Citrus Sinensis ID: 018443

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MLQPLNSNLRMLFFLLLRCRKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY
cccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHccccHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHccccEEEEEccccHHHHHHHcccccEEEEccccHHHHHHHHccccEEEEEcccccHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHcccccccccccEEcccccEEEEccc
ccccccHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccccccHHHHHHcEEEEEccccEccccEEcHHHHHHHHHHHHHccccEEEEccccccHHHccHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEcHHHHcccccHHHHHHHcccccEEEEEEccccHHHHHHccccEEEEEcccHHHHHHHHHccccEEEEEHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccEEEEccccEEEEEcc
MLQPLNSNLRMLFFLLLRCRknrkwrppqaaiipnyhlpmrsfevknrtsaeDIKALRLITAiktpylpdgrfdleaydDLVNMQIVNgaegmivggttgegqlmsWDEHIMLIGHTVNCFGASVKVigntgsnstrEAIHATEQGFAVGMHAALhinpyygktsleGLISHFDSvlsmgptiiynvpsrtgqdipprvihtmaqspnlagvkecvgndrvehytgngivvwsgnddqchdarwnhgatGVISVTSNLVPGMMRelmfggknpslntklfpliewlfqepnpiplnTALAqlgvvrpvfrlpyvplpqekRAEFVNLVNQIgrenfvgekdvqvlddddfilvdry
MLQPLNSNLRMLFFLLLRCRKNRkwrppqaaiipnyhlpmrSFEVKNRTSAEDIKALRLITaiktpylpdGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGrenfvgekdvqvlddddfilvdry
MLQPlnsnlrmlfflllrCRKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY
*******NLRMLFFLLLRCRKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILV***
****LNSNLRMLFFLLLRC*************I*NY*******************ALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY
MLQPLNSNLRMLFFLLLRCRKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY
*LQPLNSNLRMLFFLLLRCRKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQPLNSNLRMLFFLLLRCRKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query356 2.2.26 [Sep-21-2011]
Q42948359 4-hydroxy-tetrahydrodipic N/A no 0.946 0.938 0.848 1e-174
Q9FVC8365 4-hydroxy-tetrahydrodipic yes no 0.946 0.923 0.818 1e-168
Q42800332 4-hydroxy-tetrahydrodipic yes no 0.921 0.987 0.823 1e-163
Q9LZX6365 4-hydroxy-tetrahydrodipic no no 0.946 0.923 0.789 1e-163
P24847377 4-hydroxy-tetrahydrodipic N/A no 0.918 0.867 0.773 1e-153
P26259380 4-hydroxy-tetrahydrodipic N/A no 0.918 0.860 0.764 1e-153
Q39535377 4-hydroxy-tetrahydrodipic N/A no 0.918 0.867 0.755 1e-152
P24846388 4-hydroxy-tetrahydrodipic N/A no 0.918 0.842 0.764 1e-151
B5YKK4291 4-hydroxy-tetrahydrodipic yes no 0.761 0.931 0.354 3e-41
C4L2D2293 4-hydroxy-tetrahydrodipic yes no 0.752 0.914 0.353 4e-41
>sp|Q42948|DAPA_TOBAC 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic OS=Nicotiana tabacum GN=DHPS1 PE=2 SV=1 Back     alignment and function desciption
 Score =  612 bits (1577), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 286/337 (84%), Positives = 315/337 (93%)

Query: 20  RKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYD 79
           R+  +WR P+AA+IP++HLPMRS EVKNRT A+DIKALRLITAIKTPYLPDGRFDLEAYD
Sbjct: 23  RRTTRWRSPRAAVIPSFHLPMRSNEVKNRTFADDIKALRLITAIKTPYLPDGRFDLEAYD 82

Query: 80  DLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREA 139
            LVN+QI NGAEG+IVGGTTGEGQLMSWDEHIMLIGHTVNCFG S+KVIGNTGSNSTREA
Sbjct: 83  TLVNLQIENGAEGVIVGGTTGEGQLMSWDEHIMLIGHTVNCFGGSIKVIGNTGSNSTREA 142

Query: 140 IHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRV 199
           IHATEQGFAVGMHAALHINPYYGKTSLEGLISHF+SVL MGPTIIYNVPSRTGQDIPPRV
Sbjct: 143 IHATEQGFAVGMHAALHINPYYGKTSLEGLISHFESVLPMGPTIIYNVPSRTGQDIPPRV 202

Query: 200 IHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLV 259
           I TMA+SPNLAGVKECVGNDRVE YT +G+VVWSGNDD+CH +RW++GATGVISVTSNLV
Sbjct: 203 IQTMAKSPNLAGVKECVGNDRVEQYTSDGVVVWSGNDDECHVSRWDYGATGVISVTSNLV 262

Query: 260 PGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQE 319
           PG+MRELMFGGKNP+LN+KL PL+EWLF EPNPI LNTALAQLGVVRPVFRLPYVPL + 
Sbjct: 263 PGLMRELMFGGKNPALNSKLMPLMEWLFHEPNPIALNTALAQLGVVRPVFRLPYVPLTKA 322

Query: 320 KRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY 356
           KR EFV +V +IGRENF+GE+DVQ+LDD+DFILV RY
Sbjct: 323 KREEFVKIVKEIGRENFIGERDVQILDDNDFILVGRY 359

Nicotiana tabacum (taxid: 4097)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 5EC: 2
>sp|Q9FVC8|DAPA2_ARATH 4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=DHDPS2 PE=1 SV=2 Back     alignment and function description
>sp|Q42800|DAPA_SOYBN 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic OS=Glycine max GN=DHPS1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZX6|DAPA1_ARATH 4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic OS=Arabidopsis thaliana GN=DHDPS1 PE=2 SV=2 Back     alignment and function description
>sp|P24847|DAPA2_WHEAT 4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic OS=Triticum aestivum PE=1 SV=1 Back     alignment and function description
>sp|P26259|DAPA_MAIZE 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic OS=Zea mays PE=1 SV=2 Back     alignment and function description
>sp|Q39535|DAPA_COILA 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic OS=Coix lachryma-jobi GN=DAPA PE=3 SV=1 Back     alignment and function description
>sp|P24846|DAPA1_WHEAT 4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic OS=Triticum aestivum PE=1 SV=1 Back     alignment and function description
>sp|B5YKK4|DAPA_THEYD 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dapA PE=3 SV=1 Back     alignment and function description
>sp|C4L2D2|DAPA_EXISA 4-hydroxy-tetrahydrodipicolinate synthase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dapA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
255561405367 dihydrodipicolinate synthase, putative [ 0.946 0.918 0.884 1e-178
224063919365 predicted protein [Populus trichocarpa] 0.946 0.923 0.881 1e-177
224127414363 predicted protein [Populus trichocarpa] 0.943 0.925 0.863 1e-174
6014908359 RecName: Full=4-hydroxy-tetrahydrodipico 0.946 0.938 0.848 1e-172
8648949380 dihydrodipicolinate synthase [Populus tr 0.943 0.884 0.854 1e-172
449432235367 PREDICTED: dihydrodipicolinate synthase 0.952 0.923 0.846 1e-170
356532087363 PREDICTED: dihydrodipicolinate synthase, 0.952 0.933 0.823 1e-167
15225477365 dihydrodipicolinate synthase [Arabidopsi 0.946 0.923 0.818 1e-167
255647005363 unknown [Glycine max] 0.952 0.933 0.823 1e-167
11066382365 dihydrodipicolinate synthase 2 [Arabidop 0.946 0.923 0.818 1e-166
>gi|255561405|ref|XP_002521713.1| dihydrodipicolinate synthase, putative [Ricinus communis] gi|223539104|gb|EEF40700.1| dihydrodipicolinate synthase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 298/337 (88%), Positives = 319/337 (94%)

Query: 20  RKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYD 79
           R++ KWR PQAA+IPN+HLPMRSFEVKNRTS+EDIK+LRLITAIKTPYLPDGRFDLEAYD
Sbjct: 31  RRSGKWRSPQAAVIPNFHLPMRSFEVKNRTSSEDIKSLRLITAIKTPYLPDGRFDLEAYD 90

Query: 80  DLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREA 139
            L+NMQIVNGAEG+IVGGTTGEGQLMSWDEHIMLIGHTVNCFG S+KVIGNTGSNSTREA
Sbjct: 91  ALLNMQIVNGAEGVIVGGTTGEGQLMSWDEHIMLIGHTVNCFGGSIKVIGNTGSNSTREA 150

Query: 140 IHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRV 199
           IHATEQGFAVGMHAALHINPYYGKTSLEGL+SHFDSVL MGPTIIYNVPSRTGQDIPP V
Sbjct: 151 IHATEQGFAVGMHAALHINPYYGKTSLEGLVSHFDSVLPMGPTIIYNVPSRTGQDIPPCV 210

Query: 200 IHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLV 259
           IHT+AQSPNLAGVKECVGNDRVE YT  GIVVWSGNDDQCHD+RWNHGATGVISVTSNLV
Sbjct: 211 IHTIAQSPNLAGVKECVGNDRVEEYTEKGIVVWSGNDDQCHDSRWNHGATGVISVTSNLV 270

Query: 260 PGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQE 319
           PG+MR+L+F GKNP+LN+KL PLI+WLFQEPNPI LNTALAQLGVVRPVFRLPYVPLP  
Sbjct: 271 PGLMRQLVFEGKNPALNSKLLPLIDWLFQEPNPIGLNTALAQLGVVRPVFRLPYVPLPLA 330

Query: 320 KRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY 356
           +R EFVNLV  IGRENFVGEKDV+VLDDDDFIL+ RY
Sbjct: 331 QRVEFVNLVKAIGRENFVGEKDVRVLDDDDFILIGRY 367

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224063919|ref|XP_002301301.1| predicted protein [Populus trichocarpa] gi|222843027|gb|EEE80574.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127414|ref|XP_002320068.1| predicted protein [Populus trichocarpa] gi|222860841|gb|EEE98383.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|6014908|sp|Q42948.1|DAPA_TOBAC RecName: Full=4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic; Short=HTPA synthase; Flags: Precursor gi|1213069|emb|CAA56123.1| dihydrodipicolinate synthase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|8648949|emb|CAA51273.2| dihydrodipicolinate synthase [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|449432235|ref|XP_004133905.1| PREDICTED: dihydrodipicolinate synthase 2, chloroplastic-like [Cucumis sativus] gi|449518437|ref|XP_004166248.1| PREDICTED: dihydrodipicolinate synthase 2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356532087|ref|XP_003534605.1| PREDICTED: dihydrodipicolinate synthase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|15225477|ref|NP_182068.1| dihydrodipicolinate synthase [Arabidopsis thaliana] gi|14547964|sp|Q9FVC8.2|DAPA2_ARATH RecName: Full=4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic; Short=HTPA synthase 2; Flags: Precursor gi|2583111|gb|AAB82620.1| putative dihydrodipicolinate synthase [Arabidopsis thaliana] gi|28466961|gb|AAO44089.1| At2g45440 [Arabidopsis thaliana] gi|110735769|dbj|BAE99862.1| putative dihydrodipicolinate synthase [Arabidopsis thaliana] gi|330255460|gb|AEC10554.1| dihydrodipicolinate synthase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255647005|gb|ACU23971.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|11066382|gb|AAG28565.1|AF200325_1 dihydrodipicolinate synthase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
TAIR|locus:2050936365 DHDPS2 "dihydrodipicolinate sy 0.946 0.923 0.818 1.5e-154
TAIR|locus:2101921365 DHDPS1 "dihydrodipicolinate sy 0.946 0.923 0.789 5.4e-150
TIGR_CMR|CPS_3680306 CPS_3680 "dihydrodipicolinate 0.831 0.967 0.53 2.8e-82
TIGR_CMR|CHY_1156293 CHY_1156 "dihydrodipicolinate 0.75 0.911 0.35 1.1e-37
TIGR_CMR|CBU_1222289 CBU_1222 "dihydrodipicolinate 0.764 0.941 0.333 6.3e-37
TIGR_CMR|DET_0973297 DET_0973 "dihydrodipicolinate 0.747 0.895 0.371 8e-37
TIGR_CMR|GSU_0159290 GSU_0159 "dihydrodipicolinate 0.755 0.927 0.332 8.3e-35
UNIPROTKB|P0A6L2292 dapA [Escherichia coli K-12 (t 0.733 0.893 0.341 2.2e-34
TIGR_CMR|SO_1879294 SO_1879 "dihydrodipicolinate s 0.727 0.880 0.329 2.2e-34
UNIPROTKB|Q97R25311 dapA "4-hydroxy-tetrahydrodipi 0.778 0.890 0.315 9.5e-34
TAIR|locus:2050936 DHDPS2 "dihydrodipicolinate synthase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1507 (535.5 bits), Expect = 1.5e-154, P = 1.5e-154
 Identities = 276/337 (81%), Positives = 307/337 (91%)

