Citrus Sinensis ID: 018502
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 355 | ||||||
| 359495984 | 329 | PREDICTED: formyltetrahydrofolate deform | 0.915 | 0.987 | 0.738 | 1e-151 | |
| 449458970 | 326 | PREDICTED: formyltetrahydrofolate deform | 0.915 | 0.996 | 0.702 | 1e-144 | |
| 224074167 | 317 | formyltetrahydrofolate deformylase [Popu | 0.873 | 0.977 | 0.716 | 1e-143 | |
| 358248700 | 316 | uncharacterized protein LOC100780134 [Gl | 0.887 | 0.996 | 0.705 | 1e-142 | |
| 356563338 | 316 | PREDICTED: formyltetrahydrofolate deform | 0.887 | 0.996 | 0.699 | 1e-141 | |
| 224138620 | 317 | formyltetrahydrofolate deformylase [Popu | 0.833 | 0.933 | 0.715 | 1e-137 | |
| 357502477 | 324 | Formyltetrahydrofolate deformylase [Medi | 0.898 | 0.984 | 0.690 | 1e-137 | |
| 388513597 | 322 | unknown [Medicago truncatula] | 0.898 | 0.990 | 0.690 | 1e-137 | |
| 217071818 | 324 | unknown [Medicago truncatula] | 0.898 | 0.984 | 0.690 | 1e-137 | |
| 89257492 | 332 | formyltetrahydrofolate deformylase, puta | 0.845 | 0.903 | 0.706 | 1e-136 |
| >gi|359495984|ref|XP_003635126.1| PREDICTED: formyltetrahydrofolate deformylase-like [Vitis vinifera] gi|297744389|emb|CBI37363.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 541 bits (1394), Expect = e-151, Method: Compositional matrix adjust.
Identities = 265/359 (73%), Positives = 294/359 (81%), Gaps = 34/359 (9%)
Query: 1 MPLLRRLSSSLQQVVKFTNRSFKSLKFPGEPI---ESSVSPTLTHGIHVFHCPDEVGIVA 57
M L RRLS+SL Q++ FTNRSFKSLKFP + + SS +L HGIHVFHCPD VGIVA
Sbjct: 1 MSLRRRLSTSLPQLLGFTNRSFKSLKFPQQSLHCFNSSSESSLAHGIHVFHCPDGVGIVA 60
Query: 58 KLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMR 117
KLS+CIASRGGNIL AD+FVPE K VFYSRSEFIFDP KWPR QMDEDF KLS MFNAM+
Sbjct: 61 KLSDCIASRGGNILGADIFVPENKKVFYSRSEFIFDPAKWPRAQMDEDFLKLSNMFNAMK 120
Query: 118 SVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFL 177
SVVRVP +DPKYK++VLASKQ+HCLVD L+GWQ+G+LPV+ITCVISNHDRGPN+HV RFL
Sbjct: 121 SVVRVPILDPKYKISVLASKQDHCLVDLLHGWQDGRLPVDITCVISNHDRGPNTHVFRFL 180
Query: 178 ERHGIPYHYL-CAKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSK 236
ERHGIPYHYL KEN+RE E+L+LVQ+TDFLVLARYMQ
Sbjct: 181 ERHGIPYHYLHTTKENKREGEILDLVQDTDFLVLARYMQ--------------------- 219
Query: 237 GSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTE 296
ILSG FL+SYGKD+INIHHGLLPSFKGG P+KQAFDAGVKLIGATSHFVTE
Sbjct: 220 ---------ILSGNFLKSYGKDIINIHHGLLPSFKGGNPSKQAFDAGVKLIGATSHFVTE 270
Query: 297 ELDAGPIIEQMVERVSHRDNLRTFVQKSEDVEKQCLAKAIKSYCELRVLPYEMNKTVVF 355
ELDAGPII QMVERV HRDNL++FVQKSE++EKQCL KAIKSYCELRVLPYE NKTVVF
Sbjct: 271 ELDAGPIIGQMVERVCHRDNLKSFVQKSENLEKQCLVKAIKSYCELRVLPYEDNKTVVF 329
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449458970|ref|XP_004147219.1| PREDICTED: formyltetrahydrofolate deformylase-like [Cucumis sativus] gi|449504944|ref|XP_004162337.1| PREDICTED: formyltetrahydrofolate deformylase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224074167|ref|XP_002304283.1| formyltetrahydrofolate deformylase [Populus trichocarpa] gi|222841715|gb|EEE79262.1| formyltetrahydrofolate deformylase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|358248700|ref|NP_001240181.1| uncharacterized protein LOC100780134 [Glycine max] gi|255636588|gb|ACU18632.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356563338|ref|XP_003549921.1| PREDICTED: formyltetrahydrofolate deformylase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224138620|ref|XP_002326648.1| formyltetrahydrofolate deformylase [Populus trichocarpa] gi|222833970|gb|EEE72447.1| formyltetrahydrofolate deformylase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357502477|ref|XP_003621527.1| Formyltetrahydrofolate deformylase [Medicago truncatula] gi|355496542|gb|AES77745.1| Formyltetrahydrofolate deformylase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388513597|gb|AFK44860.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217071818|gb|ACJ84269.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|89257492|gb|ABD64983.1| formyltetrahydrofolate deformylase, putative [Brassica oleracea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 355 | ||||||
| TAIR|locus:2130893 | 328 | AT4G17360 [Arabidopsis thalian | 0.560 | 0.606 | 0.675 | 9.4e-122 | |
| TAIR|locus:505006677 | 323 | AT5G47435 [Arabidopsis thalian | 0.543 | 0.597 | 0.664 | 5.1e-121 | |
| TIGR_CMR|DET_1237 | 284 | DET_1237 "formyltetrahydrofola | 0.312 | 0.390 | 0.392 | 5.1e-39 | |
| UNIPROTKB|G4MX54 | 284 | MGG_08008 "Formyltetrahydrofol | 0.315 | 0.394 | 0.460 | 8.3e-39 | |
| TIGR_CMR|CPS_2482 | 292 | CPS_2482 "formyltetrahydrofola | 0.315 | 0.383 | 0.433 | 4e-37 | |
| TIGR_CMR|CPS_4036 | 292 | CPS_4036 "formyltetrahydrofola | 0.315 | 0.383 | 0.433 | 4e-37 | |
| TIGR_CMR|CPS_4357 | 286 | CPS_4357 "formyltetrahydrofola | 0.312 | 0.388 | 0.419 | 1e-36 | |
| TIGR_CMR|CPS_3620 | 292 | CPS_3620 "formyltetrahydrofola | 0.315 | 0.383 | 0.424 | 5.7e-36 | |
| UNIPROTKB|Q9KQK6 | 277 | VC_1992 "Formyltetrahydrofolat | 0.304 | 0.389 | 0.458 | 6.3e-35 | |
| TIGR_CMR|VC_1992 | 277 | VC_1992 "formyltetrahydrofolat | 0.304 | 0.389 | 0.458 | 6.3e-35 |
| TAIR|locus:2130893 AT4G17360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 727 (261.0 bits), Expect = 9.4e-122, Sum P(2) = 9.4e-122
Identities = 135/200 (67%), Positives = 160/200 (80%)
Query: 17 FTNRSFKSLKFPGEPIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVF 76
FT SFKS +F GE ++SSVSP L G HVFHCPD VGIVAKLS+CIA++GGNIL DVF
Sbjct: 19 FTKWSFKSSQFHGESLDSSVSPLLIPGFHVFHCPDVVGIVAKLSDCIAAKGGNILGYDVF 78
Query: 77 VPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLAS 136
VPE KNVFYSRSEFIFDP+KWPR QMDEDF +++ F+A+ SVVRVP +DPKYK+A+L S
Sbjct: 79 VPENKNVFYSRSEFIFDPVKWPRRQMDEDFQTIAQKFSALSSVVRVPSLDPKYKIALLLS 138
Query: 137 KQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYL-CAKXXXXX 195
KQ+HCLV+ L+ WQ+GKLPV+ITCVISNH+R PN+HV+RFL+RHGI YHYL
Sbjct: 139 KQDHCLVEMLHKWQDGKLPVDITCVISNHERAPNTHVMRFLQRHGISYHYLPTTDQNKIE 198
Query: 196 XXXXXXVQNTDFLVLARYMQ 215
V+ TDFLVLARYMQ
Sbjct: 199 EEILELVKGTDFLVLARYMQ 218
|
|
| TAIR|locus:505006677 AT5G47435 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1237 DET_1237 "formyltetrahydrofolate deformylase" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MX54 MGG_08008 "Formyltetrahydrofolate deformylase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2482 CPS_2482 "formyltetrahydrofolate deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4036 CPS_4036 "formyltetrahydrofolate deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4357 CPS_4357 "formyltetrahydrofolate deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3620 CPS_3620 "formyltetrahydrofolate deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KQK6 VC_1992 "Formyltetrahydrofolate deformylase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1992 VC_1992 "formyltetrahydrofolate deformylase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 355 | |||
| PLN02828 | 268 | PLN02828, PLN02828, formyltetrahydrofolate deformy | 0.0 | |
| PRK06027 | 286 | PRK06027, purU, formyltetrahydrofolate deformylase | 1e-105 | |
| cd08648 | 196 | cd08648, FMT_core_Formyl-FH4-Hydrolase_C, Formylte | 1e-103 | |
| COG0788 | 287 | COG0788, PurU, Formyltetrahydrofolate hydrolase [N | 1e-99 | |
| TIGR00655 | 280 | TIGR00655, PurU, formyltetrahydrofolate deformylas | 3e-83 | |
| PRK13011 | 286 | PRK13011, PRK13011, formyltetrahydrofolate deformy | 1e-74 | |
| PRK13010 | 289 | PRK13010, purU, formyltetrahydrofolate deformylase | 4e-67 | |
