECTTTCTTHHHHTCEEEEEE
T ss_pred eeEEEecCcccccCCcccccccccccCCccccccceeccccccCcccCCcccCCCceEEEechhhCcccccCceeeEEEE
Confidence 7999999777777664321 12 34789985 67777789999999999999999999999999999
Q ss_pred ecCCCeecccccccCCeeEEEEEeceEEEEEEccCCceEEEEEecCCcEEEEcCCcEEEEeeCCCCeEEEEEEcCCCCce
Q 018395 230 LDGKAMCSPGFSCDSALQVTYIVRGSGRAQIVGPDGKRVLETTVKAGNLFIVPRFYVVSKIADPDGLAWFSIITTPNPIF 309 (356)
Q Consensus 230 l~~g~~~~PH~h~~~A~ei~~v~~G~~~~~iv~~~g~~~~~~~l~~Gdv~vvP~g~~h~~~~~~~~~~~~~~~~~~~p~~ 309 (356)
|+||||++|||||+ |+||+||++|+++++||+++|+++|+++|++|||||||+|++|++++++++++|++|+++++|+.
T Consensus 330 L~pGgm~~PHwHp~-A~Ei~yVl~G~~rv~~V~~~g~~~f~~~l~~GDV~v~P~G~~H~~~ag~e~~~~l~~f~s~np~~ 408 (466)
T 3kgl_A 330 IRQNAMVLPQWNAN-ANAVLYVTDGEAHVQVVNDNGDRVFDGQVSQGQLLSIPQGFSVVKRATSEQFRWIEFKTNANAQI 408 (466)
T ss_dssp EETTEEEEEEEESS-CCEEEEEEESEEEEEEECTTSCEEEEEEEETTCEEEECTTCEEEEEECSSEEEEEEEESSSSCCE
T ss_pred eecCcEeeeeECCC-CCEEEEEEeceEEEEEEeCCCcEEEEeEecCCcEEEECCCCeEEEEcCCCCEEEEEEECCCCCcc
Confidence 99999999999999 99999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eccccccccccCCCHHHHHHHcCCCHHHHHHHHhcCCCeEEecCC
Q 018395 310 THLAGSIGTWKSLSPSVLEAAFNVPSDVEKQFRSKRANEAIFFPP 354 (356)
Q Consensus 310 ~~laG~~s~l~~~p~~vl~~af~~~~~~~~~l~~~~~~~~~~~~p 354 (356)
.+|+|+++||++||++||+++|+++.+++++|++++++++|+.|+
T Consensus 409 ~~LaG~~s~~~~lP~eVla~aF~v~~~~v~~Lk~~q~e~~i~~~~ 453 (466)
T 3kgl_A 409 NTLAGRTSVLRGLPLEVISNGYQISLEEARRVKFNTIETTLTHSS 453 (466)
T ss_dssp EESSSTTCTGGGSCHHHHHHHHTCCHHHHHHHHHSCCCSSEEECC
T ss_pred ccccchhhhhhhCCHHHHHHHhCcCHHHHHHHHhccCccEEECCC
Confidence 999999999999999999999999999999999999998888654
|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >3m3i_A Putative uncharacterized protein; PFAM:PF06172, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 2.35A {Leishmania major} | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >3loi_A Putative uncharacterized protein; beta barrel, unknown function; 2.10A {Branchiostoma belcheri tsingtauense} SCOP: b.82.1.0 PDB: 3lzz_A* | Back alignment and structure |
|---|
| >4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A | Back alignment and structure |
|---|
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >3loi_A Putative uncharacterized protein; beta barrel, unknown function; 2.10A {Branchiostoma belcheri tsingtauense} SCOP: b.82.1.0 PDB: 3lzz_A* | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >1xe7_A YML079WP, hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region; jelly roll motif, cupin superfamily, structural genomics; HET: GUN; 1.75A {Saccharomyces cerevisiae} SCOP: b.82.1.16 PDB: 1xe8_A* | Back alignment and structure |
|---|
| >3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* | Back alignment and structure |
|---|
| >1znp_A Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, structural genomics, PSI, protein struc initiative; 2.50A {Agrobacterium tumefaciens str} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* | Back alignment and structure |
|---|
| >1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13 | Back alignment and structure |
|---|
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
| >3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3m3i_A Putative uncharacterized protein; PFAM:PF06172, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 2.35A {Leishmania major} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >1znp_A Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, structural genomics, PSI, protein struc initiative; 2.50A {Agrobacterium tumefaciens str} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 | Back alignment and structure |
|---|
| >1xe7_A YML079WP, hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region; jelly roll motif, cupin superfamily, structural genomics; HET: GUN; 1.75A {Saccharomyces cerevisiae} SCOP: b.82.1.16 PDB: 1xe8_A* | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* | Back alignment and structure |
|---|
| >2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A | Back alignment and structure |
|---|
| >2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 | Back alignment and structure |
|---|
| >3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270} | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 356 | ||||
| d1j58a_ | 372 | b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B | 2e-42 | |
| d1od5a1 | 245 | b.82.1.2 (A:7-251) Seed storage 7S protein {Soybea | 4e-39 | |
| d1fxza1 | 239 | b.82.1.2 (A:10-248) Seed storage 7S protein {Soybe | 3e-37 | |
| d1fxza2 | 174 | b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb | 2e-32 | |
| d1fxza2 | 174 | b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb | 1e-19 | |
| d1od5a2 | 173 | b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb | 9e-30 | |