Query:    20 RKNRKWRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYD 79
             R++ KW  P+AA++PN+HLPMRS EVKNRT+ +DIKALR+ITAIKTPYLPDGRFDLEAYD
Sbjct:    29 RRSSKWVSPKAAVVPNFHLPMRSLEVKNRTNTDDIKALRVITAIKTPYLPDGRFDLEAYD 88

Query:    80 DLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREA 139
             DLVN+QI NGAEG+IVGGTTGEGQLMSWDEHIMLIGHTVNCFG S+KVIGNTGSNSTREA
Sbjct:    89 DLVNIQIQNGAEGVIVGGTTGEGQLMSWDEHIMLIGHTVNCFGGSIKVIGNTGSNSTREA 148

Query:   140 IHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRV 199
             IHATEQGFAVGMHAALHINPYYGKTS+EGLI+HF SVL MGPTIIYNVP RTGQDIPPR 
Sbjct:   149 IHATEQGFAVGMHAALHINPYYGKTSIEGLIAHFQSVLHMGPTIIYNVPGRTGQDIPPRA 208

Query:   200 IHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLV 259
             I  ++Q+PNLAGVKECVGN RVE YT NG+VVWSGNDD+CHD+RW++GATGVISVTSNLV
Sbjct:   209 IFKLSQNPNLAGVKECVGNKRVEEYTENGVVVWSGNDDECHDSRWDYGATGVISVTSNLV 268

Query:   260 PGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQE 319
             PG+MR+LMF G+N SLN+KL PL+ WLF EPNPI +NTALAQLGV RPVFRLPYVPLP  
Sbjct:   269 PGLMRKLMFEGRNSSLNSKLLPLMAWLFHEPNPIGINTALAQLGVSRPVFRLPYVPLPLS 328

Query:   320 KRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY 356
             KR EFV LV +IGRE+FVGEKDVQ LDDDDFIL+ RY
Sbjct:   329 KRLEFVKLVKEIGREHFVGEKDVQALDDDDFILIGRY 365
GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0008840 "4-hydroxy-tetrahydrodipicolinate synthase" evidence=IEA;ISS;IMP
GO:0009089 "lysine biosynthetic process via diaminopimelate" evidence=IEA;ISS
GO:0016829 "lyase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2101921 DHDPS1 "dihydrodipicolinate synthase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3680 CPS_3680 "dihydrodipicolinate synthase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1156 CHY_1156 "dihydrodipicolinate synthase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1222 CBU_1222 "dihydrodipicolinate synthase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0973 DET_0973 "dihydrodipicolinate synthase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0159 GSU_0159 "dihydrodipicolinate synthase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6L2 dapA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1879 SO_1879 "dihydrodipicolinate synthase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q97R25 dapA "4-hydroxy-tetrahydrodipicolinate synthase" [Streptococcus pneumoniae TIGR4 (taxid:170187)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q39535DAPA_COILA4, ., 2, ., 1, ., 5, 20.75530.91850.8673N/Ano
Q9LZX6DAPA1_ARATH4, ., 2, ., 1, ., 5, 20.78930.94660.9232nono
P26259DAPA_MAIZE4, ., 2, ., 1, ., 5, 20.76450.91850.8605N/Ano
Q42800DAPA_SOYBN4, ., 2, ., 1, ., 5, 20.82310.92130.9879yesno
P24847DAPA2_WHEAT4, ., 2, ., 1, ., 5, 20.77370.91850.8673N/Ano
P24846DAPA1_WHEAT4, ., 2, ., 1, ., 5, 20.76450.91850.8427N/Ano
Q42948DAPA_TOBAC4, ., 2, ., 1, ., 5, 20.84860.94660.9387N/Ano
Q9FVC8DAPA2_ARATH4, ., 2, ., 1, ., 5, 20.81890.94660.9232yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.2.10.983
4th Layer4.2.1.520.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_II1351
dihydrodipicolinate synthase (EC-4.2.1.52) (366 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.37950001
aspartate semialdehyde dehydrogenase (EC-1.2.1.11) (344 aa)
•    •• 0.982
eugene3.00100987
aspartate semialdehyde dehydrogenase (EC-1.2.1.11) (375 aa)
•    •• 0.979
eugene3.00081272
aspartate semialdehyde dehydrogenase (EC-1.2.1.11) (375 aa)
•    •• 0.978
gw1.8576.1.1
Predicted protein (207 aa)
• •  •• 0.973
estExt_fgenesh4_pm.C_LG_XV0419
hypothetical protein (301 aa)
•    •• 0.971
estExt_Genewise1_v1.C_1700073
dihydrodipicolinate reductase (EC-1.3.1.26) (283 aa)
•    •• 0.925
fgenesh4_pg.C_LG_XIX000654
hypothetical protein (829 aa)
     •• 0.921
gw1.41.659.1
hypothetical protein (843 aa)
     •• 0.920
gw1.XVI.3802.1
diaminopimelate epimerase (EC-5.1.1.7) (281 aa)
•     • 0.834
eugene3.00090483
diaminopimelate decarboxylase (EC-4.1.1.20) (482 aa)
• •   • 0.834

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
PLN02417280 PLN02417, PLN02417, dihydrodipicolinate synthase 0.0
pfam00701289 pfam00701, DHDPS, Dihydrodipicolinate synthetase f 1e-126
cd00950284 cd00950, DHDPS, Dihydrodipicolinate synthase (DHDP 1e-113
PRK03170292 PRK03170, PRK03170, dihydrodipicolinate synthase; 2e-85
cd00408281 cd00408, DHDPS-like, Dihydrodipicolinate synthase 8e-84
TIGR00674285 TIGR00674, dapA, dihydrodipicolinate synthase 6e-71
COG0329299 COG0329, DapA, Dihydrodipicolinate synthase/N-acet 2e-66
TIGR02313294 TIGR02313, HpaI-NOT-DapA, 2,4-dihydroxyhept-2-ene- 8e-36
cd00954288 cd00954, NAL, N-Acetylneuraminic acid aldolase, al 3e-22
PRK04147293 PRK04147, PRK04147, N-acetylneuraminate lyase; Pro 3e-18
cd00953279 cd00953, KDG_aldolase, KDG (2-keto-3-deoxygluconat 2e-15
TIGR00683290 TIGR00683, nanA, N-acetylneuraminate lyase 2e-13
cd00951289 cd00951, KDGDH, 5-dehydro-4-deoxyglucarate dehydra 3e-10
cd00952309 cd00952, CHBPH_aldolase, Trans-o-hydroxybenzyliden 2e-07
TIGR03249296 TIGR03249, KdgD, 5-dehydro-4-deoxyglucarate dehydr 3e-07
PRK03620303 PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate deh 6e-07
>gnl|CDD|178038 PLN02417, PLN02417, dihydrodipicolinate synthase Back     alignment and domain information 
 Score =  563 bits (1452), Expect = 0.0
 Identities = 230/280 (82%), Positives = 247/280 (88%)

Query: 55  KALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLI 114
           K LRLITAIKTPYLPDGRFDLEAYD LVNMQI NGAEG+IVGGTTGEGQLMSWDEHIMLI
Sbjct: 1   KKLRLITAIKTPYLPDGRFDLEAYDSLVNMQIENGAEGLIVGGTTGEGQLMSWDEHIMLI 60

Query: 115 GHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFD 174
           GHTVNCFG  +KVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTS EGLI HF+
Sbjct: 61  GHTVNCFGGKIKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSQEGLIKHFE 120

Query: 175 SVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSG 234
           +VL MGPTIIYNVP RTGQDIPP VI  +AQ PN AGVKEC GNDRV+ YT  GI++WSG
Sbjct: 121 TVLDMGPTIIYNVPGRTGQDIPPEVIFKIAQHPNFAGVKECTGNDRVKQYTEKGILLWSG 180

Query: 235 NDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIP 294
           NDD+CHDARW++GA GVISVTSNLVPG+M +LMF GKN  LN KL PL++WLF EPNPI 
Sbjct: 181 NDDECHDARWDYGADGVISVTSNLVPGLMHKLMFAGKNKELNDKLLPLMDWLFCEPNPIG 240

Query: 295 LNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGRE 334
           LNTALAQLG++RPVFRLPYVPL   KRAEFV LV  IGRE
Sbjct: 241 LNTALAQLGLIRPVFRLPYVPLDLAKRAEFVALVKAIGRE 280