| cd08645 | 183 | cd08645, FMT_core_GART, Phosphoribosylglycinamide | 1e-37 | |
| COG0299 | 200 | COG0299, PurN, Folate-dependent phosphoribosylglyc | 1e-33 | |
| PRK05647 | 200 | PRK05647, purN, phosphoribosylglycinamide formyltr | 1e-30 | |
| pfam00551 | 181 | pfam00551, Formyl_trans_N, Formyl transferase | 3e-30 | |
| cd08369 | 173 | cd08369, FMT_core, Formyltransferase, catalytic co | 1e-28 | |
| TIGR00639 | 190 | TIGR00639, PurN, phosphoribosylglycinamide formylt | 2e-25 | |
| cd04875 | 74 | cd04875, ACT_F4HF-DF, N-terminal ACT domain of for | 2e-17 | |
| PLN02331 | 207 | PLN02331, PLN02331, phosphoribosylglycinamide form | 6e-11 | |
| cd08653 | 152 | cd08653, FMT_core_like_3, Formyl transferase catal | 7e-10 | |
| COG0223 | 307 | COG0223, Fmt, Methionyl-tRNA formyltransferase [Tr | 1e-08 | |
| TIGR00460 | 313 | TIGR00460, fmt, methionyl-tRNA formyltransferase | 5e-08 | |
| cd08644 | 203 | cd08644, FMT_core_ArnA_N, ArnA, N-terminal formylt | 3e-07 | |
| PLN02285 | 334 | PLN02285, PLN02285, methionyl-tRNA formyltransfera | 3e-07 | |
| cd08823 | 177 | cd08823, FMT_core_like_5, Formyl transferase catal | 3e-06 | |
| PRK08125 | 660 | PRK08125, PRK08125, bifunctional UDP-glucuronic ac | 5e-05 | |
| PRK06988 | 312 | PRK06988, PRK06988, putative formyltransferase; Pr | 5e-05 | |
| PRK00005 | 309 | PRK00005, fmt, methionyl-tRNA formyltransferase; R | 7e-05 | |
| cd08646 | 204 | cd08646, FMT_core_Met-tRNA-FMT_N, Methionyl-tRNA f | 7e-05 | |
| PRK07579 | 245 | PRK07579, PRK07579, hypothetical protein; Provisio | 1e-04 | |
| cd08651 | 180 | cd08651, FMT_core_like_4, Formyl transferase catal | 0.002 | |
| cd02116 | 60 | cd02116, ACT, ACT domains are commonly involved in | 0.003 |
| >gnl|CDD|178422 PLN02828, PLN02828, formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
Score = 537 bits (1384), Expect = 0.0
Identities = 222/298 (74%), Positives = 249/298 (83%), Gaps = 31/298 (10%)
Query: 59 LSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRS 118
LS+CIASRGGNIL DVFVPE KNVFYSRSEFIFDP+KWPR QMDEDF ++SK F A++S
Sbjct: 1 LSDCIASRGGNILGVDVFVPENKNVFYSRSEFIFDPVKWPRAQMDEDFQEISKHFKALKS 60
Query: 119 VVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLE 178
VVRVP +DPKYK+AVLASKQ+HCL+D L+ WQ+G+LPV+ITCVISNH+RGPN+HV+RFLE
Sbjct: 61 VVRVPGLDPKYKIAVLASKQDHCLIDLLHRWQDGRLPVDITCVISNHERGPNTHVMRFLE 120
Query: 179 RHGIPYHYLC-AKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKG 237
RHGIPYHYL KEN+RE+E+LELV+ TDFLVLARYMQ
Sbjct: 121 RHGIPYHYLPTTKENKREDEILELVKGTDFLVLARYMQ---------------------- 158
Query: 238 SLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEE 297
ILSG FL+ YGKD+INIHHGLLPSFKGG P+KQAFDAGVKLIGATSHFVTEE
Sbjct: 159 --------ILSGNFLKGYGKDIINIHHGLLPSFKGGNPSKQAFDAGVKLIGATSHFVTEE 210
Query: 298 LDAGPIIEQMVERVSHRDNLRTFVQKSEDVEKQCLAKAIKSYCELRVLPYEMNKTVVF 355
LDAGPIIEQMVERVSHRDNLR+FVQKSE++EKQCLAKAIKSYCELRVLPY NKTVVF
Sbjct: 211 LDAGPIIEQMVERVSHRDNLRSFVQKSENLEKQCLAKAIKSYCELRVLPYGTNKTVVF 268
|
Length = 268 |
| >gnl|CDD|235676 PRK06027, purU, formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|187717 cd08648, FMT_core_Formyl-FH4-Hydrolase_C, Formyltetrahydrofolate deformylase (Formyl-FH4 hydrolase), C-terminal hydrolase domain | Back alignment and domain information |
|---|
| >gnl|CDD|223859 COG0788, PurU, Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233074 TIGR00655, PurU, formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >gnl|CDD|237266 PRK13011, PRK13011, formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|139334 PRK13010, purU, formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|187714 cd08645, FMT_core_GART, Phosphoribosylglycinamide formyltransferase (GAR transformylase, GART) | Back alignment and domain information |
|---|
| >gnl|CDD|223376 COG0299, PurN, Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235544 PRK05647, purN, phosphoribosylglycinamide formyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|144222 pfam00551, Formyl_trans_N, Formyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|187712 cd08369, FMT_core, Formyltransferase, catalytic core domain | Back alignment and domain information |
|---|
| >gnl|CDD|161973 TIGR00639, PurN, phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent | Back alignment and domain information |
|---|
| >gnl|CDD|153147 cd04875, ACT_F4HF-DF, N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|177965 PLN02331, PLN02331, phosphoribosylglycinamide formyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|187721 cd08653, FMT_core_like_3, Formyl transferase catalytic core domain found in a group of proteins with unknown functions | Back alignment and domain information |
|---|
| >gnl|CDD|223301 COG0223, Fmt, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|232983 TIGR00460, fmt, methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|187713 cd08644, FMT_core_ArnA_N, ArnA, N-terminal formyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|215159 PLN02285, PLN02285, methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|187725 cd08823, FMT_core_like_5, Formyl transferase catalytic core domain found in a group of proteins with unknown functions | Back alignment and domain information |
|---|
| >gnl|CDD|236156 PRK08125, PRK08125, bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235902 PRK06988, PRK06988, putative formyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234567 PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|187715 cd08646, FMT_core_Met-tRNA-FMT_N, Methionyl-tRNA formyltransferase, N-terminal hydrolase domain | Back alignment and domain information |
|---|
| >gnl|CDD|236058 PRK07579, PRK07579, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187720 cd08651, FMT_core_like_4, Formyl transferase catalytic core domain found in a group of proteins with unknown functions | Back alignment and domain information |
|---|
| >gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 355 | |||
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 100.0 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 100.0 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 100.0 | |
| PLN02828 | 268 | formyltetrahydrofolate deformylase | 100.0 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 100.0 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 100.0 | |
| COG0299 | 200 | PurN Folate-dependent phosphoribosylglycinamide fo | 100.0 | |
| KOG3076 | 206 | consensus 5'-phosphoribosylglycinamide formyltrans | 100.0 | |
| PLN02331 | 207 | phosphoribosylglycinamide formyltransferase | 100.0 | |
| TIGR00639 | 190 | PurN phosphoribosylglycinamide formyltransferase, | 100.0 | |
| PRK05647 | 200 | purN phosphoribosylglycinamide formyltransferase; | 100.0 | |
| PLN02285 | 334 | methionyl-tRNA formyltransferase | 100.0 | |
| PF00551 | 181 | Formyl_trans_N: Formyl transferase; InterPro: IPR0 | 100.0 | |
| COG0223 | 307 | Fmt Methionyl-tRNA formyltransferase [Translation, | 100.0 | |
| PRK06988 | 312 | putative formyltransferase; Provisional | 100.0 | |
| PRK00005 | 309 | fmt methionyl-tRNA formyltransferase; Reviewed | 100.0 | |
| TIGR00460 | 313 | fmt methionyl-tRNA formyltransferase. The top-scor | 100.0 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 100.0 | |
| PRK07579 | 245 | hypothetical protein; Provisional | 100.0 | |
| KOG3082 | 338 | consensus Methionyl-tRNA formyltransferase [Transl | 99.81 | |