| d1od5a2 | 173 | b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb | 2e-17 | |
| d2phla1 | 200 | b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc | 1e-24 | |
| d2phla1 | 200 | b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc | 7e-12 | |
| g1dgw.1 | 168 | b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea | 3e-24 | |
| g1dgw.1 | 168 | b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea | 6e-21 | |
| d1uika1 | 203 | b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb | 1e-23 | |
| d1uika1 | 203 | b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb | 1e-10 | |
| d1dgwa_ | 178 | b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( | 1e-23 | |
| d1dgwa_ | 178 | b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( | 5e-15 | |
| d1uika2 | 185 | b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb | 5e-23 | |
| d1uika2 | 185 | b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb | 4e-21 | |
| d1uija1 | 170 | b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea | 4e-21 | |
| d1uija1 | 170 | b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea | 5e-11 | |
| d2et1a1 | 201 | b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare | 1e-18 | |
| d2et1a1 | 201 | b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare | 2e-14 | |
| d2phla2 | 162 | b.82.1.2 (A:220-381) Seed storage 7S protein {Fren | 2e-15 | |
| d2phla2 | 162 | b.82.1.2 (A:220-381) Seed storage 7S protein {Fren | 2e-14 | |
| d2phda1 | 351 | b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps | 7e-08 | |
| d2d40a1 | 308 | b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es | 8e-08 | |
| d3bu7a1 | 355 | b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si | 2e-07 | |
| d1sfna_ | 245 | b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc | 4e-05 | |
| d1x82a_ | 190 | b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI { | 1e-04 | |
| d1juha_ | 348 | b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill | 7e-04 | |
| d1y3ta1 | 330 | b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci | 0.001 | |
| d1vr3a1 | 179 | b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse | 0.003 | |
| d1sq4a_ | 273 | b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { | 0.004 |
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Germin/Seed storage 7S protein domain: Oxalate decarboxylase OxdC (YvrK) species: Bacillus subtilis [TaxId: 1423]
Score = 149 bits (377), Expect = 2e-42
Identities = 54/325 (16%), Positives = 112/325 (34%), Gaps = 24/325 (7%)
Query: 27 NELPMLRQGNIGAAKLALEKNGFALPHYCDSARVAYVLQGSGVAGIVLPEKEEKVVAIKK 86
ELP+ N+ + + L+ H+ A AY++ GS IV + + + +
Sbjct: 64 RELPISE--NLASVNMRLKPGAIRELHWHKEAEWAYMIYGSARVTIVDEKGRSFIDDVGE 121
Query: 87 GDGIALPFGVVTWWYNKEDTELVVLFLGDTSKGHKAGEFTNFFLTGANGIFTGFSTEFVS 146
GD P G+ E+ +L D G F+ E ++
Sbjct: 122 GDLWYFPSGLPHSIQALEEGAEFLLVFDD-------GSFSENSTFQLTDWLAHTPKEVIA 174
Query: 147 RAWDLDENTVKTLVGKQTGKGIVKLDAN---AKLPEPKKEHRDGMAFN-CEEAPLDVDIK 202
+ + + + L GK+ +L + + P E + E+ P++
Sbjct: 175 ANFGVTKEEISNLPGKEKYIFENQLPGSLKDDIVEGPNGEVPYPFTYRLLEQEPIES--- 231
Query: 203 NGGRVVLLNTKNLPLVGEVGCGADLVRLDGKAMCSPGFSCDSALQVTYIVRGSGRAQIVG 262
GG+V + ++ N + + LV ++ AM + ++ + Y + G R +
Sbjct: 232 EGGKVYIADSTNFKVSKTIASA--LVTVEPGAMRELHWHPNTH-EWQYYISGKARMTVFA 288
Query: 263 PDGKRVLETTVKAGNLFIVPRFYVVSKI-ADPDGLAWFSIITTPNPIFTHLAGSIGTWKS 321
DG +AG++ VP + L + I + L +
Sbjct: 289 SDGHART-FNYQAGDVGYVPFAMGHYVENIGDEPLVFLEIFKDDHYADVSLNQWLA---M 344
Query: 322 LSPSVLEAAFNVPSDVEKQFRSKRA 346
L + ++A ++ D ++
Sbjct: 345 LPETFVQAHLDLGKDFTDVLSKEKH 369
|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245 | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239 | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190 | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 100.0 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 100.0 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 100.0 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 100.0 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 100.0 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 100.0 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 100.0 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 100.0 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 100.0 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 100.0 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 100.0 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.98 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 99.97 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 99.97 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 99.97 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 99.97 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 99.97 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.96 