Length = 280
>gnl|CDD|201403 pfam00701, DHDPS, Dihydrodipicolinate synthetase family Back     alignment and domain information
>gnl|CDD|188637 cd00950, DHDPS, Dihydrodipicolinate synthase (DHDPS) Back     alignment and domain information
>gnl|CDD|235107 PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|188630 cd00408, DHDPS-like, Dihydrodipicolinate synthase family Back     alignment and domain information
>gnl|CDD|129757 TIGR00674, dapA, dihydrodipicolinate synthase Back     alignment and domain information
>gnl|CDD|223406 COG0329, DapA, Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|131366 TIGR02313, HpaI-NOT-DapA, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>gnl|CDD|188641 cd00954, NAL, N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL) Back     alignment and domain information
>gnl|CDD|179749 PRK04147, PRK04147, N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>gnl|CDD|188640 cd00953, KDG_aldolase, KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>gnl|CDD|188072 TIGR00683, nanA, N-acetylneuraminate lyase Back     alignment and domain information
>gnl|CDD|188638 cd00951, KDGDH, 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH) Back     alignment and domain information
>gnl|CDD|188639 cd00952, CHBPH_aldolase, Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>gnl|CDD|132293 TIGR03249, KdgD, 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>gnl|CDD|235141 PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 356
PLN02417280 dihydrodipicolinate synthase 100.0
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 100.0
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 100.0
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 100.0
PRK04147293 N-acetylneuraminate lyase; Provisional 100.0
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 100.0
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 100.0
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 100.0
PRK03170292 dihydrodipicolinate synthase; Provisional 100.0
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 100.0
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 100.0
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 100.0
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 100.0
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 100.0
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 100.0
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 100.0
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 99.92
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 99.86
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 99.62
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 99.58
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 99.4
PF06187382 DUF993: Protein of unknown function (DUF993); Inte 98.45
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 97.74
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 97.65
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 97.46
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 97.23
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 97.14
PRK15063428 isocitrate lyase; Provisional 97.14
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 97.11
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 97.07
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 96.38
PRK09250348 fructose-bisphosphate aldolase; Provisional 96.27
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.07
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 96.03
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 95.94
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 95.88
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 95.87
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 95.8
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 95.79
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 95.74
CHL00040475 rbcL ribulose-1,5-bisphosphate carboxylase/oxygena 95.68
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 95.49
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 95.49
cd08206414 RuBisCO_large_I_II_III Ribulose bisphosphate carbo 95.44
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 95.4
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 95.38
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 95.35
cd08208424 RLP_Photo Ribulose bisphosphate carboxylase like p 95.34
PRK08227264 autoinducer 2 aldolase; Validated 95.25
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 95.23
cd08213412 RuBisCO_large_III Ribulose bisphosphate carboxylas 95.16
cd08207406 RLP_NonPhot Ribulose bisphosphate carboxylase like 95.11
PRK04208468 rbcL ribulose bisophosphate carboxylase; Reviewed 95.05
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 94.98
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 94.96
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 94.81
cd08148366 RuBisCO_large Ribulose bisphosphate carboxylase la 94.78
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 94.77
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 94.76
PRK06852304 aldolase; Validated 94.58
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 94.58
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 94.56
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 94.51
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 94.48
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 94.46
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 94.43
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 94.35
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 94.35
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 94.32
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 94.29
PLN02746347 hydroxymethylglutaryl-CoA lyase 94.27
PF00016309 RuBisCO_large: Ribulose bisphosphate carboxylase l 94.18
cd08209391 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopent 94.14
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 94.05
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 94.05
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 93.94
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 93.92
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 93.91
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 93.9
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 93.82
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 93.8
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 93.79
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 93.74
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.66
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 93.66
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 93.62
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 93.61
cd08212450 RuBisCO_large_I Ribulose bisphosphate carboxylase 93.6
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 93.58
COG3142241 CutC Uncharacterized protein involved in copper re 93.58
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 93.52
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 93.51
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 93.47
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 93.45
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 93.45
PRK01008372 queuine tRNA-ribosyltransferase; Provisional 93.44
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 93.37
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 93.31
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 93.3
TIGR00677281 fadh2_euk methylenetetrahydrofolate reductase, euk 93.26
cd03307326 Mta_CmuA_like MtaA_CmuA_like family. MtaA/CmuA, al 93.25
PRK09549407 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate eno 93.21
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 93.12
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 93.1
PLN02535364 glycolate oxidase 93.02
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 92.98
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 92.86
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 92.84
TIGR03332407 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosp 92.82
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 92.81
PLN02424332 ketopantoate hydroxymethyltransferase 92.79
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 92.78
TIGR00676272 fadh2 5,10-methylenetetrahydrofolate reductase, pr 92.75
cd02812219 PcrB_like PcrB_like proteins. One member of this f 92.74
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 92.68
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 92.64
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 92.62
PRK14024241 phosphoribosyl isomerase A; Provisional 92.62
cd08211439 RuBisCO_large_II Ribulose bisphosphate carboxylase 92.61
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 92.56
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 92.48
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 92.48
PLN02979366 glycolate oxidase 92.35
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 92.28
PRK00208250 thiG thiazole synthase; Reviewed 92.27
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 92.19
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 92.18
PLN02591250 tryptophan synthase 92.17
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 92.16
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 92.12
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 92.12
PRK11197381 lldD L-lactate dehydrogenase; Provisional 92.12
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 92.08
PRK13753279 dihydropteroate synthase; Provisional 92.01
PLN02433345 uroporphyrinogen decarboxylase 91.93
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 91.93
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 91.89
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 91.77
PLN02433345 uroporphyrinogen decarboxylase 91.64
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 91.46
PLN02591250 tryptophan synthase 91.46
PRK09432296 metF 5,10-methylenetetrahydrofolate reductase; Pro 91.43
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 91.29
PLN02428349 lipoic acid synthase 91.28
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 91.26
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 91.22
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 91.22
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 91.2
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 91.13
PLN02826409 dihydroorotate dehydrogenase 91.04
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 91.02
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 90.93
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 90.88
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 90.87
PF00682237 HMGL-like: HMGL-like of this family is not conserv 90.84
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 90.71
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 90.64
PTZ00413398 lipoate synthase; Provisional 90.57
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 90.56
cd03307326 Mta_CmuA_like MtaA_CmuA_like family. MtaA/CmuA, al 90.53
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 90.5
CHL00162267 thiG thiamin biosynthesis protein G; Validated 90.45
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 90.45
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 90.42
PRK08999312 hypothetical protein; Provisional 90.41
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 90.41
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 90.35
PRK13523337 NADPH dehydrogenase NamA; Provisional 90.3
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 90.3
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 90.28
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 90.24
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 90.22
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 90.2
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 90.19
PRK07226267 fructose-bisphosphate aldolase; Provisional 90.17
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 90.17
PF01702238 TGT: Queuine tRNA-ribosyltransferase; InterPro: IP 90.14
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 90.13
PRK07226267 fructose-bisphosphate aldolase; Provisional 90.1
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 90.08
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 90.06
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 90.01
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 89.94
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 89.92
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 89.73
PF00682237 HMGL-like: HMGL-like of this family is not conserv 89.7
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 89.68
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 89.64
PRK12330499 oxaloacetate decarboxylase; Provisional 89.61
COG1609333 PurR Transcriptional regulators [Transcription] 89.46
PRK06806281 fructose-bisphosphate aldolase; Provisional 89.45
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 89.43
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 89.42
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 89.31
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 89.27
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 89.27
cd00537274 MTHFR Methylenetetrahydrofolate reductase (MTHFR). 89.24
PRK14041467 oxaloacetate decarboxylase; Provisional 89.15
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 89.13
COG1850429 RbcL Ribulose 1,5-bisphosphate carboxylase, large 89.09
PRK09389 488 (R)-citramalate synthase; Provisional 89.03
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 89.02
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 88.99
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 88.99
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 88.99
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 88.98
PRK00112366 tgt queuine tRNA-ribosyltransferase; Provisional 88.93
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 88.9
PRK06252339 methylcobalamin:coenzyme M methyltransferase; Vali 88.9
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 88.89
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 88.85
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 88.82
PLN02424332 ketopantoate hydroxymethyltransferase 88.74
PRK08645612 bifunctional homocysteine S-methyltransferase/5,10 88.74
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 88.73
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 88.59
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 88.58
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 88.48
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 88.44
PLN02489335 homocysteine S-methyltransferase 88.43
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 88.36
PRK08185283 hypothetical protein; Provisional 88.36
PRK00915 513 2-isopropylmalate synthase; Validated 88.35
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 88.31
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 88.26
cd00019279 AP2Ec AP endonuclease family 2; These endonuclease 88.21
PRK12331448 oxaloacetate decarboxylase; Provisional 88.18
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 88.06
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 88.01
PRK00115346 hemE uroporphyrinogen decarboxylase; Validated 87.96
COG0413268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 87.96
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 87.9
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, inc 87.89
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 87.88
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 87.87
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 87.86
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 87.82
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 87.78
cd01295 422 AdeC Adenine deaminase (AdeC) directly deaminates 87.7
PLN02321 632 2-isopropylmalate synthase 87.59
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 87.51
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 87.45
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 87.36
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 87.33
PRK11572248 copper homeostasis protein CutC; Provisional 87.3
COG0826347 Collagenase and related proteases [Posttranslation 87.21
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 87.2
PF13407257 Peripla_BP_4: Periplasmic binding protein domain; 87.17
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 87.07
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 87.02
PLN02321 632 2-isopropylmalate synthase 87.01
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 86.98
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 86.93
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 86.9
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 86.84
COG2159293 Predicted metal-dependent hydrolase of the TIM-bar 86.8
PLN03228 503 methylthioalkylmalate synthase; Provisional 86.8
PRK07094323 biotin synthase; Provisional 86.75
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 86.73
PF07302221 AroM: AroM protein; InterPro: IPR010843 This famil 86.68
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 86.65
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 86.63
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 86.6
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 86.54
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 86.37
PRK07028430 bifunctional hexulose-6-phosphate synthase/ribonuc 86.35
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 86.25
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 86.22
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 86.16
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 86.15
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 86.08
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 86.04
PLN02746347 hydroxymethylglutaryl-CoA lyase 85.98
PLN02979366 glycolate oxidase 85.98
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 85.95
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 85.95
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 85.8
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 85.74
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 85.64
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 85.62
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 85.61
PRK14042 596 pyruvate carboxylase subunit B; Provisional 85.57
PRK09490 1229 metH B12-dependent methionine synthase; Provisiona 85.49
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 85.4
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 85.28
TIGR03822321 AblA_like_2 lysine-2,3-aminomutase-related protein 85.15
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 85.12
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 84.82
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 84.68
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 84.6
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 84.6
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 84.53
TIGR00430368 Q_tRNA_tgt tRNA-guanine transglycosylase, queuosin 84.39
COG5016472 Pyruvate/oxaloacetate carboxyltransferase [Energy 84.31
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 84.29
PRK10481224 hypothetical protein; Provisional 84.22
PRK14040 593 oxaloacetate decarboxylase; Provisional 84.22
TIGR00973494 leuA_bact 2-isopropylmalate synthase, bacterial ty 84.19
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 84.11
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 84.05
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 83.96
PRK12331 448 oxaloacetate decarboxylase; Provisional 83.85
COG1908132 FrhD Coenzyme F420-reducing hydrogenase, delta sub 83.8
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 83.78
PLN03228503 methylthioalkylmalate synthase; Provisional 83.77
TIGR00587274 nfo apurinic endonuclease (APN1). All proteins in 83.76
PRK10605362 N-ethylmaleimide reductase; Provisional 83.76
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 83.72
TIGR00449367 tgt_general tRNA-guanine transglycosylases, variou 83.6
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcripti 83.58
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 83.55
COG4981 717 Enoyl reductase domain of yeast-type FAS1 [Lipid m 83.54
PLN02535364 glycolate oxidase 83.5
TIGR02082 1178 metH 5-methyltetrahydrofolate--homocysteine methyl 83.5
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 83.46
PRK04302223 triosephosphate isomerase; Provisional 83.42
COG0646311 MetH Methionine synthase I (cobalamin-dependent), 83.37
PRK10528191 multifunctional acyl-CoA thioesterase I and protea 83.24
PRK06252339 methylcobalamin:coenzyme M methyltransferase; Vali 83.21
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 83.2
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 83.15
PRK08446350 coproporphyrinogen III oxidase; Provisional 83.04
cd03465330 URO-D_like The URO-D _like protein superfamily inc 82.92
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 82.89
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 82.82
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 82.78
PRK00915513 2-isopropylmalate synthase; Validated 82.69
PRK01060281 endonuclease IV; Provisional 82.66
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 82.64
PRK11572248 copper homeostasis protein CutC; Provisional 82.6
PRK08227264 autoinducer 2 aldolase; Validated 82.57
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 82.44
PRK09282 592 pyruvate carboxylase subunit B; Validated 82.43
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 82.41
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 82.4
cd00717335 URO-D Uroporphyrinogen decarboxylase (URO-D) is a 82.39
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 82.37
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 82.33
PLN02540 565 methylenetetrahydrofolate reductase 82.27
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 82.25
PRK09389488 (R)-citramalate synthase; Provisional 82.22
PRK09250348 fructose-bisphosphate aldolase; Provisional 82.19
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 82.16
cd00717335 URO-D Uroporphyrinogen decarboxylase (URO-D) is a 82.09
PRK05660378 HemN family oxidoreductase; Provisional 81.97
PRK12677384 xylose isomerase; Provisional 81.95
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 81.82
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 81.67
TIGR02637302 RhaS rhamnose ABC transporter, rhamnose-binding pr 81.47
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 81.39
TIGR00977526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 81.36
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 81.33
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 81.3
smart00518273 AP2Ec AP endonuclease family 2. These endonuclease 81.3
TIGR01496257 DHPS dihydropteroate synthase. This model represen 81.2
PF02219287 MTHFR: Methylenetetrahydrofolate reductase; InterP 81.13
PRK12581468 oxaloacetate decarboxylase; Provisional 81.13
PRK02412253 aroD 3-dehydroquinate dehydratase; Provisional 81.09
PRK09875292 putative hydrolase; Provisional 80.6
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 80.58
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 80.51
PRK09492315 treR trehalose repressor; Provisional 80.5
TIGR00510302 lipA lipoate synthase. The family shows strong seq 80.44
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 80.43
TIGR03821321 AblA_like_1 lysine-2,3-aminomutase-related protein 80.39
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 80.38
PRK15452 443 putative protease; Provisional 80.34
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 80.28
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 80.19
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information 
Probab=100.00  E-value=8.2e-67  Score=497.22  Aligned_cols=279  Identities=82%  Similarity=1.343  Sum_probs=264.2

