Citrus Sinensis ID: 018439
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 356 | ||||||
| 225441543 | 353 | PREDICTED: F-box protein At3g58530 [Viti | 0.991 | 1.0 | 0.802 | 1e-165 | |
| 224088164 | 341 | predicted protein [Populus trichocarpa] | 0.957 | 1.0 | 0.812 | 1e-165 | |
| 255580692 | 351 | ubiquitin-protein ligase, putative [Rici | 0.985 | 1.0 | 0.774 | 1e-164 | |
| 297739793 | 350 | unnamed protein product [Vitis vinifera] | 0.932 | 0.948 | 0.801 | 1e-155 | |
| 147789108 | 349 | hypothetical protein VITISV_044261 [Viti | 0.932 | 0.951 | 0.798 | 1e-149 | |
| 297817168 | 353 | hypothetical protein ARALYDRAFT_486305 [ | 0.991 | 1.0 | 0.731 | 1e-147 | |
| 356530677 | 353 | PREDICTED: F-box protein At3g58530-like | 0.980 | 0.988 | 0.705 | 1e-143 | |
| 18410977 | 353 | F-box protein [Arabidopsis thaliana] gi| | 0.941 | 0.949 | 0.728 | 1e-141 | |
| 15450960 | 353 | putative protein [Arabidopsis thaliana] | 0.941 | 0.949 | 0.728 | 1e-141 | |
| 388498858 | 357 | unknown [Lotus japonicus] | 0.966 | 0.963 | 0.682 | 1e-137 |
| >gi|225441543|ref|XP_002276459.1| PREDICTED: F-box protein At3g58530 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 588 bits (1515), Expect = e-165, Method: Compositional matrix adjust.
Identities = 284/354 (80%), Positives = 323/354 (91%), Gaps = 1/354 (0%)
Query: 3 MEEEKVKAAEEEETWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVI 62
MEE + +A + + WS+ET+PKV+RI+ TRL QRD+ISLLLVSPW+HRTLVS SLWLV+
Sbjct: 1 MEETEARAGGDLK-WSRETIPKVLRIVGTRLPQRDLISLLLVSPWIHRTLVSCSSLWLVL 59
Query: 63 DLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLN 122
D RE NNAGNRLVAALS+ RY+HV++INLEFAQDIED+HL+LLKTKCL SLQ+LESLNLN
Sbjct: 60 DFRETNNAGNRLVAALSLFRYQHVKQINLEFAQDIEDKHLDLLKTKCLDSLQELESLNLN 119
Query: 123 GCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDK 182
CQKISD+G+E I+S CP+LKVFSIYWNVRVTDIG+ HLVKNCKHI+DLNLSGCKN+ DK
Sbjct: 120 VCQKISDRGVETITSACPKLKVFSIYWNVRVTDIGMTHLVKNCKHIVDLNLSGCKNITDK 179
Query: 183 SLQLIADNYQELESLNLTRCVKLTDGGLQKILIKCSSLRSLNLYALSGFTDEAYKKISLL 242
SLQLIADNY +LE LNLTRC+KLTDGGLQ+IL+KCSSL+SLNLYALS FTDEAYKKISLL
Sbjct: 180 SLQLIADNYPDLELLNLTRCIKLTDGGLQQILLKCSSLQSLNLYALSSFTDEAYKKISLL 239
Query: 243 AHLKFLDLCGAQNLSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCSSLEFLSLF 302
L+FLDLCGAQNLSD+GL CIAKCKNLVSLNLTWCVR+TDVGV+AIA+GC+SLEFLSLF
Sbjct: 240 TDLRFLDLCGAQNLSDQGLCCIAKCKNLVSLNLTWCVRVTDVGVIAIAQGCTSLEFLSLF 299
Query: 303 GIVGVTDKCLEVLSRFCSNTLTTLDVNGCVGIKQRSRDELLQLFPHLMCFKVHS 356
GIVGVTDKCLE LSR CSN +TTLDVNGC+GIK RSRDELLQ FP+L CFKVHS
Sbjct: 300 GIVGVTDKCLEALSRSCSNMITTLDVNGCIGIKGRSRDELLQYFPYLRCFKVHS 353
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224088164|ref|XP_002308350.1| predicted protein [Populus trichocarpa] gi|222854326|gb|EEE91873.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255580692|ref|XP_002531168.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223529238|gb|EEF31211.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297739793|emb|CBI29975.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147789108|emb|CAN73494.1| hypothetical protein VITISV_044261 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297817168|ref|XP_002876467.1| hypothetical protein ARALYDRAFT_486305 [Arabidopsis lyrata subsp. lyrata] gi|297322305|gb|EFH52726.1| hypothetical protein ARALYDRAFT_486305 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356530677|ref|XP_003533907.1| PREDICTED: F-box protein At3g58530-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18410977|ref|NP_567069.1| F-box protein [Arabidopsis thaliana] gi|75154905|sp|Q8LB33.1|FB330_ARATH RecName: Full=F-box protein At3g58530 gi|21593045|gb|AAM64994.1| unknown [Arabidopsis thaliana] gi|332646275|gb|AEE79796.1| F-box protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15450960|gb|AAK96751.1| putative protein [Arabidopsis thaliana] gi|17978711|gb|AAL47349.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|388498858|gb|AFK37495.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 356 | ||||||
| TAIR|locus:2076376 | 353 | AT3G58530 [Arabidopsis thalian | 0.957 | 0.966 | 0.724 | 2e-134 | |
| UNIPROTKB|F1NHD2 | 423 | FBXL2 "Uncharacterized protein | 0.733 | 0.617 | 0.293 | 3.2e-26 | |
| RGD|1562243 | 422 | Fbxl2 "F-box and leucine-rich | 0.716 | 0.604 | 0.296 | 4e-26 | |
| MGI|MGI:1919429 | 423 | Fbxl2 "F-box and leucine-rich | 0.716 | 0.602 | 0.296 | 5.2e-26 | |
| MGI|MGI:1919444 | 436 | Fbxl20 "F-box and leucine-rich | 0.716 | 0.584 | 0.301 | 1e-25 | |
| UNIPROTKB|F1PWK1 | 422 | FBXL2 "Uncharacterized protein | 0.780 | 0.658 | 0.276 | 1.1e-25 | |
| UNIPROTKB|A6H779 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.789 | 0.664 | 0.268 | 2.2e-25 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.716 | 0.584 | 0.298 | 2.3e-25 | |
| UNIPROTKB|Q96IG2 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.716 | 0.584 | 0.298 | 2.3e-25 | |
| UNIPROTKB|Q9UKC9 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.780 | 0.657 | 0.273 | 3.8e-25 |
| TAIR|locus:2076376 AT3G58530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1317 (468.7 bits), Expect = 2.0e-134, P = 2.0e-134
Identities = 247/341 (72%), Positives = 293/341 (85%)
Query: 16 TWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNAGNRLV 75
TW +E V V+R++STRL Q D+ISLLLVSPWL+RTL+SYPS+WL I+LREM NAG+RL+
Sbjct: 13 TWRREIVTSVMRLVSTRLPQTDLISLLLVSPWLYRTLISYPSIWLTINLREMTNAGDRLL 72
Query: 76 AALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEII 135
AALS+PRYR V+ INLEFAQ + D HL+L+KT+C +L LE LNLN CQKISD GIE I
Sbjct: 73 AALSLPRYRQVKHINLEFAQGVVDSHLKLVKTECPDALLSLEWLNLNVCQKISDNGIEAI 132
Query: 136 SSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDKSLQLIADNYQELE 195
+S CP+LKVFSIYWNVRVTD GI++LVKNC+HI DLNLSGCK+L DKS+QL+A++Y +LE
Sbjct: 133 TSICPKLKVFSIYWNVRVTDAGIRNLVKNCRHITDLNLSGCKSLTDKSMQLVAESYPDLE 192
Query: 196 SLNLTRCVKLTDGGLQKILIKCSSLRSLNLYALSGFTDEAYKKISLLAHLKFLDLCGAQN 255
SLN+TRCVK+TD GL ++L KC SL++LNLYALSGFTD+AY KISLLA L+FLD+CGAQN