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 99.96 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 99.95 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 99.95 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 99.94 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 99.94 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 99.93 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 99.93 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 99.88 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 99.87 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 99.87 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 99.86 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 99.82 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 99.81 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 99.81 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 99.81 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 99.76 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 99.73 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 99.61 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 99.54 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 99.45 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 99.44 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 99.44 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 99.41 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 99.31 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 99.31 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 99.26 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 99.24 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 99.17 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 99.15 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 99.14 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 99.13 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 99.12 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 99.11 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 99.06 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 99.02 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 98.98 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 98.96 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 98.95 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 98.95 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 98.95 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 98.91 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 98.91 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 98.87 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 98.71 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 98.69 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 98.58 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 98.57 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 98.52 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 98.41 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 98.36 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 98.18 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 97.99 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 97.98 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 97.97 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 97.86 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 97.79 | |
| d1tq5a1 | 231 | Hypothetical protein YhhW {Escherichia coli [TaxId | 97.77 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 97.76 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 97.45 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 97.43 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 97.42 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 97.41 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 97.36 | |
| d1j1la_ | 288 | Pirin {Human (Homo sapiens) [TaxId: 9606]} | 97.14 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 97.09 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 96.8 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 96.62 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 96.61 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 96.51 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 96.49 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 96.48 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 96.45 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 96.38 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 96.34 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 96.32 | |
| d1oi6a_ | 202 | dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc | 96.32 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 96.28 | |