Q ss_pred             ccCceeEeeecccCCCCCCCHHHHHHHHHHHHHCCCCEEEEccCcccccCCCHHHHHHHHHHHHHHhCCCcEEEEecCCC
Q 018443           55 KALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSN  134 (356)
Q Consensus        55 ~~~Gvi~al~TPf~~dg~ID~~~l~~~v~~li~~Gv~Gl~v~GstGE~~~Lt~eEr~~li~~~~~~~~grvpVi~gvg~~  134 (356)
                      |..|++++++|||++||+||+++++++++|+++.|++||+++|||||+++||.+||+++++.+++++++|+|||+||+++
T Consensus         1 ~~~Gv~~a~~TPf~~~g~iD~~~~~~~i~~l~~~Gv~Gi~~~GstGE~~~ls~~Er~~~~~~~~~~~~~~~pvi~gv~~~   80 (280)
T PLN02417          1 KKLRLITAIKTPYLPDGRFDLEAYDSLVNMQIENGAEGLIVGGTTGEGQLMSWDEHIMLIGHTVNCFGGKIKVIGNTGSN   80 (280)
T ss_pred             CCCceeeeeeCCcCCCCCcCHHHHHHHHHHHHHcCCCEEEECccCcchhhCCHHHHHHHHHHHHHHhCCCCcEEEECCCc
Confidence            35899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHcCCCEEEEcCCCCCCCCHHHHHHHHHHHHhcCCeEEEeCCCCCCCCCCHHHHHHHhcCCCEEEEee
Q 018443          135 STREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKE  214 (356)
Q Consensus       135 st~~ai~lar~a~~~Gadavlv~pP~y~~~s~~~l~~y~~~va~~~PiilYn~P~~tG~~ls~~~l~~La~~pnivGiK~  214 (356)
                      +|+++++++++|+++|||++|++||||++++++++++||++|+++.|+++||+|++||++++++++++|+++|||+|||+
T Consensus        81 ~t~~~i~~a~~a~~~Gadav~~~~P~y~~~~~~~i~~~f~~va~~~pi~lYn~P~~tg~~l~~~~l~~l~~~pni~giKd  160 (280)
T PLN02417         81 STREAIHATEQGFAVGMHAALHINPYYGKTSQEGLIKHFETVLDMGPTIIYNVPGRTGQDIPPEVIFKIAQHPNFAGVKE  160 (280)
T ss_pred             cHHHHHHHHHHHHHcCCCEEEEcCCccCCCCHHHHHHHHHHHHhhCCEEEEEChhHhCcCCCHHHHHHHhcCCCEEEEEe
Confidence            99999999999999999999999999999999999999999998779999999999999999999999999999999999


Q ss_pred             cCchhhHhhhhCCCeEEEecCcchhHhHHHHcCCceeecccccccHHHHHHHHHcCCcHHHHHHHHHHHHHHhcCCChHH
Q 018443          215 CVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIP  294 (356)
Q Consensus       215 s~~d~~i~~~~~~~~~v~~G~d~~~l~~~l~~Ga~G~is~~~n~~P~~~~~l~~ag~a~~l~~~l~~l~~~~~~~~~~~~  294 (356)
                      +++|.++.+...++|.||+|.|+.++...+..|++|++++++|++|+.++++|+++++.++|+++.+++++++..+++..
T Consensus       161 ss~~~~~~~~~~~~~~v~~G~d~~~~~~~l~~Ga~G~is~~~n~~P~~~~~l~~a~~~~~l~~~l~~l~~~~~~~~~~~~  240 (280)
T PLN02417        161 CTGNDRVKQYTEKGILLWSGNDDECHDARWDYGADGVISVTSNLVPGLMHKLMFAGKNKELNDKLLPLMDWLFCEPNPIG  240 (280)
T ss_pred             CCCcHHHHHHhcCCeEEEEcccHHhhHHHHhCCCCEEEecHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCcHH
Confidence            99985555555679999999999888754788999999999999999999999998778899999999998777777778


Q ss_pred             HHHHHHHcCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCc
Q 018443          295 LNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGR  333 (356)
Q Consensus       295 ~K~al~~~G~~~g~~R~Pl~~l~~~~~~~l~~~l~~~gl  333 (356)
                      +|++|+++|++.+.+|+|+.+++++++++|+++++++++
T Consensus       241 ~K~al~~~G~~~g~~R~Pl~~l~~~~~~~l~~~l~~~~~  279 (280)
T PLN02417        241 LNTALAQLGLIRPVFRLPYVPLDLAKRAEFVALVKAIGR  279 (280)
T ss_pred             HHHHHHHcCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCC
Confidence            999999999988888999999999999999999999875

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PF06187 DUF993: Protein of unknown function (DUF993); InterPro: IPR009334 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK15063 isocitrate lyase; Provisional Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>CHL00040 rbcL ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd08206 RuBisCO_large_I_II_III Ribulose bisphosphate carboxylase large chain, Form I,II,III Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd08208 RLP_Photo Ribulose bisphosphate carboxylase like proteins from phototrophic bacteria Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd08213 RuBisCO_large_III Ribulose bisphosphate carboxylase large chain, Form III Back     alignment and domain information
>cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria Back     alignment and domain information
>PRK04208 rbcL ribulose bisophosphate carboxylase; Reviewed Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>cd08148 RuBisCO_large Ribulose bisphosphate carboxylase large chain Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PF00016 RuBisCO_large: Ribulose bisphosphate carboxylase large chain, catalytic domain; InterPro: IPR000685 Ribulose bisphosphate carboxylase (RuBisCO) [, ] catalyses the initial step in Calvin's reductive pentose phosphate cycle in plants as well as purple and green bacteria Back     alignment and domain information
>cd08209 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd08212 RuBisCO_large_I Ribulose bisphosphate carboxylase large chain, Form I Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK01008 queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>TIGR00677 fadh2_euk methylenetetrahydrofolate reductase, eukaryotic type Back     alignment and domain information
>cd03307 Mta_CmuA_like MtaA_CmuA_like family Back     alignment and domain information
>PRK09549 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; Reviewed Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>TIGR03332 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase, prokaryotic form Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>cd08211 RuBisCO_large_II Ribulose bisphosphate carboxylase large chain, Form II Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>PLN02433 uroporphyrinogen decarboxylase Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PLN02433 uroporphyrinogen decarboxylase Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK09432 metF 5,10-methylenetetrahydrofolate reductase; Provisional Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd03307 Mta_CmuA_like MtaA_CmuA_like family Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PF01702 TGT: Queuine tRNA-ribosyltransferase; InterPro: IPR002616 This is a family of queuine, archaeosine and general tRNA-ribosyltransferases 2 Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd00537 MTHFR Methylenetetrahydrofolate reductase (MTHFR) Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>COG1850 RbcL Ribulose 1,5-bisphosphate carboxylase, large subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00112 tgt queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK06252 methylcobalamin:coenzyme M methyltransferase; Validated Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02489 homocysteine S-methyltransferase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK00115 hemE uroporphyrinogen decarboxylase; Validated Back     alignment and domain information
>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>TIGR00430 Q_tRNA_tgt tRNA-guanine transglycosylase, queuosine-34-forming Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PRK10481 hypothetical protein; Provisional Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>TIGR00587 nfo apurinic endonuclease (APN1) Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>TIGR00449 tgt_general tRNA-guanine transglycosylases, various specificities Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG4981 Enoyl reductase domain of yeast-type FAS1 [Lipid metabolism] Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional Back     alignment and domain information
>PRK06252 methylcobalamin:coenzyme M methyltransferase; Validated Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd03465 URO-D_like The URO-D _like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd00717 URO-D Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PLN02540 methylenetetrahydrofolate reductase Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>cd00717 URO-D Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>PRK12677 xylose isomerase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR02637 RhaS rhamnose ABC transporter, rhamnose-binding protein Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>smart00518 AP2Ec AP endonuclease family 2 Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>PF02219 MTHFR: Methylenetetrahydrofolate reductase; InterPro: IPR003171 This family includes the 5,10-methylenetetrahydrofolate reductase 1 Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>TIGR00510 lipA lipoate synthase Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
4dpp_A360 The Structure Of Dihydrodipicolinate Synthase 2 Fro 1e-166
3tuu_A346 Structure Of Dihydrodipicolinate Synthase From The 1e-164
3pud_A291 Crystal Structure Of Dhydrodipicolinate Synthase Fr 7e-40
3pb2_A300 Characterisation Of The First Monomeric Dihydrodipi 2e-38
3pb0_A300 Characterisation Of The First Monomeric Dihydrodipi 3e-38
1o5k_A306 Crystal Structure Of Dihydrodipicolinate Synthase ( 1e-37
3qze_A314 Crystal Structure Of Dapa (Pa1010) At 1.6 A Resolut 3e-37
2yxg_A289 Crystal Structure Of Dihyrodipicolinate Synthase (D 1e-35
2ojp_A292 The Crystal Structure Of A Dimeric Mutant Of Dihydr 1e-35
1dhp_A292 Dihydrodipicolinate Synthase Length = 292 1e-35
3noe_A292 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-35
3i7q_A292 Dihydrodipicolinate Synthase Mutant - K161a Length 3e-35
2ehh_A294 Crystal Structure Of Dihydrodipicolinate Synthase F 3e-35
1s5w_A292 Crystal Structure Analysis Of A Mutant Of Dihydrodi 3e-35
1s5v_A292 Crystal Structure Analysis Of A Mutant Of Dihydrodi 3e-35
1xky_A301 Crystal Structure Of Dihydrodipicolinate Synthase D 5e-35
1s5t_A292 Crystal Structure Analysis Of A Mutant Of Dihydrodi 5e-35
3c0j_A292 Structure Of E. Coli Dihydrodipicolinate Synthase C 6e-35
2a6l_A292 Dihydrodipicolinate Synthase (E. Coli)- Mutant R138 8e-35
2a6n_A292 Dihydrodipicolinate Synthase (E. Coli)- Mutant R138 9e-35
3g0s_A316 Dihydrodipicolinate Synthase From Salmonella Typhim 1e-34
2pur_A292 Structure Of Dihydrodipicolinate Synthase Mutant Th 2e-34
3hij_A292 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-34
3flu_A297 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-34
3den_A292 Structure Of E. Coli Dhdps Mutant Y107w Length = 29 3e-34
3h5d_A311 Dihydrodipicolinate Synthase From Drug-Resistant St 3e-34
3ird_A291 Structure Of Dihydrodipicolinate Synthase From Clos 3e-33
3daq_A292 Crystal Structure Of Dihydrodipicolinate Synthase F 5e-33
3a5f_A291 High-Resolution Structure Of Dhdps From Clostridium 1e-32
3di0_A295 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-32
2rfg_A297 Crystal Structure Of Dihydrodipicolinate Synthase F 6e-31
3m5v_A301 Crystal Structure Of Dihydrodipicolinate Synthase F 1e-30
3ler_A301 Crystal Structure Of Dihydrodipicolinate Synthase F 5e-30
2vc6_A292 Structure Of Mosa From S. Meliloti With Pyruvate Bo 1e-29
3si9_A315 Crystal Structure Of Dihydrodipicolinate Synthase F 5e-26
1xxx_A303 Crystal Structure Of Dihydrodipicolinate Synthase ( 9e-26
3l21_A304 The Crystal Structure Of A Dimeric Mutant Of Dihydr 3e-25
3cpr_A304 The Crystal Structure Of Corynebacterium Glutamicum 3e-18
2v8z_A343 Crystal Structure Of Yage, A Prophage Protein Belon 1e-16
3nev_A298 Crystal Structure Of Yage, A Prophage Protein From 1e-16
1hl2_A297 Crystal Structure Of N-Acetylneuraminate Lyase From 2e-16
2v9d_A343 Crystal Structure Of Yage, A Prophage Protein Belon 2e-16
3n2x_A298 Crystal Structure Of Yage, A Prophage Protein Belon 7e-16
3lch_A319 The D-Sialic Acid Aldolase Mutant V251r Length = 31 1e-15
3lcw_A319 L-Kdo Aldolase Complexed With Hydroxypyruvate Lengt 1e-15
2wo5_A304 Structure Of Wild Type E. Coli N-Acetylneuraminic A 2e-15
1nal_1297 The Three-Dimensional Structure Of N-Acetylneuramin 2e-15
2wnq_A304 Structure Of The E192n Mutant Of E. Coli N-Acetylne 2e-15
3lcg_A319 The D-Sialic Acid Aldolase Mutant V251l Length = 31 2e-15
3lbc_A319 D-Sialic Acid Aldolase Complexed With L-Arabinose L 2e-15
3lcf_A319 The D-Sialic Acid Aldolase Mutant V251i Length = 31 2e-15
3lci_A319 The D-Sialic Acid Aldolase Mutant V251w Length = 31 3e-15
3lcl_A319 The D-Sialic Acid Aldolase Mutant V251iV265I Length 3e-15
1fdz_A297 N-Acetylneuraminate Lyase In Complex With Pyruvate 5e-15
2wnn_A303 Structure Of Wild Type E. Coli N-Acetylneuraminic A 8e-15
2wkj_A303 Crystal Structure Of The E192n Mutant Of E.Coli N-A 1e-14
2wnz_A304 Structure Of The E192n Mutant Of E. Coli N-Acetylne 1e-14
3s5n_A304 Crystal Structure Of Human 4-Hydroxy-2-Oxoglutarate 6e-12
2pcq_A283 Crystal Structure Of Putative Dihydrodipicolinate S 1e-11
3s5o_A307 Crystal Structure Of Human 4-Hydroxy-2-Oxoglutarate 3e-11
3qfe_A318 Crystal Structures Of A Putative Dihydrodipicolinat 1e-09
3na8_A315 Crystal Structure Of A Putative Dihydrodipicolinate 2e-09
2nuw_A288 2-Keto-3-Deoxygluconate Aldolase From Sulfolobus Ac 4e-09
3b4u_A294 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-08
1w37_A294 2-Keto-3-Deoxygluconate(Kdg) Aldolase Of Sulfolobus 2e-08
1w3i_A293 Sulfolobus Solfataricus 2-Keto-3-Deoxygluconate (Kd 2e-08
1f6p_A293 Crystal Structure Analysis Of N-Acetylneuraminate L 3e-08
2yda_A294 Sulfolobus Sulfataricus 2-Keto-3-Deoxygluconate Ald 5e-08
2r91_A286 Crystal Structure Of Kd(P)ga From T.Tenax Length = 3e-07
4ahp_A298 Crystal Structure Of Wild Type N-acetylneuraminic A 5e-07
4aho_A299 Crystal Structure Of N-acetylneuraminic Acid Lyase 3e-06
4ah7_A298 Structure Of Wild Type Stapylococcus Aureus N-acety 3e-06
4ahq_A298 Crystal Structure Of N-acetylneuraminic Acid Lyase 6e-06
3e96_A316 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-04
>pdb|4DPP|A Chain A, The Structure Of Dihydrodipicolinate Synthase 2 From Arabidopsis Thaliana Length = 360 Back     alignment and structure 
Iteration: 1