| KOG2452 | 881 | consensus Formyltetrahydrofolate dehydrogenase [Nu | 99.78 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 99.77 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 99.73 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 99.66 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 99.65 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 99.61 | |
| PRK00194 | 90 | hypothetical protein; Validated | 99.6 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 99.59 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.57 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 99.56 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.11 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 99.03 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 98.74 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.67 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 98.34 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 98.12 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 98.11 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 97.99 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 97.96 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 97.89 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 97.81 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.8 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 97.8 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 97.8 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 97.73 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 97.66 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 97.66 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 97.65 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 97.65 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.62 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 97.56 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 97.5 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 97.5 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 97.46 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 97.43 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 97.41 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 97.31 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 97.23 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 97.19 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 97.18 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 97.1 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 97.1 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 97.07 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 97.04 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 97.03 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 97.02 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 97.01 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 97.01 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 97.01 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 96.98 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 96.91 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 96.9 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 96.84 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 96.79 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 96.72 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 96.68 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 96.67 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 96.52 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 96.51 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 96.42 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 96.22 | |
| COG4492 | 150 | PheB ACT domain-containing protein [General functi | 96.14 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 95.84 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 95.82 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 95.62 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 95.58 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 95.54 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 95.37 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 95.23 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 95.2 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 95.13 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 95.01 | |
| cd04913 | 75 | ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- | 94.97 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 94.9 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 94.74 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 94.53 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 94.5 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 94.37 | |
| PF00185 | 158 | OTCace: Aspartate/ornithine carbamoyltransferase, | 94.12 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 94.11 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 94.11 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 93.96 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 93.95 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 93.89 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 93.68 | |
| cd04892 | 65 | ACT_AK-like_2 ACT domains C-terminal to the cataly | 93.62 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 93.18 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 92.79 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 92.71 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 92.69 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 92.59 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 92.28 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 92.21 | |
| cd04937 | 64 | ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela | 92.12 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 92.03 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 91.98 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 91.94 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 91.92 | |
| PLN02342 | 348 | ornithine carbamoyltransferase | 91.91 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 91.9 | |
| COG2150 | 167 | Predicted regulator of amino acid metabolism, cont | 91.75 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 91.37 | |
| cd04924 | 66 | ACT_AK-Arch_2 ACT domains of a monofunctional aspa | 91.07 | |
| cd04919 | 66 | ACT_AK-Hom3_2 ACT domains located C-terminal to th | 91.03 | |
| cd04932 | 75 | ACT_AKiii-LysC-EC_1 ACT domains located C-terminal | 90.61 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 90.36 | |
| KOG2663 | 309 | consensus Acetolactate synthase, small subunit [Am | 90.34 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 89.99 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 89.97 | |
| cd04912 | 75 | ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter | 89.93 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 89.76 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 89.66 | |
| cd04918 | 65 | ACT_AK1-AT_2 ACT domains located C-terminal to the | 89.44 | |
| PRK02255 | 338 | putrescine carbamoyltransferase; Provisional | 89.32 | |
| cd04868 | 60 | ACT_AK-like ACT domains C-terminal to the catalyti | 89.12 | |
| PRK10696 | 258 | tRNA 2-thiocytidine biosynthesis protein TtcA; Pro | 88.92 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 88.5 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 88.43 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 87.61 | |
| cd04916 | 66 | ACT_AKiii-YclM-BS_2 ACT domains located C-terminal | 87.51 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 87.45 | |