| d1zx5a1 | 299 | Putative mannosephosphate isomerase AF0035 {Archae | 96.27 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 96.24 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 96.14 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 96.09 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 95.99 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 95.92 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 95.92 | |
| d1oi6a_ | 202 | dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc | 95.86 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 95.83 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 95.79 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 95.73 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 95.42 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 95.26 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 95.18 | |
| d1yuda1 | 158 | Hypothetical protein SO0799 {Shewanella oneidensis | 95.15 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 95.1 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 94.68 | |
| d1yuda1 | 158 | Hypothetical protein SO0799 {Shewanella oneidensis | 94.42 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 94.27 | |
| d1j1la_ | 288 | Pirin {Human (Homo sapiens) [TaxId: 9606]} | 93.47 | |
| d1znpa1 | 140 | Hypothetical protein Atu3615 {Agrobacterium tumefa | 92.92 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 92.46 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 92.0 | |
| d3bb6a1 | 109 | Uncharacterized protein YeaR {Escherichia coli [Ta | 91.59 | |
| d1znpa1 | 140 | Hypothetical protein Atu3615 {Agrobacterium tumefa | 89.76 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 89.29 | |
| d2oyza1 | 93 | Uncharacterized protein VPA0057 {Vibrio parahaemol | 88.96 | |
| d1e5ra_ | 290 | Type II Proline 3-hydroxylase (proline oxidase) {S | 88.46 | |
| d1xe7a_ | 194 | Hypothetical protein YML079W {Baker's yeast (Sacch | 88.4 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 88.16 | |
| d1xrua1 | 277 | 5-keto-4-deoxyuronate isomerase KduI {Escherichia | 86.99 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 86.24 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 85.23 | |
| d1tq5a1 | 231 | Hypothetical protein YhhW {Escherichia coli [TaxId | 85.12 | |
| d1zx5a1 | 299 | Putative mannosephosphate isomerase AF0035 {Archae | 84.13 | |
| d3e5ua2 | 139 | Chlorophenol reduction protein CprK {Desulfitobact | 84.05 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 83.66 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 83.6 | |
| d1o5la1 | 129 | CRP-like transcriptional regulator TM1171, N-termi | 83.3 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 82.85 | |
| d3e5ua2 | 139 | Chlorophenol reduction protein CprK {Desulfitobact | 82.38 | |
| d3bb6a1 | 109 | Uncharacterized protein YeaR {Escherichia coli [Ta | 82.12 | |
| d3dl3a1 | 96 | Tellurite resistance protein B, TehB {Vibrio fisch | 82.09 | |
| d1cx4a1 | 136 | Regulatory subunit of Protein kinase A {Rat (Rattu | 81.92 | |
| d2gaua2 | 142 | Transcriptional regulator PG0396, N-terminal domai | 81.71 | |
| d1zyba2 | 147 | Probable transcription regulator BT4300, N-termina | 80.4 | |
| d2oyza1 | 93 | Uncharacterized protein VPA0057 {Vibrio parahaemol | 80.36 |
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Germin/Seed storage 7S protein domain: Oxalate decarboxylase OxdC (YvrK) species: Bacillus subtilis [TaxId: 1423]
Probab=100.00 E-value=1e-57 Score=441.06 Aligned_cols=311 Identities=18% Similarity=0.241 Sum_probs=268.1
Q ss_pred CCCeEEEEeCCCCCCCcccCceEEEEEEecCCCcccCeeeCCCEEEEEEeCeEEEEEEcCCCceEEEEEcCCCEEEeCCC
Q 018395 16 GNGGSYHAWCPNELPMLRQGNIGAAKLALEKNGFALPHYCDSARVAYVLQGSGVAGIVLPEKEEKVVAIKKGDGIALPFG 95 (356)
Q Consensus 16 ~~~G~i~~~~~~~~p~l~~~~~~~~~~~l~Pg~~~~pH~h~a~e~~yVl~G~~~~~vv~~~~~~~~~~l~~GDv~~iP~G 95 (356)
.+||++++.+..++|.++ +|++..++|+||++++||||.+.||.||++|++++++++++++..+.+|++||+++||+|
T Consensus 53 ~~gg~~r~~~~~~lp~~~--~~a~~~~~L~pga~~~pH~H~~ae~~yVl~G~~~vt~Vd~~G~~~~~~l~~GDv~~~P~G 130 (372)
T d1j58a_ 53 EKGGYAREVTVRELPISE--NLASVNMRLKPGAIRELHWHKEAEWAYMIYGSARVTIVDEKGRSFIDDVGEGDLWYFPSG 130 (372)
T ss_dssp ETTEEEEEECTTTCTTCS--SCEEEEEEECTTCEEEEEEESSCEEEEEEEEEEEEEEECTTSCEEEEEEETTEEEEECTT
T ss_pred cCCCeeEEeehhhChhhh--hhhheEEEECCCcCcCCcccCcccEEEEEeCEEEEEEEeCCCcEEEEEeccCCEEEECCC
Confidence 489999999999999997 589999999999999999995569999999999999999998877789999999999999
Q ss_pred cEEEEEecCCCcEEEEEEeeCCCCCCCCceeEEeecccccccccCcHHHHHhhccCCHHHHHHhhcccCCceEEEcCCCC
Q 018395 96 VVTWWYNKEDTELVVLFLGDTSKGHKAGEFTNFFLTGANGIFTGFSTEFVSRAWDLDENTVKTLVGKQTGKGIVKLDANA 175 (356)
Q Consensus 96 ~~H~~~N~g~e~l~~l~i~~~~~~~~pg~~~~f~lag~~s~l~~~~~~vl~~af~~~~~~~~~l~~~q~~~~iv~~~~~~ 175 (356)
++||++|. +++++++.+++.. ++.....|.+ .+||+++|.+||+++|+++.+++++++++|. +|+......