 Score =  580 bits (1495), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 273/330 (82%), Positives = 301/330 (91%)
Query: 27  PPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYDDLVNMQI 86
           P  AA++PN+HLPMRS EVKNRT+ +DIKALR+ITAIKTPYLPDGRFDLEAYDDLVN+QI
Sbjct: 31  PFTAAVVPNFHLPMRSLEVKNRTNTDDIKALRVITAIKTPYLPDGRFDLEAYDDLVNIQI 90
Query: 87  VNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQG 146
            NGAEG+IVGGTTGEGQLMSWDEHIMLIGHTVNCFG S+KVIGNTGSNSTREAIHATEQG
Sbjct: 91  QNGAEGVIVGGTTGEGQLMSWDEHIMLIGHTVNCFGGSIKVIGNTGSNSTREAIHATEQG 150
Query: 147 FAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIPPRVIHTMAQS 206
           FAVGMHAALHINPYYGKTS+EGLI+HF SVL MGPTIIYNVP RTGQDIPPR I  ++Q+
Sbjct: 151 FAVGMHAALHINPYYGKTSIEGLIAHFQSVLHMGPTIIYNVPGRTGQDIPPRAIFKLSQN 210
Query: 207 PNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMREL 266
           PNLAGVKECVGN RVE YT NG+VVWSGNDD+CHD+RW++GATGVISVTSNLVPG+MR+L
Sbjct: 211 PNLAGVKECVGNKRVEEYTENGVVVWSGNDDECHDSRWDYGATGVISVTSNLVPGLMRKL 270
Query: 267 MFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVN 326
           MF G+N SLN+KL PL+ WLF EPNPI +NTALAQLGV RPVFRLPYVPLP  KR EFV 
Sbjct: 271 MFEGRNSSLNSKLLPLMAWLFHEPNPIGINTALAQLGVSRPVFRLPYVPLPLSKRLEFVK 330
Query: 327 LVNQIGRENFVGEKDVQVLDDDDFILVDRY 356
           LV +IGRE+FVGEKDVQ LDDDDFIL+ RY
Sbjct: 331 LVKEIGREHFVGEKDVQALDDDDFILIGRY 360
>pdb|3TUU|A Chain A, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine Length = 346 Back     alignment and structure
>pdb|3PUD|A Chain A, Crystal Structure Of Dhydrodipicolinate Synthase From Acinetobacter Baumannii At 2.8a Resolution Length = 291 Back     alignment and structure
>pdb|3PB2|A Chain A, Characterisation Of The First Monomeric Dihydrodipicolinate Synthase Variant Reveals Evolutionary Insights Length = 300 Back     alignment and structure
>pdb|3PB0|A Chain A, Characterisation Of The First Monomeric Dihydrodipicolinate Synthase Variant Reveals Evolutionary Insights Length = 300 Back     alignment and structure
>pdb|1O5K|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase (Tm1521) From Thermotoga Maritima At 1.80 A Resolution Length = 306 Back     alignment and structure
>pdb|3QZE|A Chain A, Crystal Structure Of Dapa (Pa1010) At 1.6 A Resolution Length = 314 Back     alignment and structure
>pdb|2YXG|A Chain A, Crystal Structure Of Dihyrodipicolinate Synthase (Dapa) Length = 289 Back     alignment and structure
>pdb|2OJP|A Chain A, The Crystal Structure Of A Dimeric Mutant Of Dihydrodipicolinate Synthase From E.Coli- Dhdps-L197y Length = 292 Back     alignment and structure
>pdb|1DHP|A Chain A, Dihydrodipicolinate Synthase Length = 292 Back     alignment and structure
>pdb|3NOE|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Pseudomonas Aeruginosa Length = 292 Back     alignment and structure
>pdb|3I7Q|A Chain A, Dihydrodipicolinate Synthase Mutant - K161a Length = 292 Back     alignment and structure
>pdb|2EHH|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Aquifex Aeolicus Length = 294 Back     alignment and structure
>pdb|1S5W|A Chain A, Crystal Structure Analysis Of A Mutant Of Dihydrodipicolinate Synthase--Residue Tyr133 To Phe133 Length = 292 Back     alignment and structure
>pdb|1S5V|A Chain A, Crystal Structure Analysis Of A Mutant Of Dihydrodipicolinate Synthase--Residue Tyr107 To Phe107 Length = 292 Back     alignment and structure
>pdb|1XKY|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase Dapa-2 (Ba3935) From Bacillus Anthracis At 1.94a Resolution. Length = 301 Back     alignment and structure
>pdb|1S5T|A Chain A, Crystal Structure Analysis Of A Mutant Of Dihydrodipicolinate Synthase--Residue Thr44 To Val44 Length = 292 Back     alignment and structure
>pdb|3C0J|A Chain A, Structure Of E. Coli Dihydrodipicolinate Synthase Complexed With Hydroxypyruvate Length = 292 Back     alignment and structure
>pdb|2A6L|A Chain A, Dihydrodipicolinate Synthase (E. Coli)- Mutant R138h Length = 292 Back     alignment and structure
>pdb|2A6N|A Chain A, Dihydrodipicolinate Synthase (E. Coli)- Mutant R138a Length = 292 Back     alignment and structure
>pdb|3G0S|A Chain A, Dihydrodipicolinate Synthase From Salmonella Typhimurium Lt2 Length = 316 Back     alignment and structure
>pdb|2PUR|A Chain A, Structure Of Dihydrodipicolinate Synthase Mutant Thr44ser At 1.7 A. Length = 292 Back     alignment and structure
>pdb|3HIJ|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Bacillus Anthracis In Complex With Its Substrate, Pyruvate Length = 292 Back     alignment and structure
>pdb|3FLU|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From The Pathogen Neisseria Meningitidis Length = 297 Back     alignment and structure
>pdb|3DEN|A Chain A, Structure Of E. Coli Dhdps Mutant Y107w Length = 292 Back     alignment and structure
>pdb|3H5D|A Chain A, Dihydrodipicolinate Synthase From Drug-Resistant Streptococc Pneumoniae Length = 311 Back     alignment and structure
>pdb|3IRD|A Chain A, Structure Of Dihydrodipicolinate Synthase From Clostridium Botulinum Length = 291 Back     alignment and structure
>pdb|3DAQ|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Methicillin- Resistant Staphylococcus Aureus Length = 292 Back     alignment and structure
>pdb|3A5F|A Chain A, High-Resolution Structure Of Dhdps From Clostridium Botulinum In Complex With Pyruvate Length = 291 Back     alignment and structure
>pdb|3DI0|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Staphylococcus Aureus Length = 295 Back     alignment and structure
>pdb|2RFG|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Hahella Chejuensis At 1.5a Resolution Length = 297 Back     alignment and structure
>pdb|3M5V|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Campylobacter Jejuni Length = 301 Back     alignment and structure
>pdb|3LER|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Campylobacter Jejuni Subsp. Jejuni Nctc 11168 Length = 301 Back     alignment and structure
>pdb|2VC6|A Chain A, Structure Of Mosa From S. Meliloti With Pyruvate Bound Length = 292 Back     alignment and structure
>pdb|3SI9|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Bartonella Henselae Length = 315 Back     alignment and structure
>pdb|1XXX|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase (Dapa, Rv2753c) From Mycobacterium Tuberculosis Length = 303 Back     alignment and structure
>pdb|3L21|A Chain A, The Crystal Structure Of A Dimeric Mutant Of Dihydrodipicolinate Synthase (Dapa, Rv2753c) From Mycobacterium Tuberculosis - Dhdps- A204r Length = 304 Back     alignment and structure
>pdb|3CPR|A Chain A, The Crystal Structure Of Corynebacterium Glutamicum Dihydrodipicolinate Synthase To 2.2 A Resolution Length = 304 Back     alignment and structure
>pdb|2V8Z|A Chain A, Crystal Structure Of Yage, A Prophage Protein Belonging To The Dihydrodipicolinic Acid Synthase Family From E. Coli K12 Length = 343 Back     alignment and structure
>pdb|3NEV|A Chain A, Crystal Structure Of Yage, A Prophage Protein From E. Coli K12 In Complex With Kdgal Length = 298 Back     alignment and structure
>pdb|1HL2|A Chain A, Crystal Structure Of N-Acetylneuraminate Lyase From E. Coli Mutant L142r In Complex With B-Hydroxypyruvate Length = 297 Back     alignment and structure
>pdb|2V9D|A Chain A, Crystal Structure Of Yage, A Prophage Protein Belonging To The Dihydrodipicolinic Acid Synthase Family From E. Coli K12 Length = 343 Back     alignment and structure
>pdb|3N2X|A Chain A, Crystal Structure Of Yage, A Prophage Protein Belonging To The Dihydrodipicolinic Acid Synthase Family From E. Coli K12 In Complex With Pyruvate Length = 298 Back     alignment and structure
>pdb|3LCH|A Chain A, The D-Sialic Acid Aldolase Mutant V251r Length = 319 Back     alignment and structure
>pdb|3LCW|A Chain A, L-Kdo Aldolase Complexed With Hydroxypyruvate Length = 319 Back     alignment and structure
>pdb|2WO5|A Chain A, Structure Of Wild Type E. Coli N-Acetylneuraminic Acid Lyase In Space Group P21 Crystal Form I Length = 304 Back     alignment and structure
>pdb|1NAL|1 Chain 1, The Three-Dimensional Structure Of N-Acetylneuraminate Lyase From Escherichia Coli Length = 297 Back     alignment and structure
>pdb|2WNQ|A Chain A, Structure Of The E192n Mutant Of E. Coli N-Acetylneuraminic Acid Lyase In Space Group P21 Length = 304 Back     alignment and structure
>pdb|3LCG|A Chain A, The D-Sialic Acid Aldolase Mutant V251l Length = 319 Back     alignment and structure
>pdb|3LBC|A Chain A, D-Sialic Acid Aldolase Complexed With L-Arabinose Length = 319 Back     alignment and structure
>pdb|3LCF|A Chain A, The D-Sialic Acid Aldolase Mutant V251i Length = 319 Back     alignment and structure
>pdb|3LCI|A Chain A, The D-Sialic Acid Aldolase Mutant V251w Length = 319 Back     alignment and structure
>pdb|3LCL|A Chain A, The D-Sialic Acid Aldolase Mutant V251iV265I Length = 319 Back     alignment and structure
>pdb|1FDZ|A Chain A, N-Acetylneuraminate Lyase In Complex With Pyruvate Via Borohydride Reduction Length = 297 Back     alignment and structure
>pdb|2WNN|A Chain A, Structure Of Wild Type E. Coli N-Acetylneuraminic Acid Lyase In Complex With Pyruvate In Space Group P21 Length = 303 Back     alignment and structure
>pdb|2WKJ|A Chain A, Crystal Structure Of The E192n Mutant Of E.Coli N-Acetylneuraminic Acid Lyase In Complex With Pyruvate At 1.45a Resolution In Space Group P212121 Length = 303 Back     alignment and structure
>pdb|2WNZ|A Chain A, Structure Of The E192n Mutant Of E. Coli N-Acetylneuraminic Acid Lyase In Complex With Pyruvate In Space Group P21 Crystal Form I Length = 304 Back     alignment and structure
>pdb|3S5N|A Chain A, Crystal Structure Of Human 4-Hydroxy-2-Oxoglutarate Aldolase Length = 304 Back     alignment and structure
>pdb|2PCQ|A Chain A, Crystal Structure Of Putative Dihydrodipicolinate Synthase (Ttha0737) From Thermus Thermophilus Hb8 Length = 283 Back     alignment and structure
>pdb|3S5O|A Chain A, Crystal Structure Of Human 4-Hydroxy-2-Oxoglutarate Aldolase Bound To Pyruvate Length = 307 Back     alignment and structure
>pdb|3QFE|A Chain A, Crystal Structures Of A Putative Dihydrodipicolinate Synthase Family Protein From Coccidioides Immitis Length = 318 Back     alignment and structure
>pdb|3NA8|A Chain A, Crystal Structure Of A Putative Dihydrodipicolinate Synthetase From Pseudomonas Aeruginosa Length = 315 Back     alignment and structure
>pdb|2NUW|A Chain A, 2-Keto-3-Deoxygluconate Aldolase From Sulfolobus Acidocaldarius, Native Structure At 1.8 A Resolution Length = 288 Back     alignment and structure
>pdb|3B4U|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Agrobacterium Tumefaciens Str. C58 Length = 294 Back     alignment and structure
>pdb|1W37|A Chain A, 2-Keto-3-Deoxygluconate(Kdg) Aldolase Of Sulfolobus Solfataricus Length = 294 Back     alignment and structure
>pdb|1W3I|A Chain A, Sulfolobus Solfataricus 2-Keto-3-Deoxygluconate (Kdg) Aldolase Complex With Pyruvate Length = 293 Back     alignment and structure
>pdb|1F6P|A Chain A, Crystal Structure Analysis Of N-Acetylneuraminate Lyase From Haemophilus Influenzae: Crystal Form Iii Length = 293 Back     alignment and structure
>pdb|2YDA|A Chain A, Sulfolobus Sulfataricus 2-Keto-3-Deoxygluconate Aldolase Y103f,Y130f, A198f Variant Length = 294 Back     alignment and structure
>pdb|2R91|A Chain A, Crystal Structure Of Kd(P)ga From T.Tenax Length = 286 Back     alignment and structure
>pdb|4AHP|A Chain A, Crystal Structure Of Wild Type N-acetylneuraminic Acid Lyase From Staphylococcus Aureus Length = 298 Back     alignment and structure
>pdb|4AHO|A Chain A, Crystal Structure Of N-acetylneuraminic Acid Lyase From Staphylococcus Aureus With The Chemical Modification Thia-lysine At Position 165 Length = 299 Back     alignment and structure
>pdb|4AH7|A Chain A, Structure Of Wild Type Stapylococcus Aureus N-acetylneuraminic Acid Lyase In Complex With Pyruvate Length = 298 Back     alignment and structure
>pdb|4AHQ|A Chain A, Crystal Structure Of N-acetylneuraminic Acid Lyase Mutant K165c From Staphylococcus Aureus Length = 298 Back     alignment and structure
>pdb|3E96|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Bacillus Clausii Length = 316 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 1e-166
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 4e-87
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 2e-86
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 1e-84
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 2e-84
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 1e-83
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 3e-83
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 9e-83
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 1e-82
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 2e-82
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 5e-82
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 9e-82
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 1e-80
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 3e-80
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 5e-80
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 1e-79
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 5e-79
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 4e-78
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 4e-77
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 1e-76
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 2e-76
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 2e-75
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 1e-74
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 2e-74
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 2e-74
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 5e-74
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 1e-73
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 2e-73
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 3e-73
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 1e-71
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 2e-71
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 4e-71
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 2e-69
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 2e-67
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 8e-67
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 1e-62
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* Length = 360 Back     alignment and structure
 Score =  468 bits (1206), Expect = e-166
 Identities = 274/340 (80%), Positives = 305/340 (89%), Gaps = 3/340 (0%)