Sbjct: 193 SLNITRCVKITDDGLLQVLQKCFSLQTLNLYALSGFTDKAYMKISLLADLRFLDICGAQN 252
Query: 256 LSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCSSLEFLSLFGIVGVTDKCLEVL 315
+SDEG+ IAKC L SLNLTWCVRITD GV IA C+SLEFLSLFGIVGVTD+CLE L
Sbjct: 253 ISDEGIGHIAKCNKLESLNLTWCVRITDAGVNTIANSCTSLEFLSLFGIVGVTDRCLETL 312
Query: 316 SRFCSNTLTTLDVNGCVGIKQRSRDELLQLFPHLMCFKVHS 356
S+ CS TLTTLDVNGC GIK+RSR+ELLQ+FP L CFKVHS
Sbjct: 313 SQTCSTTLTTLDVNGCTGIKRRSREELLQMFPRLTCFKVHS 353
|
|
| UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.VI.628.1 | hypothetical protein (341 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 356 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 3e-16 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 2e-14 | |
| smart00367 | 26 | smart00367, LRR_CC, Leucine-rich repeat - CC (cyst | 3e-04 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 76.6 bits (189), Expect = 3e-16
Identities = 51/178 (28%), Positives = 81/178 (45%), Gaps = 10/178 (5%)
Query: 185 QLIADNYQELESLNLTRCVKLTDGGLQKILIKCSSLRSLNLYALSGFTDEAYKKISL-LA 243
QL+ + LE L L C Q L C+ L+ L L DE ++
Sbjct: 21 QLLRILHSGLEWLELYMCPISDPPLDQ--LSNCNKLKKLILPGSKLIDDEGLIALAQSCP 78
Query: 244 HLKFLDLCGAQNLSDEGLACIA-KCKNLVSLNL---TWCVRITDVGVMAIAEGCSSLEFL 299
+L+ LDL +N++D G+ +A C L ++NL ITDV + A+ + C+ L+ +
Sbjct: 79 NLQVLDLRACENITDSGIVALATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTV 138
Query: 300 SLFGIVGVTDKCLEVLSRFCSNTLTTLDVNGCVGIKQRSRDELLQL--FPHLMCFKVH 355
G VTDK + L+ CS +L L +N C + +S +L FP+L +
Sbjct: 139 GFAG-CDVTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLSVLEFR 195
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 100.0 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.96 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.92 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.72 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.69 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.67 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.62 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.57 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.55 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.51 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.42 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.38 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.3 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.27 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.27 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.2 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.18 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.13 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.11 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 99.08 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 99.05 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.82 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.77 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.73 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.7 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.63 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.51 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.46 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.43 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.41 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.37 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.36 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.27 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.26 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.19 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.11 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.92 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.92 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.91 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.87 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.77 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.76 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.63 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.55 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.47 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.41 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.36 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.34 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.23 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.14 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.08 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.0 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.0 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.98 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.79 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.72 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.69 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.47 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.42 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 96.27 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.13 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.07 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.01 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.0 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.94 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.87 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.7 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.68 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 95.34 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 95.28 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.15 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 94.76 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 94.6 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 94.42 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 94.2 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 93.52 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 91.62 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 91.32 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 88.87 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 88.65 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 88.26 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 87.27 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 86.63 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 86.48 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-35 Score=242.10 Aligned_cols=296 Identities=25% Similarity=0.409 Sum_probs=194.8