| PRK08526 | 403 | threonine dehydratase; Provisional | 87.4 | |
| PRK00779 | 304 | ornithine carbamoyltransferase; Provisional | 87.23 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 87.16 | |
| cd04936 | 63 | ACT_AKii-LysC-BS-like_2 ACT domains of the lysine- | 87.08 | |
| COG2102 | 223 | Predicted ATPases of PP-loop superfamily [General | 86.92 | |
| cd04933 | 78 | ACT_AK1-AT_1 ACT domains located C-terminal to the | 86.36 | |
| PRK04284 | 332 | ornithine carbamoyltransferase; Provisional | 85.87 | |
| cd04915 | 66 | ACT_AK-Ectoine_2 ACT domains located C-terminal to | 85.86 | |
| cd04891 | 61 | ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- | 85.86 | |
| cd04923 | 63 | ACT_AK-LysC-DapG-like_2 ACT domains of the lysine- | 84.91 | |
| cd04935 | 75 | ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK | 84.79 | |
| PRK08192 | 338 | aspartate carbamoyltransferase; Provisional | 84.64 | |
| PRK13814 | 310 | pyrB aspartate carbamoyltransferase catalytic subu | 84.41 | |
| COG3978 | 86 | Acetolactate synthase (isozyme II), small (regulat | 84.39 | |
| TIGR01761 | 343 | thiaz-red thiazolinyl imide reductase. This reduct | 84.07 | |
| COG2061 | 170 | ACT-domain-containing protein, predicted allosteri | 83.88 | |
| cd04921 | 80 | ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunc | 83.57 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 82.59 | |
| TIGR00670 | 301 | asp_carb_tr aspartate carbamoyltransferase. Ornith | 82.46 | |
| COG0482 | 356 | TrmU Predicted tRNA(5-methylaminomethyl-2-thiourid | 82.35 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 82.21 | |
| PRK03515 | 336 | ornithine carbamoyltransferase subunit I; Provisio | 81.89 | |
| TIGR02079 | 409 | THD1 threonine dehydratase. This model represents | 81.79 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 81.61 | |
| PRK08639 | 420 | threonine dehydratase; Validated | 81.14 | |
| cd01994 | 194 | Alpha_ANH_like_IV This is a subfamily of Adenine n | 80.84 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 80.27 |
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-78 Score=569.23 Aligned_cols=281 Identities=45% Similarity=0.711 Sum_probs=268.9
Q ss_pred CCCCcccEEEEEEcCCccchHHHHHHHHHhcCCeEeEeeeeccCCCCeEEEEEEEEeCCCCCChHHHHHHHHHHHhhhhh
Q 018502 36 VSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNA 115 (355)
Q Consensus 36 ~~~~~~~~ILTV~GpDr~GIVA~VS~~La~~g~NIld~~q~id~~~g~F~Mr~~v~~~~~~~~~~~L~~~l~~la~~lg~ 115 (355)
|++.+++++||++|||++||||+||++|+++||||++++||.|..+|+||||++|..+....+.++|+++|++++++|||
T Consensus 1 m~~~~~~~~LtvsCpd~~GiVaais~~l~~~g~NI~~~~qf~D~~~g~FFmR~~f~~~~~~~~~~~l~~~f~~~a~~f~m 80 (287)
T COG0788 1 MSNEPDTFILTVSCPDQPGIVAAISGFLAEHGCNIVDSDQFDDPETGRFFMRVEFEGEGGPLDREALRAAFAPLAEEFGM 80 (287)
T ss_pred CCCCccceEEEEecCCCCCcHHHHHHHHHHcCCceeecccccccccCeEEEEEEEecCCCcccHHHHHHHHHHHHHhhCc
Confidence 56777999999999999999999999999999999999999998899999999999988778899999999999999997
Q ss_pred ccceeeeCCCCCCceEEEEEeCCchhHHHHHhhhhcCCCCeEEEEEEeCCCCCCCchHHHHHHHCCCCeEEeC-CCCChh
Q 018502 116 MRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLC-AKENER 194 (355)
Q Consensus 116 ~~~~~~~~~~~~~~riavl~S~~g~~L~~ll~~~~~~~l~~eI~~Vis~~~~~~~~~v~~~a~~~gIP~~~~~-~~~~~~ 194 (355)
.|++++.+.++||++|+|+.+|||.|||++|+.|+|+++|++|||||++ +...++++||||++++ +++++.
T Consensus 81 ---~~~~~~~~~~~ri~i~VSK~~HCL~DLL~r~~~g~L~~eI~~VIsNH~d-----l~~~v~~~~IPfhhip~~~~~k~ 152 (287)
T COG0788 81 ---DWRLHDAAQRKRIAILVSKEDHCLGDLLYRWRIGELPAEIVAVISNHDD-----LRPLVERFDIPFHHIPVTKENKA 152 (287)
T ss_pred ---eeEEeccccCceEEEEEechHHHHHHHHHHHhcCCcCCceEEEEcCCHH-----HHHHHHHcCCCeeeccCCCCcch
Confidence 6999999999999999999999999999999999999999999999974 7999999999999999 566543
Q ss_pred --HHHHHHHhc--CCCEEEEEeeccccchhhHhhhhhhhhhhhcccCcccccccccCChHHHhhcCCCeEEecCCCCCCC
Q 018502 195 --EEELLELVQ--NTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSF 270 (355)
Q Consensus 195 --~~~~~~~l~--~~Dlivla~y~~~~~~~~~~~~~~~~~~~~~~~~~~s~y~~~il~~~~l~~~~~~~INiHpslLP~y 270 (355)
+++++++++ ++|++|||+||| |||++|++++++++|||||||||+|
T Consensus 153 e~E~~~~~ll~~~~~DlvVLARYMq------------------------------ILS~d~~~~~~g~iINIHHSFLPaF 202 (287)
T COG0788 153 EAEARLLELLEEYGADLVVLARYMQ------------------------------ILSPDFVERFPGKIINIHHSFLPAF 202 (287)
T ss_pred HHHHHHHHHHHHhCCCEEeehhhHh------------------------------hCCHHHHHhccCcEEEecccccccC
Confidence 467888887 799999999999 9999999999999999999999999
Q ss_pred CCchHHHHHHHhCCcEeEEEEEEecCcCCCCCeeeeEEEeCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhCCeeeecCC
Q 018502 271 KGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMVERVSHRDNLRTFVQKSEDVEKQCLAKAIKSYCELRVLPYEMN 350 (355)
Q Consensus 271 rG~~p~~~A~~~G~~~~G~T~H~v~~~~D~G~Ii~q~~~~I~~~dt~~~l~~k~~~~~~~~l~~~i~~~~~~~~~~~~~~ 350 (355)
.|++||++|+++|+|.+|+|+|||++++|+||||.|+.++|+|.+|.++|..+.+++|++.|.+|+++++++|++.++ |
T Consensus 203 ~GA~PY~QA~eRGVKlIGATAHYVT~dLDeGPIIeQdv~rV~H~~s~ed~~~~GrDvE~~VLARAv~~hle~Rv~v~g-n 281 (287)
T COG0788 203 IGANPYHQAYERGVKLIGATAHYVTADLDEGPIIEQDVIRVDHAYSVEDLVRAGRDVEKLVLARAVKAHLEDRVFVNG-N 281 (287)
T ss_pred CCCChHHHHHhcCCeEeeeeeeeccCCCCCCCceeeeeeecCccCCHHHHHHhCCcHHHHHHHHHHHHHhcceEEEeC-C
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999999996 9
Q ss_pred ceeeC
Q 018502 351 KTVVF 355 (355)
Q Consensus 351 ~tvvf 355 (355)
|||||
T Consensus 282 kTVVf 286 (287)
T COG0788 282 KTVVF 286 (287)
T ss_pred eEEec
Confidence 99998
|
|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PLN02828 formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3076 consensus 5'-phosphoribosylglycinamide formyltransferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02331 phosphoribosylglycinamide formyltransferase | Back alignment and domain information |
|---|
| >TIGR00639 PurN phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent | Back alignment and domain information |
|---|
| >PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02285 methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >PF00551 Formyl_trans_N: Formyl transferase; InterPro: IPR002376 A number of formyl transferases belong to this group | Back alignment and domain information |
|---|
| >COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06988 putative formyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00460 fmt methionyl-tRNA formyltransferase | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07579 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3082 consensus Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2452 consensus Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >COG4492 PheB ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PLN02342 ornithine carbamoyltransferase | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) | Back alignment and domain information |
|---|
| >cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 | Back alignment and domain information |
|---|
| >cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04918 ACT_AK1-AT_2 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) | Back alignment and domain information |
|---|
| >PRK02255 putrescine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04916 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK08526 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK00779 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains | Back alignment and domain information |
|---|
| >COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04933 ACT_AK1-AT_1 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) | Back alignment and domain information |
|---|
| >PRK04284 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04915 ACT_AK-Ectoine_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins | Back alignment and domain information |
|---|
| >cd04923 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains | Back alignment and domain information |
|---|
| >cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein | Back alignment and domain information |
|---|
| >PRK08192 aspartate carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >COG3978 Acetolactate synthase (isozyme II), small (regulatory) subunit [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01761 thiaz-red thiazolinyl imide reductase | Back alignment and domain information |
|---|
| >COG2061 ACT-domain-containing protein, predicted allosteric regulator of homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04921 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00670 asp_carb_tr aspartate carbamoyltransferase | Back alignment and domain information |
|---|
| >COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03515 ornithine carbamoyltransferase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR02079 THD1 threonine dehydratase | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08639 threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 355 | ||||
| 3o1l_A | 302 | Crystal Structure Of A Formyltetrahydrofolate Defor | 1e-46 | ||
| 3obi_A | 288 | Crystal Structure Of A Formyltetrahydrofolate Defor | 1e-38 | ||
| 3nrb_A | 287 | Crystal Structure Of A Formyltetrahydrofolate Defor | 7e-36 | ||
| 3lou_A | 292 | Crystal Structure Of Formyltetrahydrofolate Deformy | 1e-31 | ||
| 3n0v_A | 286 | Crystal Structure Of A Formyltetrahydrofolate Defor | 2e-28 | ||
| 3kcq_A | 215 | Crystal Structure Of Phosphoribosylglycinamide Form | 2e-14 | ||
| 3p9x_A | 211 | Crystal Structure Of Phosphoribosylglycinamide Form | 1e-13 | ||
| 2ywr_A | 216 | Crystal Structure Of Gar Transformylase From Aquife | 6e-13 | ||
| 1zly_A | 203 | The Structure Of Human Glycinamide Ribonucleotide T | 8e-13 | ||
| 1meo_A | 209 | Human Glycinamide Ribonucleotide Transformylase At | 8e-13 | ||
| 1zlx_A | 203 | The Apo Structure Of Human Glycinamide Ribonucleoti | 9e-13 | ||
| 1mej_B | 223 | Human Glycinamide Ribonucleotide Transformylase Dom | 9e-13 | ||
| 3auf_A | 229 | Crystal Structure Of Glycinamide Ribonucleotide Tra | 5e-12 | ||
| 4ds3_A | 209 | Crystal Structure Of Phosphoribosylglycinamide Form | 2e-11 | ||
| 3av3_A | 212 | Crystal Structure Of Glycinamide Ribonucleotide Tra | 3e-08 | ||
| 1c3e_A | 209 | New Insights Into Inhibitor Design From The Crystal | 5e-08 | ||
| 1grc_A | 212 | Crystal Structure Of Glycinamide Ribonucleotide Tra | 5e-08 | ||
| 1cdd_A | 212 | Structures Of Apo And Complexed Escherichia Coli Gl | 5e-08 | ||
| 2gar_A | 212 | A Ph-dependent Stablization Of An Active Site Loop | 5e-08 | ||
| 4iqf_A | 317 | Crystal Structure Of Methyionyl-trna Formyltransfer | 1e-07 | ||
| 3tqr_A | 215 | Structure Of The Phosphoribosylglycinamide Formyltr | 2e-07 | ||
| 3da8_A | 215 | Crystal Structure Of Purn From Mycobacterium Tuberc | 5e-07 | ||
| 1fmt_A | 314 | Methionyl-Trnafmet Formyltransferase From Escherich | 5e-04 | ||
| 3tqq_A | 314 | Structure Of The Methionyl-Trna Formyltransferase ( | 5e-04 |
| >pdb|3O1L|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Pspto_4314) From Pseudomonas Syringae Pv. Tomato Str. Dc3000 At 2.20 A Resolution Length = 302 | Back alignment and structure |
|
| >pdb|3OBI|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Np_949368) From Rhodopseudomonas Palustris Cga009 At 1.95 A Resolution Length = 288 | Back alignment and structure |
| >pdb|3NRB|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A Resolution Length = 287 | Back alignment and structure |
| >pdb|3LOU|A Chain A, Crystal Structure Of Formyltetrahydrofolate Deformylase (yp_105254.1) From Burkholderia Mallei Atcc 23344 At 1.90 A Resolution Length = 292 | Back alignment and structure |
| >pdb|3N0V|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Pp_0327) From Pseudomonas Putida Kt2440 At 2.25 A Resolution Length = 286 | Back alignment and structure |
| >pdb|3KCQ|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Anaplasma Phagocytophilum Length = 215 | Back alignment and structure |
| >pdb|3P9X|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Bacillus Halodurans Length = 211 | Back alignment and structure |
| >pdb|2YWR|A Chain A, Crystal Structure Of Gar Transformylase From Aquifex Aeolicus Length = 216 | Back alignment and structure |
| >pdb|1ZLY|A Chain A, The Structure Of Human Glycinamide Ribonucleotide Transformylase In Complex With Alpha,beta-n- (hydroxyacetyl)-d-ribofuranosylamine And 10-formyl-5,8, Dideazafolate Length = 203 | Back alignment and structure |
| >pdb|1MEO|A Chain A, Human Glycinamide Ribonucleotide Transformylase At Ph 4.2 Length = 209 | Back alignment and structure |
| >pdb|1ZLX|A Chain A, The Apo Structure Of Human Glycinamide Ribonucleotide Transformylase Length = 203 | Back alignment and structure |
| >pdb|1MEJ|B Chain B, Human Glycinamide Ribonucleotide Transformylase Domain At Ph 8.5 Length = 223 | Back alignment and structure |
| >pdb|3AUF|A Chain A, Crystal Structure Of Glycinamide Ribonucleotide Transformylase 1 From Symbiobacterium Toebii Length = 229 | Back alignment and structure |
| >pdb|4DS3|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Brucella Melitensis Length = 209 | Back alignment and structure |
| >pdb|3AV3|A Chain A, Crystal Structure Of Glycinamide Ribonucleotide Transformylase 1 From Geobacillus Kaustophilus Length = 212 | Back alignment and structure |
| >pdb|1C3E|A Chain A, New Insights Into Inhibitor Design From The Crystal Structure And Nmr Studies Of E. Coli Gar Transformylate In Complex With Beta-Gar And 10-Formyl-5,8,10-Trideazafolic Acid. Length = 209 | Back alignment and structure |
| >pdb|1GRC|A Chain A, Crystal Structure Of Glycinamide Ribonucleotide Transformylase From Escherichia Coli At 3.0 Angstroms Resolution: A Target Enzyme For Chemotherapy Length = 212 | Back alignment and structure |
| >pdb|1CDD|A Chain A, Structures Of Apo And Complexed Escherichia Coli Glycinamide Ribonucleotide Transformylase Length = 212 | Back alignment and structure |
| >pdb|2GAR|A Chain A, A Ph-dependent Stablization Of An Active Site Loop Observed From Low And High Ph Crystal Structures Of Mutant Monomeric Glycinamide Ribonucleotide Transformylase Length = 212 | Back alignment and structure |
| >pdb|4IQF|A Chain A, Crystal Structure Of Methyionyl-trna Formyltransferase From Bacillus Anthracis Length = 317 | Back alignment and structure |
| >pdb|3TQR|A Chain A, Structure Of The Phosphoribosylglycinamide Formyltransferase (Purn) In Complex With Ches From Coxiella Burnetii Length = 215 | Back alignment and structure |
| >pdb|3DA8|A Chain A, Crystal Structure Of Purn From Mycobacterium Tuberculosis Length = 215 | Back alignment and structure |
| >pdb|1FMT|A Chain A, Methionyl-Trnafmet Formyltransferase From Escherichia Coli Length = 314 | Back alignment and structure |
| >pdb|3TQQ|A Chain A, Structure Of The Methionyl-Trna Formyltransferase (Fmt) From Coxiella Burnetii Length = 314 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 355 | |||
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 1e-129 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 1e-128 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 1e-128 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 1e-127 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 1e-123 | |
| 3kcq_A | 215 | Phosphoribosylglycinamide formyltransferase; struc | 2e-37 | |
| 3auf_A | 229 | Glycinamide ribonucleotide transformylase 1; struc | 2e-36 | |
| 3p9x_A | 211 | Phosphoribosylglycinamide formyltransferase; struc | 2e-36 | |
| 3av3_A | 212 | Phosphoribosylglycinamide formyltransferase; struc | 3e-36 | |
| 1jkx_A | 212 | GART;, phosphoribosylglycinamide formyltransferase | 4e-36 | |
| 2ywr_A | 216 | Phosphoribosylglycinamide formyltransferase; rossm | 6e-36 | |
| 4ds3_A | 209 | Phosphoribosylglycinamide formyltransferase; struc | 6e-36 | |
| 3tqr_A | 215 | Phosphoribosylglycinamide formyltransferase; purin | 8e-36 | |
| 3da8_A | 215 | Probable 5'-phosphoribosylglycinamide formyltransf | 1e-35 | |
| 1meo_A | 209 | Phosophoribosylglycinamide formyltransferase; puri | 1e-35 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-09 | |
| 1zgh_A | 260 | Methionyl-tRNA formyltransferase; southeast collab | 2e-09 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 8e-05 | |
| 2bln_A | 305 | Protein YFBG; transferase, formyltransferase, L-AR | 1e-04 |
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Length = 302 | Back alignment and structure |
|---|
Score = 370 bits (952), Expect = e-129
Identities = 125/331 (37%), Positives = 167/331 (50%), Gaps = 44/331 (13%)
Query: 30 EPIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSE 89
E+ + V CPD VGIVAK+S +AS G I A F+ R E
Sbjct: 10 HHHENLYFQGMRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHE 69
Query: 90 FIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGW 149
D + + + E F +++ F+ R+ D K +V ++AS++ HCL D L+ W
Sbjct: 70 IRADTLPFDLDGFREAFTPIAEEFSM---DWRITDSAQKKRVVLMASRESHCLADLLHRW 126
Query: 150 QEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYL-CAKEN--EREEELLELVQ--N 204
+L +I CVISNH + +E H IPY+++ ++ E+ LV
Sbjct: 127 HSDELDCDIACVISNHQ-----DLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQ 181
Query: 205 TDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHH 264
D +VLARYMQ IL + R Y VINIHH
Sbjct: 182 ADVVVLARYMQ------------------------------ILPPQLCREYAHQVINIHH 211
Query: 265 GLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMVERVSHRDNLRTFVQKS 324
LPSF G KP QA GVKLIGAT H+VTEELDAGPIIEQ V RVSHRD++ V+
Sbjct: 212 SFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVSHRDSIENMVRFG 271
Query: 325 EDVEKQCLAKAIKSYCELRVLPYEMNKTVVF 355
DVEK LA+ ++++ E RVL ++ NKTVVF
Sbjct: 272 RDVEKMVLARGLRAHLEDRVLVHD-NKTVVF 301
|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Length = 288 | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Length = 292 | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Length = 286 | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Length = 287 | Back alignment and structure |
|---|
| >3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} Length = 215 | Back alignment and structure |
|---|
| >3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Length = 229 | Back alignment and structure |
|---|
| >3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Length = 211 | Back alignment and structure |
|---|
| >3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} Length = 212 | Back alignment and structure |
|---|
| >1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Length = 212 | Back alignment and structure |
|---|
| >2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Length = 216 | Back alignment and structure |
|---|
| >4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Length = 209 | Back alignment and structure |
|---|
| >3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} Length = 215 | Back alignment and structure |
|---|
| >3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Length = 215 | Back alignment and structure |
|---|
| >1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Length = 209 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory FO structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum} SCOP: b.46.1.1 c.65.1.1 Length = 260 | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 | Back alignment and structure |
|---|
| >2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Length = 305 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 355 | |||
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 100.0 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 100.0 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 100.0 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 100.0 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 100.0 | |
| 3kcq_A | 215 | Phosphoribosylglycinamide formyltransferase; struc | 100.0 | |
| 3tqr_A | 215 | Phosphoribosylglycinamide formyltransferase; purin | 100.0 | |
| 4ds3_A | 209 | Phosphoribosylglycinamide formyltransferase; struc | 100.0 | |
| 3da8_A | 215 | Probable 5'-phosphoribosylglycinamide formyltransf | 100.0 | |
| 1meo_A | 209 | Phosophoribosylglycinamide formyltransferase; puri | 100.0 | |
| 1jkx_A | 212 | GART;, phosphoribosylglycinamide formyltransferase | 100.0 | |
| 3p9x_A | 211 | Phosphoribosylglycinamide formyltransferase; struc | 100.0 | |
| 3auf_A | 229 | Glycinamide ribonucleotide transformylase 1; struc | 100.0 | |
| 2ywr_A | 216 | Phosphoribosylglycinamide formyltransferase; rossm | 100.0 | |
| 3av3_A | 212 | Phosphoribosylglycinamide formyltransferase; struc | 100.0 | |
| 1fmt_A | 314 | Methionyl-tRNA FMet formyltransferase; initiator t | 100.0 | |
| 2bln_A | 305 | Protein YFBG; transferase, formyltransferase, L-AR | 100.0 | |
| 3q0i_A | 318 | Methionyl-tRNA formyltransferase; structural genom | 100.0 | |
| 3tqq_A | 314 | Methionyl-tRNA formyltransferase; protein synthesi | 100.0 | |
| 3rfo_A | 317 | Methionyl-tRNA formyltransferase; structural genom | 100.0 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 100.0 | |
| 2bw0_A | 329 | 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase | 100.0 | |
| 1zgh_A | 260 | Methionyl-tRNA formyltransferase; southeast collab | 99.95 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.77 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.57 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.55 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 99.53 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.52 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.43 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 98.24 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 97.53 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 97.32 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 97.17 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 97.13 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 97.08 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 97.08 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 97.04 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 96.76 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 96.44 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 96.0 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 95.81 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 95.73 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 95.62 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 95.2 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 94.19 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 93.12 | |
| 2i6u_A | 307 | Otcase, ornithine carbamoyltransferase; X-RAY crys | 92.73 | |
| 4gmf_A | 372 | Yersiniabactin biosynthetic protein YBTU; rossmann | 92.27 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 92.11 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 91.84 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 90.62 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 90.59 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 90.15 | |
| 1pvv_A | 315 | Otcase, ornithine carbamoyltransferase; dodecamer; | 90.12 | |
| 1vlv_A | 325 | Otcase, ornithine carbamoyltransferase; TM1097, st | 89.98 | |
| 3gd5_A | 323 | Otcase, ornithine carbamoyltransferase; structural | 89.31 | |
| 4ep1_A | 340 | Otcase, ornithine carbamoyltransferase; structural | 88.85 | |
| 3tpf_A | 307 | Otcase, ornithine carbamoyltransferase; structural | 88.15 | |
| 3grf_A | 328 | Ornithine carbamoyltransferase; ornithine transcar | 87.29 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 86.1 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 85.9 | |
| 1zhv_A | 134 | Hypothetical protein ATU0741; NESG, ATR8, structur | 84.3 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 84.14 | |
| 3rjz_A | 237 | N-type ATP pyrophosphatase superfamily; structural | 83.74 | |
| 1duv_G | 333 | Octase-1, ornithine transcarbamoylase; enzyme-inhi | 83.63 | |
| 1dxh_A | 335 | Ornithine carbamoyltransferase; transcarbamylase; | 83.59 | |
| 1zq6_A | 359 | Otcase, ornithine carbamoyltransferase; alpha/beta | 81.98 | |
| 4f2g_A | 309 | Otcase 1, ornithine carbamoyltransferase 1; struct | 81.7 | |
| 2w37_A | 359 | Ornithine carbamoyltransferase, catabolic; transca | 80.99 | |
| 4a8t_A | 339 | Putrescine carbamoyltransferase; trabnsferase PALO | 80.15 |
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.2e-75 Score=561.59 Aligned_cols=282 Identities=35% Similarity=0.592 Sum_probs=259.1
Q ss_pred CCCCCcccEEEEEEcCCccchHHHHHHHHHhcCCeEeEeeeeccCCCCeEEEEEEEEeC--CCCCChHHHHHHHHHHHhh
Q 018502 35 SVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFD--PIKWPREQMDEDFFKLSKM 112 (355)
Q Consensus 35 ~~~~~~~~~ILTV~GpDr~GIVA~VS~~La~~g~NIld~~q~id~~~g~F~Mr~~v~~~--~~~~~~~~L~~~l~~la~~ 112 (355)
||+..+++++||++|||||||||+||++|+++||||+|++|+.|..+|.||||++|+.+ +...+.++|+++|+++|++
T Consensus 3 ~~~~~~~~~vLtv~c~Dr~GIVa~Vs~~La~~g~NI~d~~q~~d~~~g~Ffmr~~~~~~~~~~~~~~~~L~~~f~~la~~ 82 (292)
T 3lou_A 3 SVPQRPHQFVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADALRVDALRREFEPIAER 82 (292)
T ss_dssp -----CCEEEEEEEEESCSCHHHHHHHHHHHTTEEEEEEEEEEETTTTEEEEEEEEEECC----CCHHHHHHHHHHHHHH
T ss_pred CCcCCCCcEEEEEEcCCCCCHHHHHHHHHHHCCCCEEeeEEEecCCCCceEEEEEEEccCcccCCCHHHHHHHHHHHHHh
Confidence 57677788999999999999999999999999999999999988889999999999987 5356899999999999999
Q ss_pred hhhccceeeeCCCCCCceEEEEEeCCchhHHHHHhhhhcCCCCeEEEEEEeCCCCCCCchHHHHHHHCCCCeEEeCCC-C
Q 018502 113 FNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAK-E 191 (355)
Q Consensus 113 lg~~~~~~~~~~~~~~~riavl~S~~g~~L~~ll~~~~~~~l~~eI~~Vis~~~~~~~~~v~~~a~~~gIP~~~~~~~-~ 191 (355)
++| +|++.+.++++|||||+||+||||++||++++.|+++++|++|+|||++ +.++|+++|||+++++.+ .
T Consensus 83 ~~m---~~~l~~~~~~~ri~vl~Sg~g~~l~~ll~~~~~g~l~~~i~~Visn~~~-----~~~~A~~~gIp~~~~~~~~~ 154 (292)
T 3lou_A 83 FRM---QWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVSNHPD-----FAPLAAQHGLPFRHFPITAD 154 (292)
T ss_dssp HTC---EEEEEETTSCCEEEEEECSCCHHHHHHHHHHHHTSSCCEEEEEEESSST-----THHHHHHTTCCEEECCCCSS
T ss_pred cCc---EEEeeccCCCCEEEEEEcCCCcCHHHHHHHHHcCCCCcEEEEEEeCcHH-----HHHHHHHcCCCEEEeCCCcC
Confidence 998 6899988999999999999999999999999999999999999999964 457899999999988743 2
Q ss_pred Ch--hHHHHHHHhc--CCCEEEEEeeccccchhhHhhhhhhhhhhhcccCcccccccccCChHHHhhcCCCeEEecCCCC
Q 018502 192 NE--REEELLELVQ--NTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLL 267 (355)
Q Consensus 192 ~~--~~~~~~~~l~--~~Dlivla~y~~~~~~~~~~~~~~~~~~~~~~~~~~s~y~~~il~~~~l~~~~~~~INiHpslL 267 (355)
+. .++++++.++ ++|++|+||||+ |||+++++.|++++||+|||||
T Consensus 155 ~r~~~~~~~~~~l~~~~~Dlivla~y~~------------------------------il~~~~l~~~~~~~iNiHpSlL 204 (292)
T 3lou_A 155 TKAQQEAQWLDVFETSGAELVILARYMQ------------------------------VLSPEASARLANRAINIHHSFL 204 (292)
T ss_dssp CHHHHHHHHHHHHHHHTCSEEEESSCCS------------------------------CCCHHHHHHTTTSEEEEEEECS
T ss_pred CHHHHHHHHHHHHHHhCCCEEEecCchh------------------------------hCCHHHHhhhcCCeEEeCCCcC
Confidence 22 2457888887 899999999999 9999999999999999999999
Q ss_pred CCCCCchHHHHHHHhCCcEeEEEEEEecCcCCCCCeeeeEEEeCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhCCeeee
Q 018502 268 PSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMVERVSHRDNLRTFVQKSEDVEKQCLAKAIKSYCELRVLPY 347 (355)
Q Consensus 268 P~yrG~~p~~~A~~~G~~~~G~T~H~v~~~~D~G~Ii~q~~~~I~~~dt~~~l~~k~~~~~~~~l~~~i~~~~~~~~~~~ 347 (355)
|+|||++|++||+++|++.+|+|+|+|++++|+||||.|+.++|.++||.++|.+|++++|+++++++++++++|++..+
T Consensus 205 P~~rG~~p~~~Ai~~G~~~~G~Tvh~v~~~lD~G~Ii~Q~~v~i~~~dt~~~L~~r~~~~e~~~l~~av~~~~~~~~~~~ 284 (292)
T 3lou_A 205 PGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHSYRPEQLLAVGRDVECITLARAVKAFIERRVFLN 284 (292)
T ss_dssp SCCCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECCTTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEE
T ss_pred cCCCCccHHHHHHHcCCCeEEEEEEEEcCCCcCCCEEEEEEEEcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhCCEEEc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCceeeC
Q 018502 348 EMNKTVVF 355 (355)
Q Consensus 348 ~~~~tvvf 355 (355)
+ +|||||
T Consensus 285 ~-~~~~vf 291 (292)
T 3lou_A 285 G-DRTVVF 291 (292)
T ss_dssp T-TEEEEC
T ss_pred C-CEEEEe
Confidence 6 999998
|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 | Back alignment and structure |
|---|
| >3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 | Back alignment and structure |
|---|
| >4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} | Back alignment and structure |
|---|
| >3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* | Back alignment and structure |
|---|
| >1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* | Back alignment and structure |
|---|
| >1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* | Back alignment and structure |
|---|
| >3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} | Back alignment and structure |
|---|
| >2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* 3r8x_A | Back alignment and structure |
|---|
| >2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A | Back alignment and structure |
|---|
| >3q0i_A Methionyl-tRNA formyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 1.89A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3tqq_A Methionyl-tRNA formyltransferase; protein synthesis; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A | Back alignment and structure |
|---|
| >1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory FO structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum} SCOP: b.46.1.1 c.65.1.1 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A | Back alignment and structure |
|---|
| >4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A | Back alignment and structure |
|---|
| >1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 | Back alignment and structure |
|---|
| >3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} | Back alignment and structure |
|---|
| >4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1zhv_A Hypothetical protein ATU0741; NESG, ATR8, structural genomics, PSI, protein struc initiative; 1.50A {Agrobacterium tumefaciens str} SCOP: d.58.18.8 d.58.18.8 | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A | Back alignment and structure |
|---|
| >1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* | Back alignment and structure |
|---|
| >1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A | Back alignment and structure |
|---|
| >4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} | Back alignment and structure |
|---|
| >4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 355 | ||||
| d1meoa_ | 205 | c.65.1.1 (A:) Glycinamide ribonucleotide transform | 2e-22 | |
| d1jkxa_ | 209 | c.65.1.1 (A:) Glycinamide ribonucleotide transform | 7e-21 | |
| d1zgha2 | 164 | c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransf | 3e-06 | |
| d1u8sa2 | 93 | d.58.18.5 (A:88-180) putative transcriptional repr | 4e-06 | |
| d1u8sa1 | 86 | d.58.18.5 (A:2-87) putative transcriptional repres | 9e-06 | |
| d1zpva1 | 83 | d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Strepto | 7e-05 |
| >d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} Length = 205 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Formyltransferase superfamily: Formyltransferase family: Formyltransferase domain: Glycinamide ribonucleotide transformylase, GART species: Human (Homo sapiens) [TaxId: 9606]
Score = 91.9 bits (227), Expect = 2e-22
Identities = 56/226 (24%), Positives = 85/226 (37%), Gaps = 28/226 (12%)
Query: 130 KVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCA 189
+VAVL S L + +E +I VISN ++
Sbjct: 2 RVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLY 61
Query: 190 KENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSG 249
K + + +LE S + F ILSG
Sbjct: 62 KNRVEFDSAI---------------------------DLVLEEFSIDIVCLAGFMRILSG 94
Query: 250 KFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMVE 309
F++ + ++NIH LLPSFKG +QA + GV + G T HFV E++DAG II Q
Sbjct: 95 PFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAV 154
Query: 310 RVSHRDNLRTFVQKSEDVEKQCLAKAIKSYCELRVLPYEMNKTVVF 355
V D + T ++ + E + A++ V E N + +
Sbjct: 155 PVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGE-NGKICW 199
|
| >d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]} Length = 209 | Back information, alignment and structure |
|---|
| >d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} Length = 164 | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 93 | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 86 | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 355 | |||
| d1jkxa_ | 209 | Glycinamide ribonucleotide transformylase, GART {E | 100.0 | |
| d1meoa_ | 205 | Glycinamide ribonucleotide transformylase, GART {H | 100.0 | |
| d2bw0a2 | 203 | 10-formyltetrahydrofolate dehydrogenase domain 1 { | 100.0 | |
| d1fmta2 | 206 | Methionyl-tRNAfmet formyltransferase {Escherichia | 100.0 | |
| d2blna2 | 203 | Polymyxin resistance protein ArnA, N-terminal doma | 100.0 | |
| d1zgha2 | 164 | Methionyl-tRNAfmet formyltransferase {Clostridium | 99.92 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 99.81 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 99.7 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 99.66 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 98.02 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.79 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.6 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 97.47 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 97.38 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 96.76 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 96.34 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 96.22 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 95.12 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 95.1 | |
| d2cdqa3 | 75 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 94.02 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 93.23 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 92.03 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 92.02 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 90.73 | |
| d2d13a1 | 226 | Hypothetical protein PH1257 {Archaeon Pyrococcus h | 87.31 | |
| d1ekxa2 | 160 | Aspartate carbamoyltransferase catalytic subunit { | 87.02 | |
| d1zhva2 | 66 | Hypothetical protein Atu0741 {Agrobacterium tumefa | 86.96 | |
| d1ni5a1 | 227 | tRNA-Ile-lysidine synthetase, TilS, N-terminal dom | 86.39 | |
| d1pvva2 | 163 | Ornithine transcarbamoylase {Archaeon Pyrococcus f | 80.19 |
| >d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Formyltransferase superfamily: Formyltransferase family: Formyltransferase domain: Glycinamide ribonucleotide transformylase, GART species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=3.2e-43 Score=320.95 Aligned_cols=193 Identities=28% Similarity=0.406 Sum_probs=176.9
Q ss_pred ceEEEEEeCCchhHHHHHhhhhcCCCCeEEEEEEeCCCCCCCchHHHHHHHCCCCeEEeCCCC--C--hhHHHHHHHhc-
Q 018502 129 YKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKE--N--EREEELLELVQ- 203 (355)
Q Consensus 129 ~riavl~S~~g~~L~~ll~~~~~~~l~~eI~~Vis~~~~~~~~~v~~~a~~~gIP~~~~~~~~--~--~~~~~~~~~l~- 203 (355)
+|||||+||.|++|++|+++++.++++++|++|+||++ ++...++|++.++|......+. + ..++++.+.++
T Consensus 1 MkIaVl~SG~GSnL~aLl~a~~~~~l~~~I~~Visn~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 77 (209)
T d1jkxa_ 1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKA---DAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDM 77 (209)
T ss_dssp CEEEEEESSCCHHHHHHHHHHHTTSSSSEEEEEEESCT---TCHHHHHHHHTTCEEEECCGGGCSSHHHHHHHHHHHHGG
T ss_pred CEEEEEEecCcHHHHHHHHHHHcCCCCCEEEEEEeCCC---CcccchhhhccccceeeeeccccccccchHHHHHHHHHh
Confidence 59999999999999999999999999999999999874 4578899999999998765321 1 23456777776
Q ss_pred -CCCEEEEEeeccccchhhHhhhhhhhhhhhcccCcccccccccCChHHHhhcCCCeEEecCCCCCCCCCchHHHHHHHh
Q 018502 204 -NTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDA 282 (355)
Q Consensus 204 -~~Dlivla~y~~~~~~~~~~~~~~~~~~~~~~~~~~s~y~~~il~~~~l~~~~~~~INiHpslLP~yrG~~p~~~A~~~ 282 (355)
++|++|++|||+ |+|+++++.++.++||+|||+||.|||++|++||+.+
T Consensus 78 ~~~Dliv~~g~~~------------------------------il~~~~l~~~~~~~iN~HpslLP~~rG~~p~~~~i~~ 127 (209)
T d1jkxa_ 78 YAPDVVVLAGFMR------------------------------ILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALEN 127 (209)
T ss_dssp GCCSEEEESSCCS------------------------------CCCHHHHHHTTTSEEEEESSCTTSCCSSCHHHHHHHT
T ss_pred cCCCEEEEeeeeE------------------------------ecChhhhcccccCEEEeCCchhcccCCcCchhHHHHC
Confidence 899999999999 9999999999999999999999999999999999999
Q ss_pred CCcEeEEEEEEecCcCCCCCeeeeEEEeCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhCCeeeecCCceeeC
Q 018502 283 GVKLIGATSHFVTEELDAGPIIEQMVERVSHRDNLRTFVQKSEDVEKQCLAKAIKSYCELRVLPYEMNKTVVF 355 (355)
Q Consensus 283 G~~~~G~T~H~v~~~~D~G~Ii~q~~~~I~~~dt~~~l~~k~~~~~~~~l~~~i~~~~~~~~~~~~~~~tvvf 355 (355)
|++.+|+|+|+|++++|+||||.|+.++|.++||.++|++|+.+++++++.++++.+++|++..++ +++.++
T Consensus 128 g~~~~G~t~h~~~~~~D~G~Ii~q~~~~i~~~d~~~~l~~k~~~~e~~l~~~~i~~i~~~~i~~~~-~~~~~~ 199 (209)
T d1jkxa_ 128 GDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHE-NAAWLD 199 (209)
T ss_dssp TCSEEEEEEEECCSSTTCSCEEEEEEEECCTTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEET-TEEEET
T ss_pred CCeeecceEEEecCCCCcccEeeEEEEcCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhCCeEEcC-CEEEEC
Confidence 999999999999999999999999999999999999999999999999999999999999999886 777653
|
| >d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zhva2 d.58.18.8 (A:62-127) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|