Query: 20  RKNRKWR---PPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLE 76
            +N  ++   P  AA++PN+HLPMRS EVKNRT+ +DIKALR+ITAIKTPYLPDGRFDLE
Sbjct: 21  TENLYFQGIDPFTAAVVPNFHLPMRSLEVKNRTNTDDIKALRVITAIKTPYLPDGRFDLE 80

Query: 77  AYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGSNST 136
           AYDDLVN+QI NGAEG+IVGGTTGEGQLMSWDEHIMLIGHTVNCFG S+KVIGNTGSNST
Sbjct: 81  AYDDLVNIQIQNGAEGVIVGGTTGEGQLMSWDEHIMLIGHTVNCFGGSIKVIGNTGSNST 140

Query: 137 REAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTIIYNVPSRTGQDIP 196
           REAIHATEQGFAVGMHAALHINPYYGKTS+EGLI+HF SVL MGPTIIYNVP RTGQDIP
Sbjct: 141 REAIHATEQGFAVGMHAALHINPYYGKTSIEGLIAHFQSVLHMGPTIIYNVPGRTGQDIP 200

Query: 197 PRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTS 256
           PR I  ++Q+PNLAGVKECVGN RVE YT NG+VVWSGNDD+CHD+RW++GATGVISVTS
Sbjct: 201 PRAIFKLSQNPNLAGVKECVGNKRVEEYTENGVVVWSGNDDECHDSRWDYGATGVISVTS 260

Query: 257 NLVPGMMRELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPL 316
           NLVPG+MR+LMF G+N SLN+KL PL+ WLF EPNPI +NTALAQLGV RPVFRLPYVPL
Sbjct: 261 NLVPGLMRKLMFEGRNSSLNSKLLPLMAWLFHEPNPIGINTALAQLGVSRPVFRLPYVPL 320

Query: 317 PQEKRAEFVNLVNQIGRENFVGEKDVQVLDDDDFILVDRY 356
           P  KR EFV LV +IGRE+FVGEKDVQ LDDDDFIL+ RY
Sbjct: 321 PLSKRLEFVKLVKEIGREHFVGEKDVQALDDDDFILIGRY 360
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Length = 301 Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Length = 311 Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Length = 293 Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Length = 291 Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Length = 314 Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} PDB: 3di1_A 3di0_A Length = 292 Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} Length = 297 Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} Length = 300 Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Length = 315 Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Length = 297 Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Length = 289 Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Length = 294 Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Length = 332 Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Length = 293 Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Length = 343 Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Length = 286 Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Length = 283 Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Length = 288 Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} PDB: 3ler_A* Length = 301 Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} PDB: 3s5n_A Length = 307 Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Length = 292 Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Length = 303 Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} PDB: 1xxx_A Length = 304 Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Length = 304 Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Length = 314 Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Length = 292 Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Length = 291 Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Length = 294 Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} Length = 316 Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Length = 344 Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Length = 306 Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} Length = 313 Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Length = 318 Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Length = 309 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 100.0
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 100.0
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 100.0
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 100.0
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 100.0
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 100.0
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 100.0
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 100.0
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 100.0
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 100.0
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 100.0
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 100.0
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 100.0
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 100.0
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 100.0
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 100.0
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 100.0
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 100.0
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 100.0
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 100.0
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 100.0
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 100.0
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 100.0
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 100.0
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 100.0
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 100.0
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 100.0
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 100.0
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 100.0
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 100.0
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 100.0
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 100.0
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 100.0
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 100.0
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 100.0
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 100.0
4dnh_A396 Uncharacterized protein; structural genomics, PSI- 98.02
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 97.67
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 97.6
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 97.54
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 97.51
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 97.49
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 97.36
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 97.32
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 97.26
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 97.21
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 97.11
3eol_A433 Isocitrate lyase; seattle structural center for in 97.11
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 96.9
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 96.89
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 96.87
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 96.71
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 96.62
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 96.49
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 96.21
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 95.72
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 95.71
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 95.64
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 95.63
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 95.62
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 95.5
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 95.48
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 95.4
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 95.24
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.23
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.02
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 94.71
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 94.69
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 94.66
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 94.66
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 94.64
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 94.48
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 94.39
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 94.35
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 94.31
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 94.29
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 94.29
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 94.18
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 94.17
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 94.1
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 94.07
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 94.04
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 93.86
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 93.66
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 93.59
3irs_A291 Uncharacterized protein BB4693; structural genomic 93.51
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 93.5
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 93.42
1ujp_A271 Tryptophan synthase alpha chain; riken structural 93.41
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 93.32
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 93.23
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 93.2
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 93.12
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 93.09
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 93.01
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 92.98
3apt_A310 Methylenetetrahydrofolate reductase; TIM barrel, o 92.95
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 92.9
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 92.9
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 92.87
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 92.86
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 92.8
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 92.67
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 92.66
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 92.46
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 92.4
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 92.39
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 92.34
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 92.34
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 92.32
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 92.14
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 92.11
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 92.11
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 92.09
3ble_A337 Citramalate synthase from leptospira interrogans; 91.95
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 91.86
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 91.82
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 91.76
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 91.72
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 91.72
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 91.7
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 91.68
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 91.61
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 91.59
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 91.57
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 91.57
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 91.51
3kdn_A444 Rubisco, ribulose bisphosphate carboxylase; ribulo 91.29
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 91.28
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 91.26
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 91.26
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 91.21
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 91.16
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 90.97
2hbv_A334 2-amino-3-carboxymuconate 6-semialdehyde decarbox; 90.94
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 90.92
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 90.92
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 90.8
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 90.76
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 90.46
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 90.38
1wdd_A477 Ribulose bisphosphate carboxylase large chain; rub 90.3
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 90.24
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 90.21
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 90.21
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 90.18
1bwv_A493 Rubisco, protein (ribulose bisphosphate carboxylas 89.9
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 89.89
2f6k_A307 Metal-dependent hydrolase; metal dependent hydroly 89.87
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 89.8
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 89.77
3nwr_A432 A rubisco-like protein; lyase; HET: KCX; 1.50A {Bu 89.72
4f0h_A493 Ribulose bisphosphate carboxylase large chain; alp 89.69
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 89.66
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 89.53
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 89.39
2dvt_A327 Thermophilic reversible gamma-resorcylate decarbo; 89.31
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 89.18
1u83_A276 Phosphosulfolactate synthase; structural genomics, 89.1
3tha_A252 Tryptophan synthase alpha chain; structural genomi 89.08
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 89.07
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 89.07
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 89.03
3qfw_A378 Ribulose-1,5-bisphosphate carboxylase/oxygenase L 89.02
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 88.97
2d69_A430 Ribulose bisphosphate carboxylase; alpha/beta barr 88.95
4ay7_A348 Methylcobalamin\: coenzyme M methyltransferase; TI 88.89
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 88.65
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 88.62
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 88.55
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 88.55
3oa3_A288 Aldolase; structural genomics, seattle structural 88.55
2oem_A413 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; 88.32
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 88.31
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 88.25
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 88.21
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 88.19
2wm1_A336 2-amino-3-carboxymuconate-6-semialdehyde decarboxy 88.02
2q02_A272 Putative cytoplasmic protein; structural genomics, 88.01
2zvi_A425 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; 87.98
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 87.93
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 87.69
3fk4_A414 Rubisco-like protein; structural genomics, target 87.65
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 87.61
3ij6_A312 Uncharacterized metal-dependent hydrolase; structu 87.61
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 87.61
1ykw_A435 Rubisco-like protein; beta-alpha-barrel, unknown f 87.57
2qyg_A452 Ribulose bisphosphate carboxylase-like protein 2; 87.55
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 87.52
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 87.5
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 87.42
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 87.42
3tha_A252 Tryptophan synthase alpha chain; structural genomi 87.4
3bld_A386 Queuine tRNA-ribosyltransferase; TGT, PREQ1, glyco 87.34
4exq_A368 UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid 87.34
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 87.28
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 87.24
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 87.22
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 87.17
2ash_A381 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guan 87.0
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 86.98
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 86.71
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 86.7
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 86.6
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 86.59
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 86.53
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 86.5
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 86.42
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 86.4
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 86.34
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 86.31
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 86.13
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 85.92
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 85.91
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 85.74
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 85.65
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 85.53
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 85.52
3vni_A294 Xylose isomerase domain protein TIM barrel; D-psic 85.35
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 85.18
3fst_A304 5,10-methylenetetrahydrofolate reductase; TIM barr 85.12
2qgy_A391 Enolase from the environmental genome shotgun sequ 85.05
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 85.02
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 85.0
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 84.84
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 84.76
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 84.76
2x7v_A287 Probable endonuclease 4; DNA repair protein, metal 84.74
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 84.53
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 84.48
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 84.41
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 84.35
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 84.25
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 84.23
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 84.1
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 84.07
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 84.0
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 83.98
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 83.9
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 83.85
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 83.81
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 83.67
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 83.63
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 83.61
4exq_A368 UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid 83.59
3ble_A337 Citramalate synthase from leptospira interrogans; 83.51
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 83.32
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 83.29
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 83.28
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 83.14
2oz8_A389 MLL7089 protein; structural genomics, unknown func 83.05
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 83.03
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 83.01
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 82.79
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 82.78
2eja_A338 URO-D, UPD, uroporphyrinogen decarboxylase; dimer, 82.73
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 82.72
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 82.7
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 82.46
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 82.4
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 82.37
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 82.36
1q7z_A 566 5-methyltetrahydrofolate S-homocysteine methyltran 82.35
2gl5_A410 Putative dehydratase protein; structural genomics, 82.31
1r3s_A367 URO-D, uroporphyrinogen decarboxylase, UPD; uropor 82.25
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 82.18
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 82.12
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 82.07
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 82.03
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 81.99
1qtw_A285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 81.99
1i60_A278 IOLI protein; beta barrel, structural genomics, PS 81.82
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 81.81
3lmz_A257 Putative sugar isomerase; structural genomics, joi 81.75
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 81.74
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 81.7
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 81.64
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 81.63
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 81.47
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 81.33
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 81.29
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 81.17
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 81.12
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 81.08
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 81.03
3k9c_A289 Transcriptional regulator, LACI family protein; PS 81.02
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 80.95
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 80.92
3gyb_A280 Transcriptional regulators (LACI-family transcript 80.89
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 80.79
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 80.7
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 80.64
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 80.48
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 80.23
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 80.2
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 80.1
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 80.03
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-86  Score=645.93  Aligned_cols=332  Identities=82%  Similarity=1.347  Sum_probs=299.1