Q ss_pred hccccccCCchHHHHHHHhCCChhhhHHHHhccHHHHHHhccCCCcceEeccccccch-hhhHHHhhcCcccCCccEeec
Q 018439 13 EEETWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNA-GNRLVAALSIPRYRHVREINL 91 (356)
Q Consensus 13 ~~~~~~~~~~peil~~If~~L~~~~~~~~~~v~~~w~~~~~~~~~l~~~l~l~~~~~~-~~~~~~~l~~~~~~~l~~l~l 91 (356)
....| .+|||++.+||++|+.+.+.+++++|+.|+.. +.+...|+++++...... ...++..+.......++++.+
T Consensus 69 ~~~~~--~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~-AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSl 145 (483)
T KOG4341|consen 69 NSISR--SLPPELLLKVFSMLDTKSLCRAAQCCTMWNKL-ALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSL 145 (483)
T ss_pred ccccc--cCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhh-hhccccceeeehhcchhcCCCcceehHhhhhccccccccc
Confidence 45567 88999999999999999999999999999976 789999999988765543 233333333333345666666
Q ss_pred CCCCCCchHHHHHHHHHhcccCCCccEEecCCCCCCCHHHHHHHHHhCCCccEEEeecCCccCHHHHHHHHHhCCcCcEE
Q 018439 92 EFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDL 171 (356)
Q Consensus 92 ~~~~~~~~~~~~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L 171 (356)
+++..+.+..+..+...| |++++|.+.+|..+++..+..+...|++|++|.+..|..+++..+..+...|++|++|
T Consensus 146 rG~r~v~~sslrt~~~~C----pnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~l 221 (483)
T KOG4341|consen 146 RGCRAVGDSSLRTFASNC----PNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYL 221 (483)
T ss_pred cccccCCcchhhHHhhhC----CchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHh
Confidence 666666666666665544 6666666666666666666666666666666666665566666666666666666666
Q ss_pred eccCCCCCCHHHHH--------------------------HHHHhCCCCcEEecCCCCCCChHHHHHHHhcCCCCcEEEc
Q 018439 172 NLSGCKNLLDKSLQ--------------------------LIADNYQELESLNLTRCVKLTDGGLQKILIKCSSLRSLNL 225 (356)
Q Consensus 172 ~l~~~~~~~~~~~~--------------------------~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l 225 (356)
+++.|+.++..+++ ....+++-+..+++..|..++++.+..+...+..|+.|..
T Consensus 222 NlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~ 301 (483)
T KOG4341|consen 222 NLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCY 301 (483)
T ss_pred hhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcc
Confidence 66555544443333 3333344444455555555666666666666677777777
Q ss_pred CCCCCCChHHHHHhc-cCCCCCEEecCCCCCCchHHHHHhhc-CCCCcEEecCCCCCCCHHHHHHHHhcCCCCCEEEecC
Q 018439 226 YALSGFTDEAYKKIS-LLAHLKFLDLCGAQNLSDEGLACIAK-CKNLVSLNLTWCVRITDVGVMAIAEGCSSLEFLSLFG 303 (356)
Q Consensus 226 ~~~~~~~~~~~~~l~-~~~~L~~L~l~~~~~~~~~~~~~l~~-~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~ 303 (356)
++|..+++.....++ ..++|+.+-+.+|..+++.++..+++ ++.|+.+++..|..+++..+..+..+||.|+.|.+++
T Consensus 302 s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~lslsh 381 (483)
T KOG4341|consen 302 SSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDGTLASLSRNCPRLRVLSLSH 381 (483)
T ss_pred cCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhhhHhhhccCCchhccCChhh
Confidence 777666666666665 56777777777777777777766664 5667777666666666665666666666666666666
Q ss_pred CCCCCHHHHHHH
Q 018439 304 IVGVTDKCLEVL 315 (356)
Q Consensus 304 ~~~~~~~~~~~l 315 (356)
|..++++++..+
T Consensus 382 ce~itD~gi~~l 393 (483)
T KOG4341|consen 382 CELITDEGIRHL 393 (483)
T ss_pred hhhhhhhhhhhh
Confidence 666666655544
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 356 | ||||
| 1fqv_A | 336 | Insights Into Scf Ubiquitin Ligases From The Struct | 2e-05 | ||
| 1fqv_A | 336 | Insights Into Scf Ubiquitin Ligases From The Struct | 6e-04 | ||
| 1fs2_A | 272 | Insights Into Scf Ubiquitin Ligases From The Struct | 2e-05 | ||
| 1fs2_A | 272 | Insights Into Scf Ubiquitin Ligases From The Struct | 6e-04 | ||
| 3ogk_B | 592 | Structure Of Coi1-Ask1 In Complex With Coronatine A | 2e-04 |
| >pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336 | Back alignment and structure |
|
| >pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336 | Back alignment and structure |
| >pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272 | Back alignment and structure |
| >pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272 | Back alignment and structure |
| >pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 356 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-45 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 9e-26 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-34 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-33 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-24 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-18 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 8e-34 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-33 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-29 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-26 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 4e-16 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 4e-15 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-13 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-10 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 3e-08 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 6e-15 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 1e-14 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 8e-13 