T Consensus 131 ~~H~i~n~-~dg~e~l~vf~~~---~~~~~~~f~~---~~~~~~~p~evLa~af~v~~~~~~~i~~~e~--~i~~~~~p~ 201 (372)
T d1j58a_ 131 LPHSIQAL-EEGAEFLLVFDDG---SFSENSTFQL---TDWLAHTPKEVIAANFGVTKEEISNLPGKEK--YIFENQLPG 201 (372)
T ss_dssp CCEEEEEE-EEEEEEEEEESCT---TCCGGGEEEH---HHHHHTSCHHHHHHHHTCCTGGGTTSCSSCC--SEECCCCCC
T ss_pred CEEEEEeC-CCCcEEEEEECCC---Ccccccceee---ccccccCCHHHHHHhhCCCHHHHhhcccccc--ccccccCCC
Confidence 99999996 4568999988754 3444444443 5899999999999999999999999998775 455432111
Q ss_pred c-----CCCCCcccCCCceeeccCCCCCcccCCCcEEEEeCCCCCCCccccCceeEEEEecCCCeecccccccCCeeEEE
Q 018395 176 K-----LPEPKKEHRDGMAFNCEEAPLDVDIKNGGRVVLLNTKNLPLVGEVGCGADLVRLDGKAMCSPGFSCDSALQVTY 250 (356)
Q Consensus 176 ~-----~~~p~~~~~~~~~~~l~~~~~~~~~~~gG~~~~~~~~~~p~l~~l~~s~~~v~l~~g~~~~PH~h~~~A~ei~~ 250 (356)
. ...|.......+.|++.+++| + ++.||+++++++++||++++ |+++.++|.||+|++|||||+ |+||.|
T Consensus 202 ~~~~~~~~~~~g~~~~~~~~~l~~q~P-~-~~~gG~~~~~d~~~fp~~~~--is~~~~~l~PG~~~~~H~Hp~-a~E~~y 276 (372)
T d1j58a_ 202 SLKDDIVEGPNGEVPYPFTYRLLEQEP-I-ESEGGKVYIADSTNFKVSKT--IASALVTVEPGAMRELHWHPN-THEWQY 276 (372)
T ss_dssp CHHHHCCCCTTCCCSSCSEEEGGGSCC-E-ECSSEEEEEESTTTSTTCCS--CEEEEEEECTTCEEEEEECSS-SCEEEE
T ss_pred cchhhhccCCCCCCCCcceeeccccCC-c-ccCCccEEEeccccCCccCc--eeEEEEEECCCcccCCCCCCC-CcEEEE
Confidence 1 112223334567999999988 4 68899999999999999995 789999999999999999999 999999
Q ss_pred EEeceEEEEEEccCCceEEEEEecCCcEEEEcCCcEEEE-eeCCCCeEEEEEEcCCCCceeccccccccccCCCHHHHHH
Q 018395 251 IVRGSGRAQIVGPDGKRVLETTVKAGNLFIVPRFYVVSK-IADPDGLAWFSIITTPNPIFTHLAGSIGTWKSLSPSVLEA 329 (356)
Q Consensus 251 v~~G~~~~~iv~~~g~~~~~~~l~~Gdv~vvP~g~~h~~-~~~~~~~~~~~~~~~~~p~~~~laG~~s~l~~~p~~vl~~ 329 (356)
|++|+++++|++++|+ ..+.++++|||++||+|++|++ |.|+++++|+.++++++++...+ ++||+.+|.+|+++
T Consensus 277 vl~G~g~v~v~~~~g~-~~t~~l~~GDv~~iP~g~~H~i~N~g~e~l~~l~vf~s~~~~~i~~---~~~l~~~P~~vv~~ 352 (372)
T d1j58a_ 277 YISGKARMTVFASDGH-ARTFNYQAGDVGYVPFAMGHYVENIGDEPLVFLEIFKDDHYADVSL---NQWLAMLPETFVQA 352 (372)
T ss_dssp EEESEEEEEEEEETTE-EEEEEEESSCEEEECTTCBEEEEECSSSCEEEEEEESSSSCCCEEH---HHHHHTSCHHHHHH
T ss_pred EEECeEEEEEEcCCCc-eEEEEecCCcEEEECCCCeEEEEECCCCCEEEEEEECCCCcceeeH---HHHhhhCCHHHHHH
Confidence 9999999999999875 4567999999999999999999 55899999999999988876655 58999999999999
Q ss_pred HcCCCHHHHHHHHhcCC
Q 018395 330 AFNVPSDVEKQFRSKRA 346 (356)
Q Consensus 330 af~~~~~~~~~l~~~~~ 346 (356)
+|+++.+++++|++.++
T Consensus 353 ~~~~~~e~~~~l~~~k~ 369 (372)
T d1j58a_ 353 HLDLGKDFTDVLSKEKH 369 (372)
T ss_dssp HHTCCHHHHTTCCSSCC
T ss_pred HhCcCHHHHHHHHhcCC
Confidence 99999999999987653
|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1xe7a_ b.82.1.16 (A:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|