Q ss_pred             CCCCcccccCCCCCCCCcchhcccCCccccccCceeEeeecccCCCCCCCHHHHHHHHHHHHHCCCCEEEEccCcccccC
Q 018443           25 WRPPQAAIIPNYHLPMRSFEVKNRTSAEDIKALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQL  104 (356)
Q Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Gvi~al~TPf~~dg~ID~~~l~~~v~~li~~Gv~Gl~v~GstGE~~~  104 (356)
                      -++|+||+++++|+||+|+++|++++++||++.|+++|++|||++||+||+++++++++|+++.|++|++++|||||+++
T Consensus        29 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Gi~~alvTPF~~dg~ID~~al~~lv~~li~~Gv~Gl~v~GTTGE~~~  108 (360)
T 4dpp_A           29 IDPFTAAVVPNFHLPMRSLEVKNRTNTDDIKALRVITAIKTPYLPDGRFDLEAYDDLVNIQIQNGAEGVIVGGTTGEGQL  108 (360)
T ss_dssp             -------------------------CHHHHHTCCEEEECCCCBCTTSSBCHHHHHHHHHHHHHTTCCEEEESSTTTTGGG
T ss_pred             cchhhhhhccccccccCCHhHhhccChhhcccCCeEEEEeCcCCCCCCcCHHHHHHHHHHHHHcCCCEEEecccccChhh
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHhCCCcEEEEecCCCCHHHHHHHHHHHHHcCCCEEEEcCCCCCCCCHHHHHHHHHHHHhcCCeEE
Q 018443          105 MSWDEHIMLIGHTVNCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSMGPTII  184 (356)
Q Consensus       105 Lt~eEr~~li~~~~~~~~grvpVi~gvg~~st~~ai~lar~a~~~Gadavlv~pP~y~~~s~~~l~~y~~~va~~~Piil  184 (356)
                      ||.+||+++++.+++.+++|+|||+|+|+++|+++++++++|+++|||+++++||||++++++++++||++|+++.|+++
T Consensus       109 Ls~eEr~~vi~~~ve~~~grvpViaGvg~~st~eai~la~~A~~~Gadavlvv~PyY~k~sq~gl~~hf~~IA~a~Piil  188 (360)
T 4dpp_A          109 MSWDEHIMLIGHTVNCFGGSIKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSIEGLIAHFQSVLHMGPTII  188 (360)
T ss_dssp             SCHHHHHHHHHHHHHHHTTTSEEEEECCCSSHHHHHHHHHHHHHTTCSEEEEECCCSSCCCHHHHHHHHHTTGGGSCEEE
T ss_pred             CCHHHHHHHHHHHHHHhCCCCeEEEecCCCCHHHHHHHHHHHHHcCCCEEEEcCCCCCCCCHHHHHHHHHHHHHhCCEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCCCCCCCCCHHHHHHHhcCCCEEEEeecCchhhHhhhhCCCeEEEecCcchhHhHHHHcCCceeecccccccHHHHH
Q 018443          185 YNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGNDRVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMR  264 (356)
Q Consensus       185 Yn~P~~tG~~ls~~~l~~La~~pnivGiK~s~~d~~i~~~~~~~~~v~~G~d~~~l~~~l~~Ga~G~is~~~n~~P~~~~  264 (356)
                      ||+|++||++++++++.+|+++|||+|||++++|.++.++.+++|.||+|+|++++...+.+|++|+||+++|++|+.++
T Consensus       189 YNiP~rTg~~ls~e~l~~La~~pnIvGIKdssgd~~i~~~~~~~f~v~sG~D~~~l~~~l~~Ga~G~Is~~aNv~P~~~~  268 (360)
T 4dpp_A          189 YNVPGRTGQDIPPRAIFKLSQNPNLAGVKECVGNKRVEEYTENGVVVWSGNDDECHDSRWDYGATGVISVTSNLVPGLMR  268 (360)
T ss_dssp             EECHHHHSCCCCHHHHHHHTTSTTEEEEEECSCHHHHHHHHHTTCCEEECCGGGHHHHHHHSCCCEEEESGGGTCHHHHH
T ss_pred             EeCCcccCCCCCHHHHHHHhcCCCEEEEEeCCCcHHHHHhhCCCEEEEeCChHHHHHHHHHcCCCEEEccchhhcHHHHH
Confidence            99999999999999999999999999999999998777767789999999998887655789999999999999999999


Q ss_pred             HHHHcCCcHHHHHHHHHHHHHHhcCCChHHHHHHHHHcCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCcccccccccccc
Q 018443          265 ELMFGGKNPSLNTKLFPLIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGRENFVGEKDVQV  344 (356)
Q Consensus       265 ~l~~ag~a~~l~~~l~~l~~~~~~~~~~~~~K~al~~~G~~~g~~R~Pl~~l~~~~~~~l~~~l~~~gl~~~~~~~~~~~  344 (356)
                      ++|++|+++++|+++.+++++++..+++..+|++|+++|++.+.+|+|+.+++++++++|+++++++|+..|.|.+++++
T Consensus       269 ~l~~aG~a~~l~~~l~pl~~~l~~~~~p~~vK~al~~~G~~~g~~R~Pl~~l~~~~~~~l~~~l~~~gl~~~~~~~~~~~  348 (360)
T 4dpp_A          269 KLMFEGRNSSLNSKLLPLMAWLFHEPNPIGINTALAQLGVSRPVFRLPYVPLPLSKRLEFVKLVKEIGREHFVGEKDVQA  348 (360)
T ss_dssp             HHHHSCCCHHHHHHHHHHHHHHTSSSTTHHHHHHHHHHTSSCSEEETTCCCCCHHHHHHHHHHHHHHCGGGSSSSSCCCC
T ss_pred             HHHHhhhHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCCcccCCccccee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCcccccccC
Q 018443          345 LDDDDFILVDRY  356 (356)
Q Consensus       345 ~~~~~~~~~~~~  356 (356)
                      ++||||+|+|||
T Consensus       349 ~~~~~~~~~~~~  360 (360)
T 4dpp_A          349 LDDDDFILIGRY  360 (360)
T ss_dssp             CCGGGCEEESCC
T ss_pred             ecccceEEeecC
Confidence            999999999999
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>4dnh_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati YORK structural genomics research consortium; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TI protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3apt_A Methylenetetrahydrofolate reductase; TIM barrel, oxidoreductase, flavin; HET: FAD; 1.85A {Thermus thermophilus} PDB: 3apy_A* 1v93_A* Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3kdn_A Rubisco, ribulose bisphosphate carboxylase; ribulose-1,5-bisphosphate carboxylase/oxygenase, Ca dioxide fixation, lyase, magnesium; HET: KCX CAP; 2.09A {Thermococcus kodakaraensis} PDB: 3a13_A* 3kdo_A* 3a12_A* 1geh_A* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>2hbv_A 2-amino-3-carboxymuconate 6-semialdehyde decarbox; ACMSD, TIM-barrel, decarboxylase, metaloenzyme, lyase; 1.65A {Pseudomonas fluorescens} SCOP: c.1.9.15 PDB: 2hbx_A Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1wdd_A Ribulose bisphosphate carboxylase large chain; rubisco, photosynthesis, alpha/beta barrel, N-methylmethioni translational modification, lyase; HET: KCX CAP; 1.35A {Oryza sativa} SCOP: c.1.14.1 d.58.9.1 PDB: 3axk_A* 3axm_A* 1rlc_L* 4rub_A* 3rub_L 1ej7_L 1aa1_L* 1aus_L 1rbo_L* 1rco_L* 1rcx_L* 1rxo_L* 1gk8_A* 1ir2_A* 1uzd_A* 1uzh_A* 2v69_A* 1uwa_A* 2v63_A* 2v67_A* ... Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1bwv_A Rubisco, protein (ribulose bisphosphate carboxylase); carbon dioxide fixation, complex (rubisco-reaction intermedi high specificity factor; HET: KCX CAP; 2.40A {Galdieria partita} SCOP: c.1.14.1 d.58.9.1 PDB: 1iwa_A 1bxn_A Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>2f6k_A Metal-dependent hydrolase; metal dependent hydrolyse, aminohydro_2, ACMDS, ACMS, trypto metabolism, quinolinic acid, QUIN; 2.50A {Lactobacillus plantarum} SCOP: c.1.9.15 Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>3nwr_A A rubisco-like protein; lyase; HET: KCX; 1.50A {Burkholderia fungorum} Back     alignment and structure
>4f0h_A Ribulose bisphosphate carboxylase large chain; alpha beta domain, catalytic domain TIM barrel, carboxylase/oxygenase, nitrosylation; 1.96A {Galdieria sulphuraria} PDB: 4f0k_A 4f0m_A 1bwv_A* 1iwa_A 1bxn_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2dvt_A Thermophilic reversible gamma-resorcylate decarbo; TIM barrel, lyase; 1.70A {Rhizobium SP} SCOP: c.1.9.15 PDB: 2dvu_A* 2dvx_A* 3s4t_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1 Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>3qfw_A Ribulose-1,5-bisphosphate carboxylase/oxygenase L subunit; structural genomics, PSI-2, protein structure initiative; 1.79A {Rhodopseudomonas palustris} Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>2d69_A Ribulose bisphosphate carboxylase; alpha/beta barrel, structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.90A {Pyrococcus horikoshii} SCOP: c.1.14.1 d.58.9.1 PDB: 2cxe_A 2cwx_A Back     alignment and structure
>4ay7_A Methylcobalamin\: coenzyme M methyltransferase; TIM barrel; 1.80A {Methanosarcina mazei} PDB: 4ay8_A Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>2oem_A 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; rubisco-like protein, isomerase; HET: KCX 1AE; 1.70A {Geobacillus kaustophilus} PDB: 2oel_A* 2oek_A* 2oej_A Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens} Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>2zvi_A 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; methionine salvage pathway, amino-acid biosynthesis, isomerase, magnesium, metal- binding; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>3fk4_A Rubisco-like protein; structural genomics, target 9463A, PSI-2, protein structure initiative; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1ykw_A Rubisco-like protein; beta-alpha-barrel, unknown function; 2.00A {Chlorobaculum tepidum} SCOP: c.1.14.1 d.58.9.1 PDB: 1tel_A Back     alignment and structure
>2qyg_A Ribulose bisphosphate carboxylase-like protein 2; beta-alpha-barrel, unknown function; 3.30A {Rhodopseudomonas palustris} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3bld_A Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ... Back     alignment and structure
>4exq_A UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid, NIH, SBRI, heme biosynthesis, structural GENO niaid; 1.65A {Burkholderia thailandensis} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2ash_A Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, struc genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3fst_A 5,10-methylenetetrahydrofolate reductase; TIM barrel, flavin, amino-acid biosynthesis, FAD, flavoprotein, methionine biosynthesis, NAD; HET: FAD MRY; 1.65A {Escherichia coli k-12} PDB: 3fsu_A* 1zp3_A* 1zpt_A* 1zrq_A* 1zp4_A* 2fmn_A* 2fmo_A* 1b5t_A* Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A* Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>4exq_A UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid, NIH, SBRI, heme biosynthesis, structural GENO niaid; 1.65A {Burkholderia thailandensis} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>2eja_A URO-D, UPD, uroporphyrinogen decarboxylase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>1r3s_A URO-D, uroporphyrinogen decarboxylase, UPD; uroporphyrinogen decarboxylase coproporphyrinogen, X-RAY crystallography, lyase; HET: 1CP; 1.65A {Homo sapiens} SCOP: c.1.22.1 PDB: 1r3t_A* 1r3r_A 1r3q_A* 1r3y_A* 1uro_A 3gvq_A 3gvr_A 1r3v_A* 3gvv_A 3gvw_A 1jph_A 1r3w_A* 3gw3_A 1jpi_A 1jpk_A 3gw0_A 2q71_A* 2q6z_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 356
d1xkya1292 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {B 2e-55
d2a6na1292 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {E 2e-51
d1xxxa1296 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {M 5e-46
d1o5ka_295 c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermo 5e-42
d1hl2a_295 c.1.10.1 (A:) N-acetylneuraminate lyase {Escherich 1e-35
d1f74a_293 c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophil 2e-34
d1w3ia_293 c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Ed 3e-23
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Length = 292 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Dihydrodipicolinate synthase
species: Bacillus anthracis [TaxId: 1392]

