Citrus Sinensis ID: 018508

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MTTLTCSGSGTAAAVTKLAQNKIISFPKSPLFNLNGNKSKIVFPKLKLTPSVSRSPSDLSPGDPLSPSPSPSPESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFKMNLTDDADDDDDDDDDAWRERIKDADDKYWSE
ccEEEEccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccEEEEEEccccHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHcccEEEEEEEccHHHHHHHHHHHccccccEEEEccHHHHHHcccccccccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccc
ccEEEccccHHHHHHHHHHHHHEccccccccEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHccccEEEEEEccccHHHHHHHccccccEEEEEcccccccHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHcccEEEEcccccHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHHHHcccEEEEEEEccHHHHHHHHHHHccccccEEEEcccHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccccccccc
mttltcsgsgtAAAVTKLAQNKiisfpksplfnlngnkskivfpklkltpsvsrspsdlspgdplspspspspeslkyRLQSNETLYGLFLLsfsptlaeisglagyDFVVVdmehgpggiSDALACLHALAAtgtpailrlpescptwakkaldlgpqgvmfpmidspeaAKEAVsycrfppsgvrgsahTVVRasgygidegylsNYEEELLIMCQVEseegvkraediaavdgvdcvqmgpldlsasmgylwdpghRKVREMMRVAEKGvlgggkaylagfamphdaplemksrgyhmVSGAVDVGLFRSAAVEDVARFKMnltddadddddddddAWRERIKDADDKYWSE
mttltcsgsgtAAAVTKLAQNKIISfpksplfnlngNKSKIVfpklkltpsvsrspsdlspgdplspspsPSPESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFppsgvrgsahtvVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFkmnltddaddddddddDAWRERikdaddkywse
MTTLTCSGSGTAAAVTKLAQNKIISFPKSPLFNLNGNKSKIVFPKLKLTPSVSRspsdlspgdplspspspspESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFKMNLTddadddddddddaWRERIKDADDKYWSE
*************AVTKLAQNKIISFPKSPLFNLNGNKSKIVFP**************************************NETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAAVEDVARF*********************************
********SGTAAAVTKLAQ*******************************************************LKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAAVEDVA********************************W**
**********TAAAVTKLAQNKIISFPKSPLFNLNGNKSKIVFPKLKLT***************************KYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFKMNLTDDADDDDDDDDDAWRERIKDADDKYWSE
*TT*TCSGSGTAAAVTKLAQNKIISFPKSPLFNLNGNKSKIVFPKLKL******************PSPSPSPESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFKM*******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTLTCSGSGTAAAVTKLAQNKIISFPKSPLFNLNGNKSKIVFPKLKLTPSVSRSPSDLSPGDPLSPSPSPSPESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFKMNLTDDADDDDDDDDDAWRERIKDADDKYWSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query355 2.2.26 [Sep-21-2011]
B1LLJ9267 2-keto-3-deoxy-L-rhamnona yes no 0.692 0.921 0.349 2e-37
B7NN63267 2-keto-3-deoxy-L-rhamnona yes no 0.692 0.921 0.349 3e-37
P76469267 2-keto-3-deoxy-L-rhamnona N/A no 0.692 0.921 0.353 5e-37
B1IXU2267 2-keto-3-deoxy-L-rhamnona yes no 0.692 0.921 0.353 5e-37
A8A2B1267 2-keto-3-deoxy-L-rhamnona yes no 0.692 0.921 0.353 5e-37
B1X8V8267 2-keto-3-deoxy-L-rhamnona yes no 0.692 0.921 0.353 5e-37
C4ZU87267 2-keto-3-deoxy-L-rhamnona yes no 0.692 0.921 0.353 5e-37
Q0TFJ7267 2-keto-3-deoxy-L-rhamnona yes no 0.692 0.921 0.349 5e-37
B7N5L0267 2-keto-3-deoxy-L-rhamnona yes no 0.692 0.921 0.349 6e-37
Q8XE09267 2-keto-3-deoxy-L-rhamnona N/A no 0.692 0.921 0.349 1e-36
>sp|B1LLJ9|RHMA_ECOSM 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rhmA PE=3 SV=1 Back     alignment and function desciption
 Score =  156 bits (395), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 146/249 (58%), Gaps = 3/249 (1%)

Query: 76  LKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATG 135
            K RL+  E   GL+L S +  +AEI+  +GYD++++D EH P  I D    L A+A   
Sbjct: 9   FKERLRKGEVQIGLWLSSTTSYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYA 68

Query: 136 TPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVR 195
           +  ++R  E+  +  K+ LD+G Q ++ PM+D+ + A++ VS  R+PP G RG   +V R
Sbjct: 69  SQPVIRPVEASKSLIKQVLDIGAQTLLIPMVDTADQARQVVSATRYPPYGERGVGASVAR 128

Query: 196 ASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLW 255
           A+ +G  E Y+++  + L ++ QVES+  +   ++I  V+G+D V +GP DLSAS+GY  
Sbjct: 129 AARWGRIENYMAHVNDSLCLLVQVESKTALDNLDEILGVEGIDGVFIGPADLSASLGYPD 188

Query: 256 DPGHRKVREMMRVAEKGVLGGGKAYLAGF-AMPHDAPLEMKSRGYHMVSGAVDVGLFRSA 314
           + GH +V+ ++  + + +   GKA  AGF A+  D   +  + G + V+  VD  L+  A
Sbjct: 189 NAGHPEVQRIIETSIRRIRAAGKA--AGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDA 246

Query: 315 AVEDVARFK 323
             + +A FK
Sbjct: 247 LDQRLAMFK 255
Catalyzes the reversible retro-aldol cleavage of 2-keto-3-deoxy-L-rhamnonate (KDR) to pyruvate and lactaldehyde.
Escherichia coli (strain SMS-3-5 / SECEC) (taxid: 439855)
EC: 4EC: .EC: 1EC: .EC: 2EC: .EC: nEC: 3
>sp|B7NN63|RHMA_ECO7I 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rhmA PE=3 SV=1 Back     alignment and function description
>sp|P76469|RHMA_ECOLI 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain K12) GN=rhmA PE=1 SV=1 Back     alignment and function description
>sp|B1IXU2|RHMA_ECOLC 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhmA PE=3 SV=1 Back     alignment and function description
>sp|A8A2B1|RHMA_ECOHS 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O9:H4 (strain HS) GN=rhmA PE=3 SV=1 Back     alignment and function description
>sp|B1X8V8|RHMA_ECODH 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain K12 / DH10B) GN=rhmA PE=3 SV=1 Back     alignment and function description
>sp|C4ZU87|RHMA_ECOBW 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhmA PE=3 SV=1 Back     alignment and function description
>sp|Q0TFJ7|RHMA_ECOL5 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rhmA PE=3 SV=1 Back     alignment and function description
>sp|B7N5L0|RHMA_ECOLU 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rhmA PE=3 SV=1 Back     alignment and function description
>sp|Q8XE09|RHMA_ECO57 2-keto-3-deoxy-L-rhamnonate aldolase OS=Escherichia coli O157:H7 GN=rhmA PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query355
255587508357 2,4-dihydroxyhept-2-ene-1,7-dioic acid a 0.802 0.798 0.747 1e-129
225426623359 PREDICTED: 2-keto-3-deoxy-L-rhamnonate a 0.892 0.883 0.703 1e-128
15236908358 Phosphoenolpyruvate carboxylase family p 0.850 0.843 0.703 1e-121
224075213248 predicted protein [Populus trichocarpa] 0.698 1.0 0.843 1e-120
297809303358 HpcH/HpaI aldolase family protein [Arabi 0.850 0.843 0.700 1e-120
21593014358 putative aldolase [Arabidopsis thaliana] 0.850 0.843 0.700 1e-120
449456787363 PREDICTED: 2-keto-3-deoxy-L-rhamnonate a 0.780 0.763 0.682 1e-114
147827007238 hypothetical protein VITISV_034701 [Viti 0.656 0.978 0.765 1e-105
356530766351 PREDICTED: 2-keto-3-deoxy-L-rhamnonate a 0.892 0.903 0.622 1e-104
2555159248 putative aldolase [Arabidopsis thaliana] 0.664 0.951 0.724 4e-98
>gi|255587508|ref|XP_002534296.1| 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase, putative [Ricinus communis] gi|223525555|gb|EEF28088.1| 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/301 (74%), Positives = 260/301 (86%), Gaps = 16/301 (5%)

Query: 63  DPLSPSPSP----SPESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGP 118
           DP S S +P    S  SLK RL++ ETLYG+FLLSFSPTLAEISGLAGYDF VVDMEHGP
Sbjct: 65  DPTSSSTTPISAASSFSLKSRLRNGETLYGIFLLSFSPTLAEISGLAGYDFAVVDMEHGP 124

Query: 119 GGISDALACLHALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSY 178
           GGI++AL CL ALA+T TPAI+RLPE+CPTWAKKALDLGPQG+MFPM++SP+ AK+AVSY
Sbjct: 125 GGITEALNCLRALASTQTPAIIRLPETCPTWAKKALDLGPQGIMFPMVESPKMAKKAVSY 184

Query: 179 CRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVD 238
           CRFPP G+RGSAHTVVRAS YGIDEGYLSNY +ELLIMCQVESEEGVK+A++IAAVDGVD
Sbjct: 185 CRFPPEGIRGSAHTVVRASSYGIDEGYLSNYGDELLIMCQVESEEGVKKADEIAAVDGVD 244

Query: 239 CVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVL----GGGKAYLAGFAMPHDAPLEM 294
           C+QMGPLDLSASMGYLWDPGH+KVREMMR AEK VL    GGG AYLAGF+MPHD P+++
Sbjct: 245 CIQMGPLDLSASMGYLWDPGHKKVREMMRAAEKAVLGSKKGGGGAYLAGFSMPHDGPIDL 304

Query: 295 KSRGYHMVSGAVDVGLFRSAAVEDVARFKMNLTDDADDDDDDDDDAWRERIKDADDKYWS 354
           KSRGY+MV+G VDVGLFRSAAV+DV +FKM+L   +DD+++ D        KDAD+KYWS
Sbjct: 305 KSRGYNMVAGTVDVGLFRSAAVDDVKKFKMSLVQGSDDEEEHD--------KDADEKYWS 356

Query: 355 E 355
           E
Sbjct: 357 E 357

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225426623|ref|XP_002280836.1| PREDICTED: 2-keto-3-deoxy-L-rhamnonate aldolase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|15236908|ref|NP_192813.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] gi|3600031|gb|AAC35519.1| similar to 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolases [Arabidopsis thaliana] gi|7267773|emb|CAB81176.1| putative aldolase [Arabidopsis thaliana] gi|26451478|dbj|BAC42838.1| putative aldolase [Arabidopsis thaliana] gi|29824141|gb|AAP04031.1| putative aldolase [Arabidopsis thaliana] gi|332657524|gb|AEE82924.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224075213|ref|XP_002304576.1| predicted protein [Populus trichocarpa] gi|222842008|gb|EEE79555.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297809303|ref|XP_002872535.1| HpcH/HpaI aldolase family protein [Arabidopsis lyrata subsp. lyrata] gi|297318372|gb|EFH48794.1| HpcH/HpaI aldolase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21593014|gb|AAM64963.1| putative aldolase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449456787|ref|XP_004146130.1| PREDICTED: 2-keto-3-deoxy-L-rhamnonate aldolase-like [Cucumis sativus] gi|449495022|ref|XP_004159712.1| PREDICTED: 2-keto-3-deoxy-L-rhamnonate aldolase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147827007|emb|CAN62284.1| hypothetical protein VITISV_034701 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356530766|ref|XP_003533951.1| PREDICTED: 2-keto-3-deoxy-L-rhamnonate aldolase-like [Glycine max] Back     alignment and taxonomy information
>gi|2555159|gb|AAB81520.1| putative aldolase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query355
TAIR|locus:2132726358 AT4G10750 [Arabidopsis thalian 0.878 0.871 0.666 1e-107
UNIPROTKB|P76469267 yfaU [Escherichia coli K-12 (t 0.690 0.917 0.354 2.7e-36
TIGR_CMR|SPO_3686256 SPO_3686 "HpcH/HpaI aldolase f 0.642 0.890 0.360 6.9e-31
UNIPROTKB|P23522256 garL [Escherichia coli K-12 (t 0.687 0.953 0.314 1.6e-29
ASPGD|ASPL0000032581266 AN5544 [Emericella nidulans (t 0.557 0.744 0.333 2e-24
ASPGD|ASPL0000014882252 AN3701 [Emericella nidulans (t 0.554 0.781 0.313 8e-21
ASPGD|ASPL0000051499273 AN9425 [Emericella nidulans (t 0.681 0.886 0.270 8.3e-19
ASPGD|ASPL0000029302277 AN5295 [Emericella nidulans (t 0.501 0.642 0.285 2.2e-15
TAIR|locus:213499166 AT4G24070 "AT4G24070" [Arabido 0.166 0.893 0.555 1.2e-11
TAIR|locus:2132726 AT4G10750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1065 (380.0 bits), Expect = 1.0e-107, P = 1.0e-107
 Identities = 216/324 (66%), Positives = 241/324 (74%)

Query:    38 KSKIVFPKLKLTP-SVSRXXXXXXXXXXXXXXXXXXXESLKYRLQSNETLYGLFLLSFSP 96
             KS + F +  LTP   S                     SLK RL+  ETLYGLFLLSFSP
Sbjct:    41 KSSVSFSRKTLTPIRYSSSPADHSPATAVEAITNRSKTSLKSRLRGGETLYGLFLLSFSP 100

Query:    97 TLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAKKALDL 156
             TLAEI+  AGYD+VVVDMEHGPGGI +AL C+ AL A GT AILRLPE+ PTWAKKALDL
Sbjct:   101 TLAEIAAHAGYDYVVVDMEHGPGGIPEALDCIRALNAAGTSAILRLPENSPTWAKKALDL 160

Query:   157 GPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIM 216
             GPQG+MFPMI+S + A +AVSYCRFPP G+RGSAHTVVRAS YGIDEGYLSNY EE+LIM
Sbjct:   161 GPQGIMFPMIESRKDATKAVSYCRFPPDGIRGSAHTVVRASNYGIDEGYLSNYAEEILIM 220

Query:   217 CQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVL-- 274
             CQVES EGVK+A++IAAVDGVDCVQMGPLDLSAS+GYLWDPGH+KVREMM+ AEK VL  
Sbjct:   221 CQVESGEGVKKADEIAAVDGVDCVQMGPLDLSASLGYLWDPGHKKVREMMKKAEKSVLTT 280

Query:   275 --GGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAAVEDVARFKMNLTXXXXX 332
                 G AYL+GFAMPHD   E++ RGYHMV+GAVDVGLFR+AAVEDV RFKM L      
Sbjct:   281 DPAKGGAYLSGFAMPHDGAGEIRGRGYHMVAGAVDVGLFRNAAVEDVRRFKMGLVNESDS 340

Query:   333 XXXXXXXXWRERIKDADD-KYWSE 355
                       E  KD DD KYWSE
Sbjct:   341 EDSS------EHDKDVDDEKYWSE 358
GO:0003824 "catalytic activity" evidence=IEA
GO:0006725 "cellular aromatic compound metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016830 "carbon-carbon lyase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009536 "plastid" evidence=IDA
UNIPROTKB|P76469 yfaU [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3686 SPO_3686 "HpcH/HpaI aldolase family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P23522 garL [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
ASPGD|ASPL0000032581 AN5544 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000014882 AN3701 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000051499 AN9425 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000029302 AN5295 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2134991 AT4G24070 "AT4G24070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query355
COG3836255 COG3836, HpcH, 2,4-dihydroxyhept-2-ene-1,7-dioic a 2e-64
pfam03328221 pfam03328, HpcH_HpaI, HpcH/HpaI aldolase/citrate l 2e-59
TIGR02311249 TIGR02311, HpaI, 2,4-dihydroxyhept-2-ene-1,7-dioic 2e-50
PRK10558256 PRK10558, PRK10558, alpha-dehydro-beta-deoxy-D-glu 1e-48
TIGR03239249 TIGR03239, GarL, 2-dehydro-3-deoxyglucarate aldola 3e-47
PRK10128267 PRK10128, PRK10128, 2-keto-3-deoxy-L-rhamnonate al 5e-46
>gnl|CDD|226356 COG3836, HpcH, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information 
 Score =  204 bits (522), Expect = 2e-64
 Identities = 91/255 (35%), Positives = 138/255 (54%), Gaps = 3/255 (1%)

Query: 70  SPSPESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLH 129
                S K  L +     GL+L    P +AEI   AG+D++++D EH P  +   L  L 
Sbjct: 2   DAPQNSFKAALAAGRPQIGLWLSLPDPYMAEILATAGFDWLLIDGEHAPNDLQSLLHQLQ 61

Query: 130 ALAATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGS 189
           A+AA  +P ++R P   P   K+ LD+G Q ++ PM+D+ E A++AV+  R+PP G RG 
Sbjct: 62  AVAAYASPPVVRPPVGDPVMIKQLLDIGAQTLLIPMVDTAEQARQAVAATRYPPLGERGV 121

Query: 190 AHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSA 249
              + RAS +G    YL+   +E+ ++ Q+E+  G+   + IAAV+GVD V +GP DL+A
Sbjct: 122 GSALARASRFGRIADYLAQANDEICLLVQIETRAGLDNLDAIAAVEGVDGVFIGPADLAA 181

Query: 250 SMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLE-MKSRGYHMVSGAVDV 308
           S+G+L +PGH +V+  +      +   GKA  AG      A      + G   V+   D 
Sbjct: 182 SLGHLGNPGHPEVQAAIEHIIARIRAAGKA--AGILAADPADARRYLALGATFVAVGSDT 239

Query: 309 GLFRSAAVEDVARFK 323
           GL R AA   +A FK
Sbjct: 240 GLLRRAAEALLAAFK 254

Length = 255
>gnl|CDD|202594 pfam03328, HpcH_HpaI, HpcH/HpaI aldolase/citrate lyase family Back     alignment and domain information
>gnl|CDD|131364 TIGR02311, HpaI, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>gnl|CDD|182547 PRK10558, PRK10558, alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|132283 TIGR03239, GarL, 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>gnl|CDD|182257 PRK10128, PRK10128, 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 355
COG3836255 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 100.0
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 100.0
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 100.0
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 100.0
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 100.0
PF03328221 HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family 100.0
TIGR01588288 citE citrate lyase, beta subunit. This is a model 100.0
TIGR01417565 PTS_I_fam phosphoenolpyruvate-protein phosphotrans 99.95
PRK11177575 phosphoenolpyruvate-protein phosphotransferase; Pr 99.94
COG2301283 CitE Citrate lyase beta subunit [Carbohydrate tran 99.93
PRK06464795 phosphoenolpyruvate synthase; Validated 99.91
TIGR01418782 PEP_synth phosphoenolpyruvate synthase. Also calle 99.91
COG1080574 PtsA Phosphoenolpyruvate-protein kinase (PTS syste 99.86
PRK11061748 fused phosphoenolpyruvate-protein phosphotransfera 99.83
PF02896293 PEP-utilizers_C: PEP-utilising enzyme, TIM barrel 99.82
TIGR01344 511 malate_syn_A malate synthase A. This model represe 99.74
cd00480 511 malate_synt Malate synthase catalyzes the Claisen 99.74
cd00727 511 malate_synt_A Malate synthase A (MSA), present in 99.74
PRK09255 531 malate synthase; Validated 99.73
PRK05826 465 pyruvate kinase; Provisional 99.69
TIGR01064 473 pyruv_kin pyruvate kinase. This enzyme is a homote 99.66
PTZ00300 454 pyruvate kinase; Provisional 99.66
TIGR01828856 pyru_phos_dikin pyruvate, phosphate dikinase. This 99.65
PLN02623 581 pyruvate kinase 99.63
PRK09279879 pyruvate phosphate dikinase; Provisional 99.62
COG3605756 PtsP Signal transduction protein containing GAF an 99.47
cd00288 480 Pyruvate_Kinase Pyruvate kinase (PK): Large allost 99.46
PRK09206 470 pyruvate kinase; Provisional 99.38
PRK06354 590 pyruvate kinase; Provisional 99.34
PRK06247 476 pyruvate kinase; Provisional 99.29
PRK08187493 pyruvate kinase; Validated 99.24
PLN02626 551 malate synthase 99.23
PF00224348 PK: Pyruvate kinase, barrel domain; InterPro: IPR0 98.95
PRK06739352 pyruvate kinase; Validated 98.91
PTZ00066 513 pyruvate kinase; Provisional 98.84
PLN02762 509 pyruvate kinase complex alpha subunit 98.81
PLN02461 511 Probable pyruvate kinase 98.79
PLN02765 526 pyruvate kinase 98.75
PRK14725608 pyruvate kinase; Provisional 98.52
COG0469 477 PykF Pyruvate kinase [Carbohydrate transport and m 98.39
COG0574740 PpsA Phosphoenolpyruvate synthase/pyruvate phospha 98.37
PF15617345 C-C_Bond_Lyase: C-C_Bond_Lyase of the TIM-Barrel f 98.25
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 97.86
PF01274 526 Malate_synthase: Malate synthase; InterPro: IPR001 97.71
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 97.65
PRK05581220 ribulose-phosphate 3-epimerase; Validated 97.55
KOG2323 501 consensus Pyruvate kinase [Carbohydrate transport 97.53
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 97.5
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 97.48
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 97.47
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 97.24
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 97.2
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 97.18
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 97.16
COG2225 545 AceB Malate synthase [Energy production and conver 97.1
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 97.04
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.02
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 97.01
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 96.85
PRK13655 494 phosphoenolpyruvate carboxylase; Provisional 96.8
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 96.8
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 96.79
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 96.73
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 96.69
TIGR02751 506 PEPCase_arch phosphoenolpyruvate carboxylase, arch 96.57
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 96.43
PF14010 491 PEPcase_2: Phosphoenolpyruvate carboxylase; PDB: 3 96.4
PLN02334229 ribulose-phosphate 3-epimerase 96.29
PLN02591250 tryptophan synthase 96.27
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 96.24
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 96.18
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 96.17
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 96.13
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 96.09
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 96.09
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 96.02
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 96.01
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 96.0
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 95.9
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 95.87
TIGR01345 721 malate_syn_G malate synthase G. This model describ 95.76
PRK14057254 epimerase; Provisional 95.76
PRK08091228 ribulose-phosphate 3-epimerase; Validated 95.66
PRK02999 726 malate synthase G; Provisional 95.47
cd00728 712 malate_synt_G Malate synthase G (MSG), monomeric e 95.36
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 95.33
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 95.21
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 95.21
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 95.14
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 95.1
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 95.1
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 95.05
PRK08005210 epimerase; Validated 94.99
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 94.98
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 94.92
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 94.86
PLN02274505 inosine-5'-monophosphate dehydrogenase 94.82
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 94.67
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 94.66
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 94.65
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 94.62
PRK04302223 triosephosphate isomerase; Provisional 94.61
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 94.53
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 94.5
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 94.41
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 94.39
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 94.37
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 94.18
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 94.06
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 93.85
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 93.78
PF01959354 DHQS: 3-dehydroquinate synthase (EC 4.6.1.3); Inte 93.54
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 93.54
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.4
COG1892 488 Phosphoenolpyruvate carboxylase [Carbohydrate tran 93.37
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 93.36
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 93.29
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 93.22
KOG1261 552 consensus Malate synthase [Energy production and c 93.21
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 93.21
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 93.08
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 93.06
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 92.63
PRK15452 443 putative protease; Provisional 92.57
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 92.46
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 92.38
PRK07695201 transcriptional regulator TenI; Provisional 92.36
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 92.33
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 92.29
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 92.1
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 92.04
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 91.87
PF00072112 Response_reg: Response regulator receiver domain; 91.84
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 91.8
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 91.77
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 91.76
PRK02290344 3-dehydroquinate synthase; Provisional 91.42
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 91.22
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 91.19
PRK06801286 hypothetical protein; Provisional 91.11
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 91.07
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 91.02
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 90.93
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 90.74
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 90.68
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 90.67
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 90.51
COG2197211 CitB Response regulator containing a CheY-like rec 90.5
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 90.2
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 90.18
PTZ00398 974 phosphoenolpyruvate carboxylase; Provisional 90.17
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 89.88
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 89.67
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 89.57
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 89.52
PRK06852304 aldolase; Validated 89.43
PRK04302223 triosephosphate isomerase; Provisional 89.39
PRK00009 911 phosphoenolpyruvate carboxylase; Reviewed 89.32
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 89.29
PLN02274505 inosine-5'-monophosphate dehydrogenase 89.06
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 88.7
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 88.63
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 88.5
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 88.5
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 88.44
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 88.32
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 88.21
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 88.19
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 88.02
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 87.66
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 87.58
PRK07226267 fructose-bisphosphate aldolase; Provisional 87.38
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 87.35
PRK08185283 hypothetical protein; Provisional 87.34
PRK10840216 transcriptional regulator RcsB; Provisional 87.19
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 87.15
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 87.12
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 86.88
PRK06806281 fructose-bisphosphate aldolase; Provisional 86.8
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 86.76
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 86.73
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 86.63
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 86.45
PRK05835307 fructose-bisphosphate aldolase; Provisional 86.29
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 86.16
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 86.01
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 86.01
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 85.96
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 85.65
PRK08227264 autoinducer 2 aldolase; Validated 85.55
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 85.54
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 85.43
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 85.34
PRK09016296 quinolinate phosphoribosyltransferase; Validated 85.13
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 85.09
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 85.08
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 84.95
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 84.56
PRK08999312 hypothetical protein; Provisional 84.53
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 84.49
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 84.36
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 84.36
PRK07315293 fructose-bisphosphate aldolase; Provisional 84.31
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 84.27
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 84.16
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 84.14
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 83.91
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 83.88
PRK10046225 dpiA two-component response regulator DpiA; Provis 83.83
PRK06096284 molybdenum transport protein ModD; Provisional 83.36
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 83.31
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 83.23
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 83.15
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 83.05
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 83.01
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 82.73
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 82.66
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 82.65
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 82.23
PRK07709285 fructose-bisphosphate aldolase; Provisional 82.04
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 81.65
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 81.55
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 81.55
PRK09250348 fructose-bisphosphate aldolase; Provisional 81.5
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 81.37
TIGR00419205 tim triosephosphate isomerase. Triosephosphate iso 81.36
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 81.34
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 81.32
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 81.32
PRK14565237 triosephosphate isomerase; Provisional 81.17
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 81.04
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 81.01
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 80.68
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 80.65
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 80.48
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 80.16
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 80.11
>COG3836 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.6e-62  Score=450.76  Aligned_cols=252  Identities=35%  Similarity=0.565  Sum_probs=244.9