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-11 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 3e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 6e-15 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-13 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 1e-12 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 9e-11 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 6e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 3e-11 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 4e-08 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 9e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 7e-07 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-06 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 7e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 7e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 8e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 158 bits (400), Expect = 1e-45
Identities = 65/300 (21%), Positives = 122/300 (40%), Gaps = 22/300 (7%)
Query: 25 VIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNAGNRLVAALSIPRYR 84
++ I S L +++ + V +R L S SLW +DL N + LS
Sbjct: 17 LLGIFS-CLCLPELLKVSGVCKRWYR-LASDESLWQTLDLTGKNLHPDVTGRLLS----- 69
Query: 85 HVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELKV 144
A ++ + + ++ ++L+ I + I S C +L+
Sbjct: 70 -----QGVIAFRCPRSFMDQPLAEHFSPFR-VQHMDLSNSV-IEVSTLHGILSQCSKLQN 122
Query: 145 FSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDKSLQLIADNYQELESLNLTRCVK 204
S+ +R++D + L K +++ LNLSGC + +LQ + + L+ LNL+ C
Sbjct: 123 LSLE-GLRLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFD 180
Query: 205 LTDGGLQKILIK-CSSLRSLNLYAL-SGFTDEAYKKISL-LAHLKFLDLCGAQNLSDEGL 261
T+ +Q + ++ LNL + +L LDL + L ++
Sbjct: 181 FTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCF 240
Query: 262 ACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCSSLEFLSLFGIVGVTDKCLEVLSRFCSN 321
+ L L+L+ C I ++ + E +L+ L +FGI V D L++L +
Sbjct: 241 QEFFQLNYLQHLSLSRCYDIIPETLLELGE-IPTLKTLQVFGI--VPDGTLQLLKEALPH 297
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 100.0 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.97 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.97 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.91 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.91 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.86 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.86 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.86 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.83 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.79 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.68 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.65 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.64 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.62 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.59 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.54 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.54 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.48 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.48 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.47 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.45 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.44 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.44 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.44 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.44 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.43 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.42 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.41 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.39 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.38 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.38 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.38 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.37 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.36 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.36 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.36 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.35 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.35 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.34 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.34 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.34 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.34 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.33 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.33 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.33 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.33 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.33 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.33 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.32 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.32 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.31 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.31 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.31 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.3 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.3 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.29 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.29 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.28 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.28 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.28 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.27 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.26 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.26 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.26 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.26 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.26 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.24 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.23 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.23 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.23 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.23 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.23 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.22 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.22 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.21 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.21 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.17 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.15 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.15 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.13 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.12 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.12 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.11 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.11 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.1 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.09 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.09 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.09 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.08 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.08 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.08 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.06 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.06 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.02 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.02 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.01 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.99 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.98 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.93 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.92 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.92 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.91 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.88 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.84 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.83 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.82 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.81 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.8 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.79 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.74 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.64 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.62 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.62 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.61 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.6 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.6 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.59 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.59 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.56 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.55 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.55 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.55 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.55 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.52 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.5 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.49 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.46 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.45 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.44 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.4 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.4 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.34 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.26 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.17 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.17 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.16 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.12 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.1 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.08 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.04 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.99 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.99 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.95 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.93 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.91 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.82 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.76 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.76 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.6 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.5 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.47 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.46 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.35 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.34 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.31 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.25 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.95 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.39 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.38 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.31 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 91.38 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 89.0 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 82.46 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=100.00 E-value=3.1e-32 Score=234.96 Aligned_cols=296 Identities=22% Similarity=0.316 Sum_probs=230.1
Q ss_pred hccccccCCchHHHHHHHhCCChhhhHHHHhccHHHHHHhccCCCcceEeccccccchhhhHHHhhcCcccCCccEeecC
Q 018439 13 EEETWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNAGNRLVAALSIPRYRHVREINLE 92 (356)
Q Consensus 13 ~~~~~~~~~~peil~~If~~L~~~~~~~~~~v~~~w~~~~~~~~~l~~~l~l~~~~~~~~~~~~~l~~~~~~~l~~l~l~ 92 (356)
+...|. ++|+|++.+||+||+.+|+.+++.|||+|+++. .+|.+|+.++++........+ ..+ ..++++.+++.
T Consensus 5 ~~~~~~-~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~-~~~~~~~~l~l~~~~~~~~~~-~~~---~~~~l~~L~l~ 78 (336)
T 2ast_B 5 PGVSWD-SLPDELLLGIFSCLCLPELLKVSGVCKRWYRLA-SDESLWQTLDLTGKNLHPDVT-GRL---LSQGVIAFRCP 78 (336)
T ss_dssp --CCSS-SSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHH-TCSTTSSEEECTTCBCCHHHH-HHH---HHTTCSEEECT
T ss_pred ccCChh-hCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHh-cCchhheeeccccccCCHHHH-Hhh---hhccceEEEcC
Confidence 345573 566699999999999999999999999999985 569999999998765443222 221 12678888888
Q ss_pred CCCCCchHHHHHHHHHhcccCCCccEEecCCCCCCCHHHHHHHHHhCCCccEEEeecCCccCHHHHHHHHHhCCcCcEEe
Q 018439 93 FAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLN 172 (356)
Q Consensus 93 ~~~~~~~~~~~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~ 172 (356)
++. +...... ...+++|++|+++++ .++...+......+++|++|+++++ .+++.....+ ..+++|++|+
T Consensus 79 ~n~-l~~~~~~------~~~~~~L~~L~L~~~-~l~~~~~~~~~~~~~~L~~L~L~~~-~l~~~~~~~l-~~~~~L~~L~ 148 (336)
T 2ast_B 79 RSF-MDQPLAE------HFSPFRVQHMDLSNS-VIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTL-AKNSNLVRLN 148 (336)
T ss_dssp TCE-ECSCCCS------CCCCBCCCEEECTTC-EECHHHHHHHHTTBCCCSEEECTTC-BCCHHHHHHH-TTCTTCSEEE
T ss_pred Ccc-ccccchh------hccCCCCCEEEccCC-CcCHHHHHHHHhhCCCCCEEeCcCc-ccCHHHHHHH-hcCCCCCEEE
Confidence 653 2111100 235689999999997 4777767778889999999999998 7887766655 4699999999
Q ss_pred ccCCCCCCHHHHHHHHHhCCCCcEEecCCCCCCChHHHHHHHhcCC-CCcEEEcCCCC-CCChHHH-HHhccCCCCCEEe
Q 018439 173 LSGCKNLLDKSLQLIADNYQELESLNLTRCVKLTDGGLQKILIKCS-SLRSLNLYALS-GFTDEAY-KKISLLAHLKFLD 249 (356)
Q Consensus 173 l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~-~L~~L~l~~~~-~~~~~~~-~~l~~~~~L~~L~ 249 (356)
++++..+++..+..+...+++|++|++++|..+++..+...+..++ +|++|++++|. .+.+..+ ..+..+++|++|+
T Consensus 149 L~~~~~l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~ 228 (336)
T 2ast_B 149 LSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLD 228 (336)
T ss_dssp CTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEE
T ss_pred CCCCCCCCHHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEe
Confidence 9998678887788888889999999999966888777888888999 99999999975 4664444 3456899999999
Q ss_pred cCCCCCCchHHHHHhhcCCCCcEEecCCCCCCCHHHHHHHHhcCCCCCEEEecCCCCCCHHHHHHHHHHccccccEEecC
Q 018439 250 LCGAQNLSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCSSLEFLSLFGIVGVTDKCLEVLSRFCSNTLTTLDVN 329 (356)
Q Consensus 250 l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~~L~~L~l~ 329 (356)
+++|..+++..+..++.+++|++|++++|..+++.++..+. .+++|+.|++++| +++.++..+.. +++.|+++
T Consensus 229 l~~~~~l~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~l~-~~~~L~~L~l~~~--i~~~~~~~l~~----~l~~L~l~ 301 (336)
T 2ast_B 229 LSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELG-EIPTLKTLQVFGI--VPDGTLQLLKE----ALPHLQIN 301 (336)
T ss_dssp CTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTS--SCTTCHHHHHH----HSTTSEES
T ss_pred CCCCCcCCHHHHHHHhCCCCCCEeeCCCCCCCCHHHHHHHh-cCCCCCEEeccCc--cCHHHHHHHHh----hCcceEEe
Confidence 99996588888888889999999999998777777664444 4899999999997 88877777764 45556666
Q ss_pred CC
Q 018439 330 GC 331 (356)
Q Consensus 330 ~c 331 (356)
++
T Consensus 302 ~n 303 (336)
T 2ast_B 302 CS 303 (336)
T ss_dssp CC
T ss_pred cc
Confidence 54
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 356 | ||||
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 8e-12 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 62.8 bits (151), Expect = 8e-12
Identities = 56/267 (20%), Positives = 107/267 (40%), Gaps = 20/267 (7%)
Query: 58 LWLVIDLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLE 117
LW +DL N + LS + F H + ++
Sbjct: 1 LWQTLDLTGKNLHPDVTGRLLS--QGVIAFRCPRSFMDQPLAEHFSPFR---------VQ 49