 Score =  181 bits (459), Expect = 2e-55
 Identities = 90/287 (31%), Positives = 145/287 (50%), Gaps = 13/287 (4%)

Query: 59  LITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTV 118
           + TA+ TP+  +G  D      LVN  I NG   ++VGGTTGE   ++ +E + L  H V
Sbjct: 7   IATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVALYRHVV 66

Query: 119 NCFGASVKVIGNTGSNSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLS 178
           +     V VI  TGSN+T  +I  T++   VG+ A + + PYY K S EG+  HF ++  
Sbjct: 67  SVVDKRVPVIAGTGSNNTHASIDLTKKATEVGVDAVMLVAPYYNKPSQEGMYQHFKAIAE 126

Query: 179 MG--PTIIYNVPSRTGQDIPPRVIHTMAQSPNLAGVKECVGND----RVEHYTGNGIVVW 232
               P ++YNVP R+   I    +  +++  N+  +K+  G+      +   T +   V+
Sbjct: 127 STPLPVMLYNVPGRSIVQISVDTVVRLSEIENIVAIKDAGGDVLTMTEIIEKTADDFAVY 186

Query: 233 SGNDDQCHDARWNHGATGVISVTSNLVPGMMRE------LMFGGKNPSLNTKLFPLIEWL 286
           SG+D     A    GA G++SV S+++   M+E           K   L+  L  + + L
Sbjct: 187 SGDDGLTLPA-MAVGAKGIVSVASHVIGNEMQEMIAAFQAGEFKKAQKLHQLLVRVTDSL 245

Query: 287 FQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIGR 333
           F  P+P P+ TAL  +G+     RLP +PL +E+R    +++  I R
Sbjct: 246 FMAPSPTPVKTALQMVGLDVGSVRLPLLPLTEEERVTLQSVMQSIPR 292
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 296 Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Length = 295 Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Length = 295 Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Length = 293 Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Length = 293 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 100.0
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 100.0
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 100.0
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 100.0
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 100.0
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 100.0
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 100.0
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 97.24
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 96.72
d1geha1307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 96.15
d2d69a1291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 96.05
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 95.55
d1wdda1325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 95.42
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 94.79
d1f61a_418 Isocitrate lyase {Mycobacterium tuberculosis [TaxI 94.42
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 93.95
d2f6ka1306 Putative amidohydrolase LP2961 {Lactobacillus plan 93.45
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 93.39
d1bwva1328 Ribulose 1,5-bisphosphate carboxylase-oxygenase {G 93.18
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 93.15
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 93.1
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 93.03
d2hbva1331 2-amino-3-carboxymuconate 6-semialdehyde decarboxy 92.33
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 91.67
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 91.19
d1v93a_292 Methylenetetrahydrofolate reductase {Thermus therm 91.02
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 90.93
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 90.76
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 90.66
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 90.51
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 90.02
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 89.62
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 89.44
d2dvta1325 Thermophilic reversible gamma-resorcylate decarbox 89.06
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 89.04
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 88.74
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 88.61
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 88.16
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 88.01
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 87.43
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 87.16
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 86.91
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 86.82
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 86.67
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 86.59
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 86.57
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 86.05
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 85.96
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 85.62
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 84.31
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 84.27
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 84.19
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 83.91
d3bofa2300 Cobalamin-dependent methionine synthase MetH, N-te 83.76
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 83.68
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 83.23
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 83.15
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 82.79
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 82.65
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 82.38
d5ruba1320 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 82.35
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 81.79
d8abpa_305 L-arabinose-binding protein {Escherichia coli [Tax 81.72
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 81.59
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 81.01
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 80.88
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 80.88
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 80.62
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 80.56
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 80.48
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 80.2
d1r5ya_372 Queosine tRNA-guanine transglycosylase {Zymomonas 80.1
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Dihydrodipicolinate synthase
species: Bacillus anthracis [TaxId: 1392]

Probab=100.00  E-value=4.1e-64  Score=476.30  Aligned_cols=278  Identities=32%  Similarity=0.550  Sum_probs=262.1

Q ss_pred             cccCceeEeeecccCCCCCCCHHHHHHHHHHHHHCCCCEEEEccCcccccCCCHHHHHHHHHHHHHHhCCCcEEEEecCC
Q 018443           54 IKALRLITAIKTPYLPDGRFDLEAYDDLVNMQIVNGAEGMIVGGTTGEGQLMSWDEHIMLIGHTVNCFGASVKVIGNTGS  133 (356)
Q Consensus        54 ~~~~Gvi~al~TPf~~dg~ID~~~l~~~v~~li~~Gv~Gl~v~GstGE~~~Lt~eEr~~li~~~~~~~~grvpVi~gvg~  133 (356)
                      |.++||+||++|||++||+||+++++++++|+++.||+|++++|+|||+++||.+||+++++.+++++++|+|||+||++
T Consensus         2 ~~~~Gi~~a~~TPf~~d~~iD~~~~~~~i~~l~~~Gv~gl~~~G~tGE~~~Ls~~Er~~l~~~~~~~~~~~~~vi~gv~~   81 (292)
T d1xkya1           2 IDFGTIATAMVTPFDINGNIDFAKTTKLVNYLIDNGTTAIVVGGTTGESPTLTSEEKVALYRHVVSVVDKRVPVIAGTGS   81 (292)
T ss_dssp             CCCCSEEEECCCCBCTTSSBCHHHHHHHHHHHHHTTCCEEEESSTTTTGGGSCHHHHHHHHHHHHHHHTTSSCEEEECCC
T ss_pred             CCCCceeeeeeCCcCCCcCcCHHHHHHHHHHHHHCCCCEEEECeEccchhhCCHHHHHHHHHHHHHHhCCCceEEEecCc
Confidence            34899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHcCCCEEEEcCCCCCCCCHHHHHHHHHHHHhc--CCeEEEeCCCCCCCCCCHHHHHHHhcCCCEEE
Q 018443          134 NSTREAIHATEQGFAVGMHAALHINPYYGKTSLEGLISHFDSVLSM--GPTIIYNVPSRTGQDIPPRVIHTMAQSPNLAG  211 (356)
Q Consensus       134 ~st~~ai~lar~a~~~Gadavlv~pP~y~~~s~~~l~~y~~~va~~--~PiilYn~P~~tG~~ls~~~l~~La~~pnivG  211 (356)
                      .|++++++++++|+++|||+++++||+|+++|++++++||++|+++  +|+++||+|..+|..++++++.+|+++|||+|
T Consensus        82 ~s~~~~i~~a~~a~~~Gad~ilv~pP~~~~~s~~~i~~~~~~v~~~~~~pi~iYn~P~~~~~~~~~~~~~~l~~~p~v~g  161 (292)
T d1xkya1          82 NNTHASIDLTKKATEVGVDAVMLVAPYYNKPSQEGMYQHFKAIAESTPLPVMLYNVPGRSIVQISVDTVVRLSEIENIVA  161 (292)
T ss_dssp             SCHHHHHHHHHHHHHTTCSEEEEECCCSSCCCHHHHHHHHHHHHHTCSSCEEEEECHHHHSSCCCHHHHHHHHTSTTEEE
T ss_pred             ccHHHHHHHHHHHHHcCCCEEEECCCCCCCCCHHHHHHHHHHHhccCCCcEEEEeCCcccCCccCHHHHhhhccCCCEEE
Confidence            9999999999999999999999999999999999999999999998  79999999999999999999999999999999


Q ss_pred             EeecCchh----hHhhhhCCCeEEEecCcchhHhHHHHcCCceeecccccccHHHHHHHHH---cCC---cHHHHHHHHH
Q 018443          212 VKECVGND----RVEHYTGNGIVVWSGNDDQCHDARWNHGATGVISVTSNLVPGMMRELMF---GGK---NPSLNTKLFP  281 (356)
Q Consensus       212 iK~s~~d~----~i~~~~~~~~~v~~G~d~~~l~~~l~~Ga~G~is~~~n~~P~~~~~l~~---ag~---a~~l~~~l~~  281 (356)
                      +|+++++.    ++.....+++.+++|.|..++.. +..|++|++++++|++|+.++++|+   +|+   ++++++++.+
T Consensus       162 iK~~~~~~~~~~~~~~~~~~~~~v~~G~~~~~~~~-~~~G~~G~~~~~~n~~p~~~~~l~~~~~~g~~~~a~~l~~~l~~  240 (292)
T d1xkya1         162 IKDAGGDVLTMTEIIEKTADDFAVYSGDDGLTLPA-MAVGAKGIVSVASHVIGNEMQEMIAAFQAGEFKKAQKLHQLLVR  240 (292)
T ss_dssp             EEECSSCHHHHHHHHHHSCTTCEEEESSGGGHHHH-HHTTCCEEEESTHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHH
T ss_pred             EeccccchhhhheeeeecCCCCEEEECCccccchH-HHcCCCccccchhhHHHHHHHHHHHhhhhhhHHHHHHHHHHHHH
Confidence            99999984    23344578899999999888765 8899999999999999999999986   454   6789999999


Q ss_pred             HHHHHhcCCChHHHHHHHHHcCCCCCCCCCCCCCCCHHHHHHHHHHHHHcC
Q 018443          282 LIEWLFQEPNPIPLNTALAQLGVVRPVFRLPYVPLPQEKRAEFVNLVNQIG  332 (356)
Q Consensus       282 l~~~~~~~~~~~~~K~al~~~G~~~g~~R~Pl~~l~~~~~~~l~~~l~~~g  332 (356)
                      +++.++..+++..+|++|+++|++.+.+|+|+.+++++++++|+++++++|
T Consensus       241 ~~~~~~~~~~~~~~K~~l~~~Gi~~g~~R~P~~~lt~~~~~~i~~~l~~l~  291 (292)
T d1xkya1         241 VTDSLFMAPSPTPVKTALQMVGLDVGSVRLPLLPLTEEERVTLQSVMQSIP  291 (292)
T ss_dssp             HHHHTTSSSTTHHHHHHHHHTTCCCCCCCTTSCCCCHHHHHHHHHHHHTSC
T ss_pred             HHHHHhccCcHHHHHHHHHHcCCCCCCCCCCCCCCCHHHHHHHHHHHHHcC
Confidence            999888888999999999999999999999999999999999999999976
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bwva1 c.1.14.1 (A:150-478) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v93a_ c.1.23.1 (A:) Methylenetetrahydrofolate reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d3bofa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d5ruba1 c.1.14.1 (A:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure