Citrus Sinensis ID: 018410
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 356 | 2.2.26 [Sep-21-2011] | |||||||
| Q5M729 | 539 | Dihydrolipoyllysine-resid | yes | no | 0.971 | 0.641 | 0.648 | 1e-119 | |
| Q8RWN9 | 539 | Dihydrolipoyllysine-resid | no | no | 0.966 | 0.638 | 0.634 | 1e-116 | |
| P12695 | 482 | Dihydrolipoyllysine-resid | yes | no | 0.674 | 0.497 | 0.410 | 6e-47 | |
| O59816 | 483 | Dihydrolipoyllysine-resid | yes | no | 0.665 | 0.490 | 0.434 | 7e-47 | |
| Q1RJT3 | 418 | Dihydrolipoyllysine-resid | yes | no | 0.603 | 0.514 | 0.445 | 3e-46 | |
| Q8BMF4 | 642 | Dihydrolipoyllysine-resid | yes | no | 0.665 | 0.369 | 0.419 | 6e-45 | |
| P08461 | 632 | Dihydrolipoyllysine-resid | yes | no | 0.665 | 0.375 | 0.412 | 1e-44 | |
| P10515 | 647 | Dihydrolipoyllysine-resid | yes | no | 0.646 | 0.355 | 0.397 | 1e-44 | |
| Q92HK7 | 412 | Dihydrolipoyllysine-resid | yes | no | 0.603 | 0.521 | 0.435 | 9e-44 | |
| Q4ULG1 | 412 | Dihydrolipoyllysine-resid | yes | no | 0.615 | 0.531 | 0.430 | 1e-43 |
| >sp|Q5M729|OPD23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At1g54220 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 430 bits (1105), Expect = e-119, Method: Compositional matrix adjust.
Identities = 232/358 (64%), Positives = 267/358 (74%), Gaps = 12/358 (3%)
Query: 1 MAYASHIINHSKKLKNVSNLLWHENAVLVRWFSND--AVSSRDDLLKIHRHVYVPVESER 58
MAYAS IINHSKKLK+VS LL ENA +R++SN A +R+D R Y P+E
Sbjct: 1 MAYASRIINHSKKLKDVSTLLRRENAATIRYYSNTNRAPLNREDTFN-SRLGYPPLER-- 57
Query: 59 VINSSAISSVSSVGVFKKKFCSVARKAGSPIAGSFLNRGFACSKVHLKRGFSSDSGLPPH 118
I+ + S++ +F +++ G PI G + F+C + RGFSS S LPPH
Sbjct: 58 -ISICSTSTLPVSIIFSTTRSNLSSAMGRPIFG----KEFSC-LMQSARGFSSGSDLPPH 111
Query: 119 QEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKG 178
QEIGMPSLSPTM EGNIARWLKKEGDKV+PGEVLCEVETDKATVEMECMEEGYLAKIVK
Sbjct: 112 QEIGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGYLAKIVKA 171
Query: 179 DGSKEIKVGEVIAITVEEEEDIPKFKDYSPSVSDAGAAPAKEPSPPPPPKQEEVEKPIST 238
+GSKEI+VGEVIAITVE+EEDI KFKDY+PS S A AAP K P PPK+E+V++P S
Sbjct: 172 EGSKEIQVGEVIAITVEDEEDIGKFKDYTPS-STADAAPTKAEPTPAPPKEEKVKQPSSP 230
Query: 239 SEPKASKPSAASPEDRLFASPVARNLAEEHNVSLSSIKGTGPNGLIVKADIEDYLASRGK 298
EPKASKPS DR+FASP+AR LAE++NV LS I+GTGP G IVKADI++YLAS GK
Sbjct: 231 PEPKASKPSTPPTGDRVFASPLARKLAEDNNVPLSDIEGTGPEGRIVKADIDEYLASSGK 290
Query: 299 EVPAKAPKGKDVAAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMG 356
AK K D APALDYVDIPHSQIRK+TASRL FSKQTIPHYYLTVD CVD LM
Sbjct: 291 GATAKPSKSTDSKAPALDYVDIPHSQIRKVTASRLAFSKQTIPHYYLTVDTCVDKLMA 348
|
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 2 |
| >sp|Q8RWN9|OPD22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P12695|ODP2_YEAST Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAT1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O59816|ODP2_SCHPO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lat1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q1RJT3|ODP2_RICBR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8BMF4|ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P08461|ODP2_RAT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q92HK7|ODP2_RICCN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=pdhC PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q4ULG1|ODP2_RICFE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=pdhC PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 356 | ||||||
| 255560715 | 543 | dihydrolipoamide acetyltransferase compo | 0.977 | 0.640 | 0.692 | 1e-136 | |
| 118487464 | 539 | unknown [Populus trichocarpa] | 0.963 | 0.636 | 0.695 | 1e-135 | |
| 225442225 | 555 | PREDICTED: dihydrolipoyllysine-residue a | 0.980 | 0.628 | 0.674 | 1e-129 | |
| 224070718 | 512 | predicted protein [Populus trichocarpa] | 0.887 | 0.617 | 0.670 | 1e-126 | |
| 22531144 | 539 | dihydrolipoamide S-acetyltransferase, pu | 0.971 | 0.641 | 0.648 | 1e-118 | |
| 18404837 | 539 | dihydrolipoyllysine-residue acetyltransf | 0.971 | 0.641 | 0.648 | 1e-118 | |
| 14161722 | 539 | mono-lipoyl E2 [Arabidopsis thaliana] | 0.971 | 0.641 | 0.645 | 1e-117 | |
| 18400212 | 539 | dihydrolipoyllysine-residue acetyltransf | 0.966 | 0.638 | 0.634 | 1e-115 | |
| 20260138 | 539 | dihydrolipoamide acetyltransferase [Arab | 0.966 | 0.638 | 0.634 | 1e-114 | |
| 356560819 | 547 | PREDICTED: dihydrolipoyllysine-residue a | 0.974 | 0.634 | 0.640 | 1e-114 |
| >gi|255560715|ref|XP_002521371.1| dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] gi|223539449|gb|EEF41039.1| dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 489 bits (1260), Expect = e-136, Method: Compositional matrix adjust.
Identities = 248/358 (69%), Positives = 287/358 (80%), Gaps = 10/358 (2%)
Query: 1 MAYASHIINHSKKLKNVSNLLWHENAVLVRWFSND---AVSSRDDLLKIHRHVYVPVESE 57
MAYASHIINHSKKL+NVSNLL E+A LVRWFSND +V +DD K+H +VP E E
Sbjct: 1 MAYASHIINHSKKLRNVSNLLRQEHAGLVRWFSNDTRLSVGKKDDTAKVHHQGFVPAERE 60
Query: 58 RVINSSAISSVSSVGVFKKKFCSVARKAGSPIAGSFLNRGFACSKVHLKRGFSSDSGLPP 117
R+ N+ +++SS G F+K ++ +P+ GS L + F+ S+V +RGFSSDSGLPP
Sbjct: 61 RLFNTGVNNNISSFGAFRKNVPRTIKQVRNPMDGSLLLKDFSSSQVQSRRGFSSDSGLPP 120
Query: 118 HQEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVK 177
HQEIGMPSLSPTM EGNIARWLKKEGDK+SPGEVLCEVETDKATVEMECMEEG+LAKI+K
Sbjct: 121 HQEIGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGFLAKIIK 180
Query: 178 GDGSKEIKVGEVIAITVEEEEDIPKFKDYSPSVSDAGAAPAKEPSPPPPPKQEEVEKPIS 237
GDGSKEIKVGEVIAITVE+EEDI KFKDYSPSVSD AA + P K+E E+ +S
Sbjct: 181 GDGSKEIKVGEVIAITVEDEEDIGKFKDYSPSVSDGAAAASPPPP----SKKEVAEETVS 236
Query: 238 TSEPKASKPSAASPEDRLFASPVARNLAEEHNVSLSSIKGTGPNGLIVKADIEDYLASRG 297
+ EPK SKPSAAS DR+FASP+A+ LAE+HNV+LSSIKGTGP+G IVKADIEDYLASRG
Sbjct: 237 SPEPKTSKPSAASSGDRIFASPLAKKLAEDHNVTLSSIKGTGPDGHIVKADIEDYLASRG 296
Query: 298 KEVPAKAPKGKDVAAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLM 355
KEV A PK A ++DYVDIPH+QIRK+TASRLL SKQTIPHYYLTVD VD LM
Sbjct: 297 KEVSATTPKA---TAASIDYVDIPHTQIRKVTASRLLLSKQTIPHYYLTVDTRVDKLM 351
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118487464|gb|ABK95559.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225442225|ref|XP_002277871.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial [Vitis vinifera] gi|297743048|emb|CBI35915.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224070718|ref|XP_002303212.1| predicted protein [Populus trichocarpa] gi|222840644|gb|EEE78191.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|22531144|gb|AAM97076.1| dihydrolipoamide S-acetyltransferase, putative [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18404837|ref|NP_564654.1| dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Arabidopsis thaliana] gi|79319911|ref|NP_001031186.1| dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Arabidopsis thaliana] gi|75285553|sp|Q5M729.1|OPD23_ARATH RecName: Full=Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial; AltName: Full=Dihydrolipoamide S-acetyltransferase component 3 of pyruvate dehydrogenase complex; AltName: Full=Pyruvate dehydrogenase complex component E2 3; Short=PDC-E2 3; Short=PDCE2 3; Flags: Precursor gi|56550713|gb|AAV97810.1| At1g54220 [Arabidopsis thaliana] gi|332194946|gb|AEE33067.1| dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Arabidopsis thaliana] gi|332194947|gb|AEE33068.1| dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|14161722|gb|AAK53067.1| mono-lipoyl E2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18400212|ref|NP_566470.1| dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex [Arabidopsis thaliana] gi|118573090|sp|Q8RWN9.2|OPD22_ARATH RecName: Full=Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial; AltName: Full=Dihydrolipoamide S-acetyltransferase component 2 of pyruvate dehydrogenase complex; AltName: Full=Pyruvate dehydrogenase complex component E2 2; Short=PDC-E2 2; Short=PDCE2 2; Flags: Precursor gi|13605807|gb|AAK32889.1|AF367302_1 AT3g13930/MDC16_5 [Arabidopsis thaliana] gi|20147147|gb|AAM10290.1| AT3g13930/MDC16_5 [Arabidopsis thaliana] gi|23306388|gb|AAN17421.1| putative acetyltransferase [Arabidopsis thaliana] gi|23397124|gb|AAN31846.1| putative acetyltransferase [Arabidopsis thaliana] gi|24899791|gb|AAN65110.1| putative acetyltransferase [Arabidopsis thaliana] gi|332641921|gb|AEE75442.1| dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|20260138|gb|AAM12967.1| dihydrolipoamide acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356560819|ref|XP_003548684.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 356 | ||||||
| TAIR|locus:2020173 | 539 | AT1G54220 [Arabidopsis thalian | 0.573 | 0.378 | 0.611 | 4.7e-97 | |
| TAIR|locus:2088247 | 539 | AT3G13930 [Arabidopsis thalian | 0.966 | 0.638 | 0.584 | 1.6e-95 | |
| UNIPROTKB|F1SMB2 | 647 | DLAT "Dihydrolipoyllysine-resi | 0.278 | 0.153 | 0.585 | 1.5e-49 | |
| MGI|MGI:2385311 | 642 | Dlat "dihydrolipoamide S-acety | 0.278 | 0.154 | 0.555 | 6.7e-49 | |
| UNIPROTKB|H0YDD4 | 479 | DLAT "Dihydrolipoyllysine-resi | 0.275 | 0.204 | 0.565 | 8.4e-49 | |
| RGD|619859 | 632 | Dlat "dihydrolipoamide S-acety | 0.261 | 0.147 | 0.580 | 1.3e-48 | |
| UNIPROTKB|E2RQS9 | 647 | DLAT "Uncharacterized protein" | 0.278 | 0.153 | 0.575 | 1.8e-48 | |
| UNIPROTKB|F1N690 | 647 | DLAT "Dihydrolipoyllysine-resi | 0.278 | 0.153 | 0.555 | 6.3e-48 | |
| UNIPROTKB|E9PEJ4 | 542 | DLAT "Dihydrolipoyllysine-resi | 0.278 | 0.182 | 0.555 | 1.1e-47 | |
| UNIPROTKB|P10515 | 647 | DLAT "Dihydrolipoyllysine-resi | 0.278 | 0.153 | 0.555 | 3.5e-47 |
| TAIR|locus:2020173 AT1G54220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 592 (213.5 bits), Expect = 4.7e-97, Sum P(2) = 4.7e-97
Identities = 132/216 (61%), Positives = 149/216 (68%)
Query: 1 MAYASHIINHSKKLKNVSNLLWHENAVLVRWFSND--AVSSRDDLLKIHRHVYVPVESER 58
MAYAS IINHSKKLK+VS LL ENA +R++SN A +R+D R Y P+E
Sbjct: 1 MAYASRIINHSKKLKDVSTLLRRENAATIRYYSNTNRAPLNREDTFN-SRLGYPPLER-- 57
Query: 59 XXXXXXXXXXXXXXXXXXXXXXXARKAGSPIAGSFLNRGFACSKVHLKRGFSSDSGLPPH 118
+ G PI G + F+C + RGFSS S LPPH
Sbjct: 58 -ISICSTSTLPVSIIFSTTRSNLSSAMGRPIFG----KEFSCL-MQSARGFSSGSDLPPH 111
Query: 119 QEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKG 178
QEIGMPSLSPTM EGNIARWLKKEGDKV+PGEVLCEVETDKATVEMECMEEGYLAKIVK
Sbjct: 112 QEIGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGYLAKIVKA 171
Query: 179 DGSKEIKVGEVIAITVEEEEDIPKFKDYSPS-VSDA 213
+GSKEI+VGEVIAITVE+EEDI KFKDY+PS +DA
Sbjct: 172 EGSKEIQVGEVIAITVEDEEDIGKFKDYTPSSTADA 207
|
|
| TAIR|locus:2088247 AT3G13930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SMB2 DLAT "Dihydrolipoyllysine-residue acetyltransferase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2385311 Dlat "dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YDD4 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|619859 Dlat "dihydrolipoamide S-acetyltransferase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RQS9 DLAT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N690 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PEJ4 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P10515 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q5M729 | OPD23_ARATH | 2, ., 3, ., 1, ., 1, 2 | 0.6480 | 0.9719 | 0.6419 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.3.1 | 0.921 |
| 3rd Layer | 2.3.1.12 | 0.914 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | fgenesh4_pg.C_LG_III000191 | SubName- Full=Putative uncharacterized protein; (512 aa) | |||||||||
(Populus trichocarpa) | |||||||||||
 | LPD1 | • | • | • | • | • | • | 0.987 | |||
 | LPD3 | • | • | • | • | • | 0.977 | ||||
 | LPD4 | • | • | • | • | • | 0.977 | ||||
 | gw1.III.1461.1 | • | • | • | • | • | 0.971 | ||||
 | estExt_fgenesh4_pm.C_LG_I0194 | • | • | • | • | • | 0.970 | ||||
 | gw1.X.5451.1 | • | • | • | • | 0.963 | |||||
 | grail3.0009040502 | • | • | • | • | 0.963 | |||||
 | fgenesh4_pg.C_LG_II001653 | • | • | • | • | 0.962 | |||||
 | grail3.0080008401 | • | • | • | • | 0.955 | |||||
 | estExt_Genewise1_v1.C_LG_IV4361 | • | • | • | • | 0.955 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 356 | |||
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 0.0 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 3e-84 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 1e-69 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 5e-59 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 1e-37 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 2e-37 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 4e-33 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 2e-28 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 3e-28 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 2e-26 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 5e-25 | |
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 8e-19 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 2e-18 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 3e-17 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 9e-17 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 1e-14 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 8e-14 | |
| pfam02817 | 39 | pfam02817, E3_binding, e3 binding domain | 3e-13 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 5e-13 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 3e-12 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 1e-11 | |
| PRK14843 | 347 | PRK14843, PRK14843, dihydrolipoamide acetyltransfe | 2e-10 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 6e-10 | |
| PRK11857 | 306 | PRK11857, PRK11857, dihydrolipoamide acetyltransfe | 1e-06 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 6e-06 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 5e-04 | |
| PRK14843 | 347 | PRK14843, PRK14843, dihydrolipoamide acetyltransfe | 5e-04 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 0.003 |
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
Score = 541 bits (1395), Expect = 0.0
Identities = 248/359 (69%), Positives = 274/359 (76%), Gaps = 15/359 (4%)
Query: 2 AYASHIINHSKKLKNVSNLLWHENAVLVRWFSNDAVSS---RDDLLKIHRHVYVPVESER 58
AYAS IINHSKKL+NVSNLL E+A LVR+FSN SS DD+ K + + S+
Sbjct: 1 AYASRIINHSKKLRNVSNLLRREHAALVRYFSNSTRSSLGKGDDIAKRRGYPPLERRSQP 60
Query: 59 VINSSAISSVSSVGVFKKKFCSVARKAGSPIAGSFLNRGFACSKVHLKRGFSSDSGLPPH 118
VSS+G+F ARK GSP+ GS L + + S++ RGFSS S LPPH
Sbjct: 61 --------KVSSLGLFGSNISRTARKNGSPMTGSGLFKSLSSSQMQSARGFSSSSDLPPH 112
Query: 119 QEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKG 178
QEIGMPSLSPTM EGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKG
Sbjct: 113 QEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKG 172
Query: 179 DGSKEIKVGEVIAITVEEEEDIPKFKDYSPSVSDAGAAPAKEPSPPPPPKQEEVEKPIST 238
DG+KEIKVGEVIAITVEEEEDI KFKDY PS S A AAP +PSPPPP + EEVEKP S+
Sbjct: 173 DGAKEIKVGEVIAITVEEEEDIGKFKDYKPSSSAAPAAPKAKPSPPPPKE-EEVEKPASS 231
Query: 239 SEPKASKPSAAS-PEDRLFASPVARNLAEEHNVSLSSIKGTGPNGLIVKADIEDYLASRG 297
EPKASKPSA DR+FASP+AR LAE++NV LSSIKGTGP+G IVKADIEDYLAS G
Sbjct: 232 PEPKASKPSAPPSSGDRIFASPLARKLAEDNNVPLSSIKGTGPDGRIVKADIEDYLASGG 291
Query: 298 KEVPAKAPKGKDVAAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMG 356
K A AP D APALDY DIP++QIRK+TASRLL SKQTIPHYYLTVD VD LM
Sbjct: 292 KG--ATAPPSTDSKAPALDYTDIPNTQIRKVTASRLLQSKQTIPHYYLTVDTRVDKLMA 348
|
Length = 539 |
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 356 | |||
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| KOG0557 | 470 | consensus Dihydrolipoamide acetyltransferase [Ener | 100.0 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 100.0 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 100.0 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 100.0 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 100.0 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 100.0 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 100.0 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 100.0 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 100.0 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 100.0 | |
| KOG0558 | 474 | consensus Dihydrolipoamide transacylase (alpha-ket | 99.97 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 99.97 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 99.97 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 99.95 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 99.81 | |
| PRK11857 | 306 | dihydrolipoamide acetyltransferase; Reviewed | 99.8 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.78 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.78 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.69 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.64 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.56 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.54 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.5 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 99.49 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.45 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.45 | |
| PF02817 | 39 | E3_binding: e3 binding domain; InterPro: IPR004167 | 99.42 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 99.37 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.35 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 99.33 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.31 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.3 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 99.29 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 99.25 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 99.25 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.24 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.19 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 99.15 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 99.07 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 99.01 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 98.99 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 98.95 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 98.83 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 98.72 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 98.6 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 98.43 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 98.36 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 98.11 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 98.04 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 97.97 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 97.85 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 97.83 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 97.81 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 97.79 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 97.77 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 97.76 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 97.73 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 97.7 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 97.61 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 97.57 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 97.5 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 97.45 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 97.42 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 97.37 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 97.25 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 97.21 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.18 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.16 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 97.13 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 97.12 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 97.05 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 96.99 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 96.86 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 96.82 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 96.63 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 96.57 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 96.31 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 95.9 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 95.88 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 95.85 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 95.76 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 95.69 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 95.66 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 95.54 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 95.19 | |
| PRK06748 | 83 | hypothetical protein; Validated | 94.88 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 94.83 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 94.82 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 94.62 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 94.57 | |
| PRK12270 | 1228 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 94.35 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 94.27 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 94.14 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 94.0 | |
| PRK07051 | 80 | hypothetical protein; Validated | 93.41 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 92.94 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 92.83 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 92.47 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 92.46 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 92.46 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 92.39 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 92.06 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 91.91 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 91.76 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 91.66 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 91.62 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 91.32 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 91.11 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 91.07 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 91.07 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 90.94 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 90.9 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 90.42 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 90.31 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 90.24 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 90.05 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 90.03 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 89.94 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 89.75 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 89.68 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 89.6 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 89.52 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 88.98 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 88.75 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 88.72 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 88.64 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 88.3 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 88.12 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 88.09 | |
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 87.66 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 86.78 | |
| PF02749 | 88 | QRPTase_N: Quinolinate phosphoribosyl transferase, | 86.77 | |
| KOG3373 | 172 | consensus Glycine cleavage system H protein (lipoa | 86.7 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 85.94 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 85.37 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 85.34 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 85.32 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 84.51 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 84.48 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 84.35 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 84.01 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 83.57 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 82.76 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 82.49 | |
| cd00210 | 124 | PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s | 82.22 | |
| PF00358 | 132 | PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph | 82.15 | |
| PRK05305 | 206 | phosphatidylserine decarboxylase; Provisional | 81.93 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 81.52 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 80.92 | |
| TIGR00164 | 189 | PS_decarb_rel phosphatidylserine decarboxylase pre | 80.81 |
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-68 Score=551.20 Aligned_cols=344 Identities=71% Similarity=1.028 Sum_probs=259.6
Q ss_pred chhhhHhhhhhhhhhhhhhhcccccceEEeecCCCcC---CcccceeeecceeccccceeecccCCccceeeeccccccc
Q 018410 2 AYASHIINHSKKLKNVSNLLWHENAVLVRWFSNDAVS---SRDDLLKIHRHVYVPVESERVINSSAISSVSSVGVFKKKF 78 (356)
Q Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 78 (356)
+||+||||||||||+++|+|+|||+.|||||||++|+ |++++.+.+++. ...+..++ ..+++|.|++++
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~------~~~~~~~~~~~~ 72 (539)
T PLN02744 1 AYASRIINHSKKLRNVSNLLRREHAALVRYFSNSTRSSLGKGDDIAKRRGYP--PLERRSQP------KVSSLGLFGSNI 72 (539)
T ss_pred CchHHHhhhchhhcchHHHhcccccceEEEecCCCccCcccccchhhcccCC--cccccccc------ccccccccccch
Confidence 5899999999999999999999999999999999999 999999977664 23333333 456789999999
Q ss_pred ceeeccCCCcccccccccccccccccceeccccCCCCCCceEEecCCCCCCCceEEEEEEEccCCCEEecCCeEEEEecc
Q 018410 79 CSVARKAGSPIAGSFLNRGFACSKVHLKRGFSSDSGLPPHQEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETD 158 (356)
Q Consensus 79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~i~~P~lg~s~~eg~I~~W~v~~Gd~V~~Gd~L~eVETd 158 (356)
||++.+.++|++...+++.|+|+++.++|+|++..+||+|++|.||+||++|+||+|++|+|++||.|++||+||+||||
T Consensus 73 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ei~mP~lg~~m~eg~I~~W~vkeGD~V~~g~~l~eVETD 152 (539)
T PLN02744 73 SRTARKNGSPMTGSGLFKSLSSSQMQSARGFSSSSDLPPHQEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETD 152 (539)
T ss_pred hhhhhhcCCccccchhhhccccccccccccccccccCCCCceEeCCCCCCCcceeEEEEEEecCCCEecCCCeeEEEeec
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceeEEEecCCCeEEEEEeecCCCeeeeCCCEEEEEeccCCccccccCCCCCCCCCCCCCCCCCCCCCCCCCcccCCCCCC
Q 018410 159 KATVEMECMEEGYLAKIVKGDGSKEIKVGEVIAITVEEEEDIPKFKDYSPSVSDAGAAPAKEPSPPPPPKQEEVEKPIST 238 (356)
Q Consensus 159 Ka~~ei~Ap~~G~I~ki~v~eG~~~V~vG~~la~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 238 (356)
|+++||+||.+|+|.+|++++|++.|++|++|+++.+++++...+.++.+.....++.++. .+.++.+.......+...
T Consensus 153 Ka~~evea~~~G~l~ki~~~eG~~~v~vG~~ia~i~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~ 231 (539)
T PLN02744 153 KATVEMECMEEGYLAKIVKGDGAKEIKVGEVIAITVEEEEDIGKFKDYKPSSSAAPAAPKA-KPSPPPPKEEEVEKPASS 231 (539)
T ss_pred cceeEecCCCCcEEEEEEecCCCcccCCCCEEEEEccCccccccccccccccccccccccc-cCCCCCcccccccCCCCC
Confidence 9999999999999999999999536999999998865444322221111100000000000 000000000000000000
Q ss_pred CCCCCCCC-CCCCCCCCccCChHHHHHHHHcCCCcccccccCCCCcccHhhHHHHHHhcCCCCCCCCCCCCCCCCCCCCc
Q 018410 239 SEPKASKP-SAASPEDRLFASPVARNLAEEHNVSLSSIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVAAPALDY 317 (356)
Q Consensus 239 ~~~~~~~~-~~~~~~~~v~ASP~ARkLA~e~gIDLs~V~GSGp~GRItk~DV~~~~~~~~~~~~a~~~~~~~~~~~~~~~ 317 (356)
+.+....+ .....+.++++||+||+||+|+||||+.|+|||++|||+++||++|+.......+.+.+ .....+...+
T Consensus 232 ~~~~~~~~~~~~~~~~~i~ASP~aRrLAre~GVDLs~V~GTGp~GRI~k~DV~a~~~~~~~~~~~~~~--~~~~~~~~~~ 309 (539)
T PLN02744 232 PEPKASKPSAPPSSGDRIFASPLARKLAEDNNVPLSSIKGTGPDGRIVKADIEDYLASGGKGATAPPS--TDSKAPALDY 309 (539)
T ss_pred cccccccccccccccccccCCchhHHHHHHcCCCHHHCCCCCCCCcccHHHHHHHhhccccccCCCCC--cccCCCCCcc
Confidence 00000000 01112236789999999999999999999999999999999999998532111111000 0001111124
Q ss_pred ccccCchHHHHHHHHHHhhccCCceEEEEeEEEeccCCC
Q 018410 318 VDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMG 356 (356)
Q Consensus 318 ~~vpmS~mRK~IA~rL~~S~~tiPH~tl~~evdvt~L~~ 356 (356)
+++||++|||+||+||++||++|||||++.|+|||+|++
T Consensus 310 ~~vpls~~Rk~IA~~m~~S~~~iPh~t~~~evdvt~L~~ 348 (539)
T PLN02744 310 TDIPNTQIRKVTASRLLQSKQTIPHYYLTVDTRVDKLMA 348 (539)
T ss_pred ccccchhHHHHHHHHHHHHHhhCCeEEEEEEEEcHHHHH
Confidence 678999999999999999999999999999999999873
|
|
| >KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11857 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PF02749 QRPTase_N: Quinolinate phosphoribosyl transferase, N-terminal domain; InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit | Back alignment and domain information |
|---|
| >PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria | Back alignment and domain information |
|---|
| >PRK05305 phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 356 | ||||
| 1zy8_L | 229 | The Crystal Structure Of Dihydrolipoamide Dehydroge | 1e-24 | ||
| 2dne_A | 108 | Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain | 1e-23 | ||
| 1fyc_A | 106 | Inner Lipoyl Domain From Human Pyruvate Dehydrogena | 2e-23 | ||
| 1y8n_B | 128 | Crystal Structure Of The Pdk3-L2 Complex Length = 1 | 2e-23 | ||
| 2dnc_A | 98 | Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain | 1e-21 | ||
| 3crk_C | 87 | Crystal Structure Of The Pdhk2-L2 Complex. Length = | 1e-19 | ||
| 3duf_I | 428 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 2e-09 | ||
| 3b8k_A | 239 | Structure Of The Truncated Human Dihydrolipoyl Acet | 5e-07 | ||
| 1lab_A | 80 | Three-Dimensional Structure Of The Lipoyl Domain Fr | 2e-06 | ||
| 1pmr_A | 80 | Lipoyl Domain From The Dihydrolipoyl Succinyltransf | 2e-05 | ||
| 1ghj_A | 79 | Solution Structure Of The Lipoyl Domain Of The 2- O | 5e-05 | ||
| 2l5t_A | 77 | Solution Nmr Structure Of E2 Lipoyl Domain From The | 9e-05 | ||
| 3rnm_E | 58 | The Crystal Structure Of The Subunit Binding Of Hum | 3e-04 | ||
| 1w4i_A | 62 | Peripheral-Subunit Binding Domains From Mesophilic, | 6e-04 | ||
| 2coo_A | 70 | Solution Structure Of The E3_binding Domain Of Dihy | 7e-04 |
| >pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 | Back alignment and structure |
| >pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 | Back alignment and structure |
| >pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 | Back alignment and structure |
| >pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 | Back alignment and structure |
| >pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 | Back alignment and structure |
| >pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 | Back alignment and structure |
| >pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 | Back alignment and structure |
| >pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 | Back alignment and structure |
| >pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 | Back alignment and structure |
| >pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 | Back alignment and structure |
| >pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 | Back alignment and structure |
| >pdb|3RNM|E Chain E, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 58 | Back alignment and structure |
| >pdb|1W4I|A Chain A, Peripheral-Subunit Binding Domains From Mesophilic, Thermophilic, And Hyperthermophilic Bacteria Fold By Ultrafast, Apparently Two-State Transitions Length = 62 | Back alignment and structure |
| >pdb|2COO|A Chain A, Solution Structure Of The E3_binding Domain Of Dihydrolipoamide Branched Chaintransacylase Length = 70 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Length = 41 | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Length = 64 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 356 | |||
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.97 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.85 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.82 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.8 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.79 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.76 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.72 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.67 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.66 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.66 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.63 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.59 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.44 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.39 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.38 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.36 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.31 | |
| 2eq9_C | 41 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 99.31 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 99.3 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.27 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.25 | |
| 2eq8_C | 40 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 99.25 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 99.24 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 99.23 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 99.21 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.19 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 99.16 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 99.16 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.14 | |
| 2f60_K | 64 | Pyruvate dehydrogenase protein X component; protei | 99.1 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 99.09 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 99.08 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 99.07 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 99.06 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 98.82 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 98.78 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 98.74 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 98.72 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 98.36 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 98.34 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 98.29 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 98.17 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 97.9 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 97.9 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 97.88 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 97.83 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 97.78 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 97.66 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 97.62 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 97.55 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 97.38 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 97.0 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 96.81 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 96.59 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 96.41 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 96.4 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 95.32 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 95.19 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 95.16 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 95.05 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 95.0 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 94.44 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 94.0 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 93.81 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 93.21 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 93.05 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 92.54 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 92.43 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 92.37 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 92.35 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 92.23 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 92.06 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 91.71 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 90.39 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 90.37 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 90.29 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 89.51 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 89.38 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 89.26 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 89.24 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 88.98 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 88.96 | |
| 2auk_A | 190 | DNA-directed RNA polymerase beta' chain; sandwich- | 88.75 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 88.41 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 86.31 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 86.18 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 86.03 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 84.76 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 83.61 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 83.42 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 82.41 | |
| 3our_B | 183 | EIIA, phosphotransferase system IIA component; exh | 81.8 |
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=8.7e-45 Score=365.99 Aligned_cols=228 Identities=29% Similarity=0.446 Sum_probs=39.7
Q ss_pred eEEecCCCCCCCceEEEEEEEccCCCEEecCCeEEEEeccceeEEEecCCCeEEEEEeecCCCeeeeCCCEEEEEeccCC
Q 018410 119 QEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKGDGSKEIKVGEVIAITVEEEE 198 (356)
Q Consensus 119 ~~i~~P~lg~s~~eg~I~~W~v~~Gd~V~~Gd~L~eVETdKa~~ei~Ap~~G~I~ki~v~eG~~~V~vG~~la~i~~~~~ 198 (356)
++|+||+||++|+||+|++|+|++||.|++||+||+|||||++++|+||++|+|.+|++++|+ .|.+|++|++|.++++
T Consensus 3 ~~i~mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vEt~K~~~~i~ap~~G~v~~i~v~~G~-~V~~G~~l~~i~~~~~ 81 (428)
T 3dva_I 3 FEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGT-VATVGQTLITLDAPGY 81 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred eeEEcCCCCCCCccEEEEEEEcCCCCEECCCCEEEEEEeCCeeEEEecCCCeEEEEEEeCCCC-EeCCCCEEEEEecCCc
Confidence 589999999999999999999999999999999999999999999999999999999999997 8999999999855443
Q ss_pred ccccccCCCCCCCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCCCCCCCCCCCCCCccCChHHHHHHHHcCCCccccccc
Q 018410 199 DIPKFKDYSPSVSDAGAAPAKEPSPPPPPKQEEVEKPISTSEPKASKPSAASPEDRLFASPVARNLAEEHNVSLSSIKGT 278 (356)
Q Consensus 199 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~ASP~ARkLA~e~gIDLs~V~GS 278 (356)
+...... . ..+..+.. +.+.. .+.....+...+.... .......+.++++||+|||||+|+||||++|+||
T Consensus 82 ~~~~~~~---~--~~~~~~~~--~~~~~-~~~~~~~~~~~~~~~~-~~~~~~~~~~~~asP~~R~lA~e~gvdl~~v~gt 152 (428)
T 3dva_I 82 ENMTFKG---Q--EQEEAKKE--EKTET-VSKEEKVDAVAPNAPA-AEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGT 152 (428)
T ss_dssp -------------------------------------------------------CCCCCHHHHHHHHHTTCCGGGSCCC
T ss_pred ccccccc---c--cccccccC--CCccc-CCccccccCCCccccc-cccccccccccccCHHHHHHHHHcCCCHHHCCCC
Confidence 3211100 0 00000000 00000 0000000000000000 0011112246789999999999999999999999
Q ss_pred CCCCcccHhhHHHHHHhcCCCCCCCC--CCC--CC-C--CCCCCCcccccCchHHHHHHHHHHhhccCCceEEEEeEEEe
Q 018410 279 GPNGLIVKADIEDYLASRGKEVPAKA--PKG--KD-V--AAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICV 351 (356)
Q Consensus 279 Gp~GRItk~DV~~~~~~~~~~~~a~~--~~~--~~-~--~~~~~~~~~vpmS~mRK~IA~rL~~S~~tiPH~tl~~evdv 351 (356)
||+|||+++||++|+.......+... +.. +. + ......++++||++|||+||+||++||++|||||++.+|||
T Consensus 153 G~~GrI~k~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~s~~Rk~ia~~m~~S~~~~P~~~~~~evDv 232 (428)
T 3dva_I 153 GKNGRVLKEDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADV 232 (428)
T ss_dssp STTSCCCTTTTTTTSCC---------------------------------------------------------------
T ss_pred CCCCceeHHHHHHHhhccccccccccccccccCCCCccccccCCccccccCcHHHHHHHHHHHHhcccCCeEEEEEEEeH
Confidence 99999999999999743211110000 000 00 0 00112367899999999999999999999999999999999
Q ss_pred ccCCC
Q 018410 352 DNLMG 356 (356)
Q Consensus 352 t~L~~ 356 (356)
|+|++
T Consensus 233 t~l~~ 237 (428)
T 3dva_I 233 TKLVA 237 (428)
T ss_dssp -----
T ss_pred HHHHH
Confidence 99974
|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 356 | ||||
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 2e-31 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 5e-21 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 7e-21 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 1e-19 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 3e-18 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 3e-15 | |
| d1w85i_ | 42 | a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl | 4e-14 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 4e-13 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 5e-13 | |
| d2cyua1 | 39 | a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa | 3e-12 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 2e-09 | |
| d1scza_ | 233 | c.43.1.1 (A:) Dihydrolipoamide succinyltransferase | 1e-08 | |
| d1dpba_ | 243 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 3e-08 | |
| d1b5sa_ | 242 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 2e-07 |
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Lipoyl domain of dihydrolipoamide acetyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Score = 112 bits (282), Expect = 2e-31
Identities = 47/95 (49%), Positives = 68/95 (71%)
Query: 115 LPPHQEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAK 174
PPH ++ +P+LSPTM G + RW KK G+K+S G++L E+ETDKAT+ E EEGYLAK
Sbjct: 2 YPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAK 61
Query: 175 IVKGDGSKEIKVGEVIAITVEEEEDIPKFKDYSPS 209
I+ +G++++ +G + I VE+E DI F DY P+
Sbjct: 62 ILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPT 96
|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 | Back information, alignment and structure |
|---|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 356 | |||
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.93 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.88 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.87 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.85 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.85 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.81 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.8 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.78 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.6 | |
| d1w85i_ | 42 | E3/E1 binding domain of dihydrolipoyl acetyltransf | 99.57 | |
| d2cyua1 | 39 | E3-binding domain of dihydrolipoamide succinyltran | 99.48 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.4 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 97.18 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 97.12 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 96.26 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 95.77 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 95.31 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 95.14 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.08 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 94.86 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 93.8 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 93.3 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 93.29 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 92.84 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 89.97 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 88.36 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 87.77 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 86.04 | |
| d1qpoa2 | 115 | Quinolinic acid phosphoribosyltransferase (Nicotin | 85.73 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 84.11 | |
| d1qapa2 | 122 | Quinolinic acid phosphoribosyltransferase (Nicotin | 83.21 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 83.06 | |
| d1uoua3 | 105 | Thymidine phosphorylase {Human (Homo sapiens) [Tax | 83.05 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 82.94 | |
| d1uoua3 | 105 | Thymidine phosphorylase {Human (Homo sapiens) [Tax | 82.85 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 82.85 | |
| d1o4ua2 | 103 | Quinolinic acid phosphoribosyltransferase (Nicotin | 82.82 | |
| d2tpta3 | 105 | Thymidine phosphorylase {Escherichia coli [TaxId: | 80.75 |
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Lipoyl domain of dihydrolipoamide acetyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=5.5e-26 Score=185.55 Aligned_cols=86 Identities=50% Similarity=0.895 Sum_probs=80.7
Q ss_pred CCCceEEecCCCCCCCceEEEEEEEccCCCEEecCCeEEEEeccceeEEEecCCCeEEEEEeecCCCeeeeCCCEEEEEe
Q 018410 115 LPPHQEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKGDGSKEIKVGEVIAITV 194 (356)
Q Consensus 115 ~~~~~~i~~P~lg~s~~eg~I~~W~v~~Gd~V~~Gd~L~eVETdKa~~ei~Ap~~G~I~ki~v~eG~~~V~vG~~la~i~ 194 (356)
||.|++|.||+||++|+||+|++|+|++||.|++||+||+|||||++++|+||++|+|.++++++|++.|++|++||+|.
T Consensus 2 ~p~~iei~mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vETdK~~~ei~a~~~G~l~~i~v~eGd~~v~vG~~ia~i~ 81 (102)
T d1y8ob1 2 YPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIV 81 (102)
T ss_dssp CCSEEEEECCCSSTTCSEEEEEEECSCTTCEECTTCEEEEEECSSCEEEEECCSCEEEEEESSCTTCCSEETTCEEEEEE
T ss_pred CCCCEEEECCCCCCCccEEEEEEEEeCCCCEEecCccEEEEEcCcEEEEEecCCcEEEEEEEEccCCEEEcCCCEEEEEe
Confidence 68999999999999999999999999999999999999999999999999999999999999999963699999999996
Q ss_pred ccCCcc
Q 018410 195 EEEEDI 200 (356)
Q Consensus 195 ~~~~~~ 200 (356)
+.+++.
T Consensus 82 ~~~~~~ 87 (102)
T d1y8ob1 82 EKEADI 87 (102)
T ss_dssp SSGGGG
T ss_pred cCCccc
Confidence 655544
|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qpoa2 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qapa2 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o4ua2 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|