Query: 118 SLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCK 177
++L+ I + I S C +L+ S+ R++D + L +++ LNLSGC
Sbjct: 50 HMDLSNS-VIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLA-KNSNLVRLNLSGCS 106
Query: 178 NLLDKSLQLIADNYQELESLNLTRCVKLTDGGLQKIL---IKCSSLRSLNLYALSGFTDE 234
+ +LQ + + L+ LNL+ C T+ +Q + + + +L+ Y + +
Sbjct: 107 GFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSD 166
Query: 235 AYKKISLLAHLKFLDLCGAQNLSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCS 294
+ +L LDL + L ++ + L L+L+ C I ++ + E
Sbjct: 167 LSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGE-IP 225
Query: 295 SLEFLSLFGIVGVTDKCLEVLSRFCSN 321
+L+ L +FGI V D L++L +
Sbjct: 226 TLKTLQVFGI--VPDGTLQLLKEALPH 250
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.93 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.93 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.68 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.64 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.63 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.63 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.05 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.04 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.03 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.98 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.95 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.91 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.89 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.87 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.85 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.84 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.8 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.79 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.78 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.78 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.78 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.75 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.74 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.73 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.71 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.66 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.65 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.56 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.55 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.54 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.46 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.43 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.32 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.31 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.08 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.94 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.84 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.57 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.53 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.48 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.13 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.0 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.89 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 94.87 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=6e-25 Score=181.93 Aligned_cols=249 Identities=24% Similarity=0.337 Sum_probs=183.3
Q ss_pred cceEeccccccchhhhHHHhhcCcccCCccEeecCCCCCCchHHHHHHHHHhcccCCCccEEecCCCCCCCHHHHHHHHH
Q 018439 58 LWLVIDLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISS 137 (356)
Q Consensus 58 l~~~l~l~~~~~~~~~~~~~l~~~~~~~l~~l~l~~~~~~~~~~~~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~ 137 (356)
+|+++|++......+...+.+.. ....+.+.... +...... .....+|++|+++++ .++...+..+..
T Consensus 1 LW~~lDLs~~~l~~~~l~~l~~~----~~~~lrl~~~~-~~~~~~~------~~~~~~L~~LdLs~~-~i~~~~l~~l~~ 68 (284)
T d2astb2 1 LWQTLDLTGKNLHPDVTGRLLSQ----GVIAFRCPRSF-MDQPLAE------HFSPFRVQHMDLSNS-VIEVSTLHGILS 68 (284)
T ss_dssp TSSEEECTTCBCCHHHHHHHHHT----TCSEEECTTCE-ECSCCCS------CCCCBCCCEEECTTC-EECHHHHHHHHT
T ss_pred CcCEEECCCCCCCchHHHHHHhc----cceEeeccccc-cccchhh------hccCCCCCEEECCCC-ccCHHHHHHHHH
Confidence 69999998765544433333321 22233333211 0000000 123357899999887 577777888888
Q ss_pred hCCCccEEEeecCCccCHHHHHHHHHhCCcCcEEeccCCCCCCHHHHHHHHHhCCCCcEEecCCCCCCChHHHHHHHh-c
Q 018439 138 TCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDKSLQLIADNYQELESLNLTRCVKLTDGGLQKILI-K 216 (356)
Q Consensus 138 ~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~-~ 216 (356)
.|++|++|++.++ .+++..+..+ ..+++|++|++++|..+++.++..+...+++|++|++++|..+++.++...+. .
T Consensus 69 ~c~~L~~L~L~~~-~l~~~~~~~l-~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~ 146 (284)
T d2astb2 69 QCSKLQNLSLEGL-RLSDPIVNTL-AKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHV 146 (284)
T ss_dssp TBCCCSEEECTTC-BCCHHHHHHH-TTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHS
T ss_pred hCCCccccccccc-CCCcHHHHHH-hcCCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhccc
Confidence 8999999999888 7787777766 46789999999988888888888888888999999999888888777765454 4
Q ss_pred CCCCcEEEcCCC-CCCChHHHHHhc-cCCCCCEEecCCCCCCchHHHHHhhcCCCCcEEecCCCCCCCHHHHHHHHhcCC
Q 018439 217 CSSLRSLNLYAL-SGFTDEAYKKIS-LLAHLKFLDLCGAQNLSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCS 294 (356)
Q Consensus 217 ~~~L~~L~l~~~-~~~~~~~~~~l~-~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~ 294 (356)
+++|++|++.+| ..+.+..+..+. .+++|++|++++|..+++.++..++++++|++|++++|..+++.++..+.. +|
T Consensus 147 ~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~~L~L~~C~~i~~~~l~~L~~-~~ 225 (284)
T d2astb2 147 SETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGE-IP 225 (284)
T ss_dssp CTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCCGGGGGGGGG-CT
T ss_pred ccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccCcCCEEECCCCCCCChHHHHHHhc-CC
Confidence 578999999876 346666666654 688999999998878888888888889999999999988888887777654 88
Q ss_pred CCCEEEecCCCCCCHHHHHHHHHHcccccc
Q 018439 295 SLEFLSLFGIVGVTDKCLEVLSRFCSNTLT 324 (356)
Q Consensus 295 ~L~~L~l~~~~~~~~~~~~~l~~~~~~~L~ 324 (356)
+|+.|++.+| +++.++..+...++ +|+
T Consensus 226 ~L~~L~l~~~--~~d~~l~~l~~~lp-~L~ 252 (284)
T d2astb2 226 TLKTLQVFGI--VPDGTLQLLKEALP-HLQ 252 (284)
T ss_dssp TCCEEECTTS--SCTTCHHHHHHHST-TSE
T ss_pred CCCEEeeeCC--CCHHHHHHHHHhCc-ccc
Confidence 9999999887 67777888777665 665
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|