Q ss_pred             CCchHHHHHHHcCCcEEEEEEecCCHHHHHHhhhcCCcEEEEeCCCCCCCHHHHHHHHHHHHhCCCCeEEcCCCCCHHHH
Q 018508           71 PSPESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWA  150 (355)
Q Consensus        71 ~~~n~lk~~L~~G~~~~gl~v~~~sp~~~e~aa~~G~D~vilDlEh~~~~~~~a~~~i~a~~~~g~~~iVRV~~~~~~~i  150 (355)
                      ..+|+||++|++|++++|+|+.+++|..+|+++.+||||++||+||+|.+.+...++++++..++.+|+||++..++..|
T Consensus         3 ~~~n~fK~~L~~g~~qiGlw~~l~~p~~~Ei~A~aGfDwl~iD~EHapnd~~sl~~qL~a~~~~~~~pvVR~p~g~~~~I   82 (255)
T COG3836           3 APQNSFKAALAAGRPQIGLWLSLPDPYMAEILATAGFDWLLIDGEHAPNDLQSLLHQLQAVAAYASPPVVRPPVGDPVMI   82 (255)
T ss_pred             cccchHHHHHhCCCceEEeeecCCcHHHHHHHHhcCCCEEEecccccCccHHHHHHHHHHhhccCCCCeeeCCCCCHHHH
Confidence            36799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCeEeecCCCCHHHHHHHHHHcCCCCCCCCCCcccccccccCCCCccccccCCCceEEEEEEccHHHHHHHHH
Q 018508          151 KKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAED  230 (355)
Q Consensus       151 ~~aLdaGa~GImvP~Vesaeea~~vv~a~~~pP~G~Rg~g~~~~ra~~~g~~~~y~~~~n~~i~vi~mIET~~av~niee  230 (355)
                      +++||.|++++++|||+|+||++++|+++||||.|.||+|....|+++||...+|++++|+++++++||||.+||+|+|+
T Consensus        83 kq~LD~GAqtlliPmV~s~eqAr~~V~A~rYPP~G~Rgvg~~~arAsr~~~i~dyl~~An~~~~~lvqiEtr~gl~nLDa  162 (255)
T COG3836          83 KQLLDIGAQTLLIPMVDTAEQARQAVAATRYPPLGERGVGSALARASRFGRIADYLAQANDEICLLVQIETRAGLDNLDA  162 (255)
T ss_pred             HHHHccccceeeeeccCCHHHHHHHHHhccCCCCCccccchhhhhhhhcCCHHHHHHhcccceEEEEEEccHHHHHHHHH
Confidence            99999999999999999999999999999999999999998889999999778999999999999999999999999999


Q ss_pred             HhccCCccEEEEChhhHHhhcCCCCCCCCHHHHHHHHHHHHHHHhCCCceeecccCCchhHHHHHHCCCCEEEecchHHH
Q 018508          231 IAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGL  310 (355)
Q Consensus       231 IaavpgVD~l~iGp~DLs~slG~~~~~~~p~v~~ai~~iv~aa~a~g~~~~g~~~~d~~~a~~~~~~G~~~vs~~~D~~l  310 (355)
                      |++++|||+||+||.||+++||+++++.||+|++++++++.+++++||. .|.++.+++.+++|+++|++|+.+|+|+++
T Consensus       163 IaaveGVDgvFiGPaDLaas~G~~gn~~hpeV~~aI~~~~~~i~aaGKa-agil~~~p~~a~~yl~lGa~fvavG~D~~l  241 (255)
T COG3836         163 IAAVEGVDGVFIGPADLAASLGHLGNPGHPEVQAAIEHIIARIRAAGKA-AGILAADPADARRYLALGATFVAVGSDTGL  241 (255)
T ss_pred             HHccCCCCeEEECHHHHHHHcCCCCCCCCHHHHHHHHHHHHHHHhcCCc-cccccCCHHHHHHHHHhCCeEEEEeccHHH
Confidence            9999999999999999999999999999999999999999999999975 567889999999999999999999999999


Q ss_pred             HHHHHHHHHHHHH
Q 018508          311 FRSAAVEDVARFK  323 (355)
Q Consensus       311 l~~~~~~~~~~~r  323 (355)
                      +.+++++.++.||
T Consensus       242 ~~~a~~~l~~~fk  254 (255)
T COG3836         242 LRRAAEALLAAFK  254 (255)
T ss_pred             HHHHHHHHHHHhc
Confidence            9999999999887

>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PF03328 HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family; InterPro: IPR005000 This family includes 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (4 Back     alignment and domain information
>TIGR01588 citE citrate lyase, beta subunit Back     alignment and domain information
>TIGR01417 PTS_I_fam phosphoenolpyruvate-protein phosphotransferase Back     alignment and domain information
>PRK11177 phosphoenolpyruvate-protein phosphotransferase; Provisional Back     alignment and domain information
>COG2301 CitE Citrate lyase beta subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06464 phosphoenolpyruvate synthase; Validated Back     alignment and domain information
>TIGR01418 PEP_synth phosphoenolpyruvate synthase Back     alignment and domain information
>COG1080 PtsA Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11061 fused phosphoenolpyruvate-protein phosphotransferase PtsP/GAF domain; Provisional Back     alignment and domain information
>PF02896 PEP-utilizers_C: PEP-utilising enzyme, TIM barrel domain; InterPro: IPR000121 A number of enzymes that catalyze the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) via a phospho-histidine intermediate have been shown to be structurally related [, , , ] Back     alignment and domain information
>TIGR01344 malate_syn_A malate synthase A Back     alignment and domain information
>cd00480 malate_synt Malate synthase catalyzes the Claisen condensation of glyoxylate and acetyl-CoA to malyl-CoA , which hydrolyzes to malate and CoA Back     alignment and domain information
>cd00727 malate_synt_A Malate synthase A (MSA), present in some bacteria, plants and fungi Back     alignment and domain information
>PRK09255 malate synthase; Validated Back     alignment and domain information
>PRK05826 pyruvate kinase; Provisional Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information
>PTZ00300 pyruvate kinase; Provisional Back     alignment and domain information
>TIGR01828 pyru_phos_dikin pyruvate, phosphate dikinase Back     alignment and domain information
>PLN02623 pyruvate kinase Back     alignment and domain information
>PRK09279 pyruvate phosphate dikinase; Provisional Back     alignment and domain information
>COG3605 PtsP Signal transduction protein containing GAF and PtsI domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00288 Pyruvate_Kinase Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors Back     alignment and domain information
>PRK09206 pyruvate kinase; Provisional Back     alignment and domain information
>PRK06354 pyruvate kinase; Provisional Back     alignment and domain information
>PRK06247 pyruvate kinase; Provisional Back     alignment and domain information
>PRK08187 pyruvate kinase; Validated Back     alignment and domain information
>PLN02626 malate synthase Back     alignment and domain information
>PF00224 PK: Pyruvate kinase, barrel domain; InterPro: IPR015793 Pyruvate kinase (2 Back     alignment and domain information
>PRK06739 pyruvate kinase; Validated Back     alignment and domain information
>PTZ00066 pyruvate kinase; Provisional Back     alignment and domain information
>PLN02762 pyruvate kinase complex alpha subunit Back     alignment and domain information
>PLN02461 Probable pyruvate kinase Back     alignment and domain information
>PLN02765 pyruvate kinase Back     alignment and domain information
>PRK14725 pyruvate kinase; Provisional Back     alignment and domain information
>COG0469 PykF Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0574 PpsA Phosphoenolpyruvate synthase/pyruvate phosphate dikinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF15617 C-C_Bond_Lyase: C-C_Bond_Lyase of the TIM-Barrel fold Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PF01274 Malate_synthase: Malate synthase; InterPro: IPR001465 Malate synthase (2 Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>KOG2323 consensus Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>COG2225 AceB Malate synthase [Energy production and conversion] Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK13655 phosphoenolpyruvate carboxylase; Provisional Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02751 PEPCase_arch phosphoenolpyruvate carboxylase, archaeal type Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PF14010 PEPcase_2: Phosphoenolpyruvate carboxylase; PDB: 3ODM_C Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>TIGR01345 malate_syn_G malate synthase G Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK02999 malate synthase G; Provisional Back     alignment and domain information
>cd00728 malate_synt_G Malate synthase G (MSG), monomeric enzyme present in some bacteria Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PF01959 DHQS: 3-dehydroquinate synthase (EC 4 Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG1892 Phosphoenolpyruvate carboxylase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>KOG1261 consensus Malate synthase [Energy production and conversion] Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PRK02290 3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PTZ00398 phosphoenolpyruvate carboxylase; Provisional Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK00009 phosphoenolpyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query355
2vws_A267 Crystal Structure Of Yfau, A Metal Ion Dependent Cl 2e-38
1dxf_A256 2-Dehydro-3-Deoxy-Galactarate Aldolase From Escheri 2e-31
1dxe_A256 2-Dehydro-3-Deoxy-Galactarate Aldolase From Escheri 5e-31
4b5v_A251 Crystal Structures Of Divalent Metal Dependent Pyru 5e-30
4b5s_A251 Crystal Structures Of Divalent Metal Dependent Pyru 6e-30
2v5j_A287 Apo Class Ii Aldolase Hpch Length = 287 6e-30
4b5w_A256 Crystal Structures Of Divalent Metal Dependent Pyru 4e-29
4b5x_A262 Crystal Structures Of Divalent Metal Dependent Pyru 5e-29
3qz6_A261 The Crystal Structure Of HpchHPAI ALDOLASE FROM DES 7e-20
1izc_A339 Crystal Structure Analysis Of Macrophomate Synthase 4e-07
>pdb|2VWS|A Chain A, Crystal Structure Of Yfau, A Metal Ion Dependent Class Ii Aldolase From Escherichia Coli K12 Length = 267 Back     alignment and structure 
Iteration: 1

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 143/249 (57%), Gaps = 3/249 (1%)
Query: 76  LKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATG 135
            K RL+  E   GL+L S +  +AEI+  +GYD++++D EH P  I D    L A+A   
Sbjct: 9   FKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYA 68
Query: 136 TPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVR 195
           +  ++R  E      K+ LD+G Q ++ PM+D+ E A++ VS  R+PP G RG   +V R
Sbjct: 69  SQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVAR 128
Query: 196 ASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLW 255
           A+ +G  E Y++   + L ++ QVES+  +   ++I  V+G+D V +GP DLSAS+GY  
Sbjct: 129 AARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPD 188
Query: 256 DPGHRKVREMMRVAEKGVLGGGKAYLAGF-AMPHDAPLEMKSRGYHMVSGAVDVGLFRSA 314
           + GH +V+ ++  + + +   GKA  AGF A+  D   +  + G + V+  VD  L+  A
Sbjct: 189 NAGHPEVQRIIETSIRRIRAAGKA--AGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDA 246
Query: 315 AVEDVARFK 323
             + +A FK
Sbjct: 247 LDQRLAMFK 255
>pdb|1DXF|A Chain A, 2-Dehydro-3-Deoxy-Galactarate Aldolase From Escherichia Coli In Complex With Pyruvate Length = 256 Back     alignment and structure
>pdb|1DXE|A Chain A, 2-Dehydro-3-Deoxy-Galactarate Aldolase From Escherichia Coli Length = 256 Back     alignment and structure
>pdb|4B5V|A Chain A, Crystal Structures Of Divalent Metal Dependent Pyruvate Aldolase, Hpai, In Complex With 4-hydroxyl-2-ketoheptane-1,7-dioate Length = 251 Back     alignment and structure
>pdb|4B5S|A Chain A, Crystal Structures Of Divalent Metal Dependent Pyruvate Aldolase, Hpai, In Complex With Pyruvate Length = 251 Back     alignment and structure
>pdb|2V5J|A Chain A, Apo Class Ii Aldolase Hpch Length = 287 Back     alignment and structure
>pdb|4B5W|A Chain A, Crystal Structures Of Divalent Metal Dependent Pyruvate Aldolase R70a Mutant, Hpai, In Complex With Pyruvate Length = 256 Back     alignment and structure
>pdb|4B5X|A Chain A, Crystal Structures Of Divalent Metal Dependent Pyruvate Aldolase (Hpai), Mutant D42a Length = 262 Back     alignment and structure
>pdb|3QZ6|A Chain A, The Crystal Structure Of HpchHPAI ALDOLASE FROM DESULFITOBACTERIUM Hafniense Dcb-2 Length = 261 Back     alignment and structure
>pdb|1IZC|A Chain A, Crystal Structure Analysis Of Macrophomate Synthase Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query355
2vws_A267 YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escher 1e-94
2v5j_A287 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; l 2e-94
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II a 2e-91
3qz6_A261 HPCH/HPAI aldolase; structural genomics, PSI-biolo 3e-91
1izc_A339 Macrophomate synthase intermolecular diels-aldera; 2e-83
1sgj_A284 Citrate lyase, beta subunit; trimer, TIM barrel, s 6e-07
3qll_A316 Citrate lyase; beta barrel; 2.45A {Yersinia pestis 4e-06
3qqw_A332 Putative citrate lyase; TIM beta/alpha-barrel, str 8e-06
3r4i_A339 Citrate lyase; TIM beta/alpha-barrel, structural g 4e-05
1u5h_A273 CITE; TIM barrel, structural genomics, PSI, protei 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, 2-keto-3-deoxy SU aldolase, degradation of homoprotocatechuate; 1.39A {Escherichia coli} PDB: 2vwt_A Length = 267 Back     alignment and structure
 Score =  281 bits (722), Expect = 1e-94
 Identities = 85/248 (34%), Positives = 140/248 (56%), Gaps = 1/248 (0%)

Query: 76  LKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATG 135
            K RL+  E   GL+L S +  +AEI+  +GYD++++D EH P  I D    L A+A   
Sbjct: 9   FKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYA 68

Query: 136 TPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVR 195
           +  ++R  E      K+ LD+G Q ++ PM+D+ E A++ VS  R+PP G RG   +V R
Sbjct: 69  SQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVAR 128

Query: 196 ASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMGYLW 255
           A+ +G  E Y++   + L ++ QVES+  +   ++I  V+G+D V +GP DLSAS+GY  
Sbjct: 129 AARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPD 188

Query: 256 DPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFRSAA 315
           + GH +V+ ++  + + +   GKA     A+  D   +  + G + V+  VD  L+  A 
Sbjct: 189 NAGHPEVQRIIETSIRRIRAAGKA-AGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDAL 247

Query: 316 VEDVARFK 323
            + +A FK
Sbjct: 248 DQRLAMFK 255
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic DEGR aromatic hydrocarbons catabolism; 1.60A {Escherichia coli} PDB: 2v5k_A Length = 287 Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Length = 256 Back     alignment and structure
>3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} Length = 261 Back     alignment and structure
>1izc_A Macrophomate synthase intermolecular diels-aldera; TIM-barrel, pyruvate Mg(II) complex, lyase; 1.70A {Macrophoma commelinae} SCOP: c.1.12.5 Length = 339 Back     alignment and structure
>1sgj_A Citrate lyase, beta subunit; trimer, TIM barrel, structural genomics, PSI, protein structure initiative; 1.84A {Deinococcus radiodurans} SCOP: c.1.12.5 Length = 284 Back     alignment and structure
>3qll_A Citrate lyase; beta barrel; 2.45A {Yersinia pestis} Length = 316 Back     alignment and structure
>3qqw_A Putative citrate lyase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.44A {Ralstonia eutropha} Length = 332 Back     alignment and structure
>3r4i_A Citrate lyase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.24A {Burkholderia xenovorans} Length = 339 Back     alignment and structure
>1u5h_A CITE; TIM barrel, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC, lyase; 1.65A {Mycobacterium tuberculosis} SCOP: c.1.12.5 PDB: 1u5v_A* 1z6k_A Length = 273 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query355
3qz6_A261 HPCH/HPAI aldolase; structural genomics, PSI-biolo 100.0
2v5j_A287 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; l 100.0
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II a 100.0
2vws_A267 YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escher 100.0
1izc_A339 Macrophomate synthase intermolecular diels-aldera; 100.0
1sgj_A284 Citrate lyase, beta subunit; trimer, TIM barrel, s 100.0
2xz9_A324 Phosphoenolpyruvate-protein kinase (PTS system EI 100.0
1u5h_A273 CITE; TIM barrel, structural genomics, PSI, protei 100.0
3qll_A316 Citrate lyase; beta barrel; 2.45A {Yersinia pestis 100.0
3qqw_A332 Putative citrate lyase; TIM beta/alpha-barrel, str 99.97
2hwg_A575 Phosphoenolpyruvate-protein phosphotransferase; en 99.97
2wqd_A572 Phosphoenolpyruvate-protein phosphotransferase; ki 99.97
3r4i_A339 Citrate lyase; TIM beta/alpha-barrel, structural g 99.97
3oyz_A 433 Malate synthase; TIM barrel, transferase; HET: ACO 99.94
2ols_A794 Phosphoenolpyruvate synthase; MC structural genomi 99.92
1vbg_A876 Pyruvate,orthophosphate dikinase; transferase, mai 99.76
3cux_A 528 Malate synthase; TIM barrel, glyoxylate bypass, tr 99.74
3cuz_A 532 MSA, malate synthase A; TIM barrel, cytoplasm, gly 99.73
1a3w_A 500 Pyruvate kinase; allosteric regulation, tranferase 99.72
1kbl_A873 PPDK, pyruvate phosphate dikinase; transferase, ph 99.7
1h6z_A913 Pyruvate phosphate dikinase; transferase, tropical 99.66
2x0s_A913 Pyruvate phosphate dikinase; transferase, tropical 99.62
1p7t_A 731 MSG, malate synthase G; TIM barrel, glyoxylate cyc 99.58
1e0t_A 470 Pyruvate kinase, PK; phosphotransferase, glycolysi 99.56
2e28_A 587 Pyruvate kinase, PK; allosteric, transferase; 2.40 99.56
3gr4_A 550 Pyruvate kinase isozymes M1/M2; activator, acetyla 99.44
3hqn_D 499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, t 99.43
3qtg_A461 Pyruvate kinase, PK; TIM barrel, glycolysis, trans 99.4
3khd_A 520 Pyruvate kinase; malaria, structural genomics, str 99.34
3gg8_A 511 Pyruvate kinase; malaria, genomics, proteomics, gl 99.28
3t05_A 606 Pyruvate kinase, PK; tetramer, glycolysis, transfe 99.27
4drs_A 526 Pyruvate kinase; glycolysis, allosteric EN transfe 98.7
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 98.1
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 97.81
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 97.68
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 97.57
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 97.44
1ujp_A271 Tryptophan synthase alpha chain; riken structural 97.41
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 97.39
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 97.35
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 97.27
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 96.83
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 96.8
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 96.78
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 96.72
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 96.68
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 96.6
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 96.55
3tha_A252 Tryptophan synthase alpha chain; structural genomi 96.55
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.52
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 96.43
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 96.41
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 96.35
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 96.29
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 96.25
3odm_A 560 Pepcase, PEPC, phosphoenolpyruvate carboxylase; be 96.13
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 95.98
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.96
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 95.92
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 95.82
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 95.76
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 95.52
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 95.49
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 95.21
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 95.01
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 95.0
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 94.96
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 94.96
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 94.83
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 94.76
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 94.53
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 94.48
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 94.46
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 94.36
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 94.35
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 94.28
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 94.23
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 94.18
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 94.06
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 94.04
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 94.03
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 93.84
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 93.82
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 93.77
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 93.77
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 93.71
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 93.62
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 93.62
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 93.62
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 93.61
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 93.29
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 93.17
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 93.13
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 93.06
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 93.05
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 92.99
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 92.96
3eul_A152 Possible nitrate/nitrite response transcriptional 92.82
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 92.81
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 92.76
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 92.61
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 92.49
3s9z_A 741 Malate synthase G; inhibitor complex, structural g 92.37
3hdg_A137 Uncharacterized protein; two-component sensor acti 92.36
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 92.35
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 92.31
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 92.19
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 92.08
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 92.08
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 92.06
3cg0_A140 Response regulator receiver modulated diguanylate 91.68
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 91.68
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 91.38
3lg3_A 435 Isocitrate lyase; conserved, CD, proteomics eviden 91.3
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 91.1
1srr_A124 SPO0F, sporulation response regulatory protein; as 91.05
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 91.04
3cnb_A143 DNA-binding response regulator, MERR family; signa 90.89
3gt7_A154 Sensor protein; structural genomics, signal receiv 90.82
3jte_A143 Response regulator receiver protein; structural ge 90.76
3i4e_A 439 Isocitrate lyase; structural genomics, seattle str 90.74
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 90.64
2zay_A147 Response regulator receiver protein; structural ge 90.52
1dz3_A130 Stage 0 sporulation protein A; response regulator, 90.5
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 90.44
1zgz_A122 Torcad operon transcriptional regulatory protein; 90.4
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 90.35
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 90.35
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 90.21
1jqn_A 883 Pepcase, PEPC, phosphoenolpyruvate carboxylase; be 90.13
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 90.11
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 90.11
3lte_A132 Response regulator; structural genomics, PSI, prot 90.06
1jqo_A 970 Phosphoenolpyruvate carboxylase; beta barrel, carb 90.01
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 89.99
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 89.98
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 89.97
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 89.71
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 89.7
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 89.65
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 89.5
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 89.47
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 89.26
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 89.25
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 88.84
1xhf_A123 DYE resistance, aerobic respiration control protei 88.74
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 88.68
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 88.68
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 88.61
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 88.59
3heb_A152 Response regulator receiver domain protein (CHEY); 88.58
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 88.54
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 88.53
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 88.22
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 88.2
2qr3_A140 Two-component system response regulator; structura 88.19
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 88.15
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 88.15
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 88.06
3hdv_A136 Response regulator; PSI-II, structural genomics, P 88.01
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 87.77
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 87.65
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 87.58
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 87.53
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 87.45
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 87.43
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 87.4
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 87.37
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 87.24
2qxy_A142 Response regulator; regulation of transcription, N 87.19
2gkg_A127 Response regulator homolog; social motility, recei 87.07
1viz_A240 PCRB protein homolog; structural genomics, unknown 87.03
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 86.98
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 86.95
3nhm_A133 Response regulator; protein structure initiative I 86.87
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 86.78
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 86.74
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 86.72
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 86.66
3crn_A132 Response regulator receiver domain protein, CHEY-; 86.59
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 86.55
3cfy_A137 Putative LUXO repressor protein; structural genomi 86.46
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 86.33
2qsj_A154 DNA-binding response regulator, LUXR family; struc 86.29
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 86.29
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 86.23
1mb3_A124 Cell division response regulator DIVK; signal tran 86.21
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 86.2
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 85.99
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 85.93
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 85.68
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 85.65
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 85.58
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 85.52
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 85.52
3n53_A140 Response regulator receiver modulated diguanylate; 85.36
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 85.3
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 85.11
3lua_A140 Response regulator receiver protein; two-component 84.96
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 84.96
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 84.77
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 84.39
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 84.28
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 84.28
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 84.09
2rjn_A154 Response regulator receiver:metal-dependent phosph 84.01
3f6c_A134 Positive transcription regulator EVGA; structural 83.95
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 83.78
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 83.6
2oqr_A230 Sensory transduction protein REGX3; response regul 83.03
1mvo_A136 PHOP response regulator; phosphate regulon, transc 82.82
3grc_A140 Sensor protein, kinase; protein structure initiati 82.63
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 82.6
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 82.44
3r0j_A250 Possible two component system response transcript 82.21
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 81.83
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 81.76
3kto_A136 Response regulator receiver protein; PSI-II,struct 81.61
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 81.57
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 81.5
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 81.49
3q9s_A249 DNA-binding response regulator; DNA binding protei 81.43
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 81.37
2fiq_A420 Putative tagatose 6-phosphate kinase 1; structural 81.3
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 81.18
3cg4_A142 Response regulator receiver domain protein (CHEY-; 81.1
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 80.92
3cz5_A153 Two-component response regulator, LUXR family; str 80.85
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 80.82
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 80.71
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 80.7
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 80.52
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 80.51
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 80.47
2gwr_A238 DNA-binding response regulator MTRA; two-component 80.09
>3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 Back     alignment and structure
Probab=100.00  E-value=2.8e-55  Score=416.04  Aligned_cols=254  Identities=26%  Similarity=0.394  Sum_probs=239.7

Q ss_pred             CchHHHHHHHcCCcEEEEEEec-CCHHHHHHhhhcCCcEEEEeCCCCCCCHHHHHHHHHHHHhCCCCeEEcCCCCCHHHH
Q 018508           72 SPESLKYRLQSNETLYGLFLLS-FSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWA  150 (355)
Q Consensus        72 ~~n~lk~~L~~G~~~~gl~v~~-~sp~~~e~aa~~G~D~vilDlEh~~~~~~~a~~~i~a~~~~g~~~iVRV~~~~~~~i  150 (355)
                      ..|+||++|++|++++|+|+.+ ++|..+|+++.+|||+|+|||||++.+.+.++++++++...+..++||||+.+++.|
T Consensus         2 ~~n~~k~~l~~g~~~~g~~~~~~~~p~~~e~a~~~g~D~vilDlEhav~~~~k~~~~l~a~~~~~~~~~VRVn~~~~~di   81 (261)
T 3qz6_A            2 NAMFLKKKLSAGKSVVGTMLNLVYNPDIVRIYAEAGLDYFIVDCEHAAYTFREINHLVSVAKNAGVSVLVRIPQVDRAHV   81 (261)
T ss_dssp             -CCCHHHHHHTTCCEEEEEESSCCCTTHHHHHHHTTCSEEEEESSSSCCCHHHHHHHHHHHHHHTCEEEEECSSCCHHHH
T ss_pred             CchHHHHHHHCCCCEEEEEEecCCCHHHHHHHhcCCcCEEEEeccCCCCCHHHHHHHHHHHhhcCCeEEEEeCCCCHHHH
Confidence            3688999999999999999999 999999999999999999999999999999999999888889999999999999999


Q ss_pred             HHHHhcCCCeEeecCCCCHHHHHHHHHHcCCCCCCCCCCcccccccccCCCC--ccccccCCCceEEEEEEccHHHHHHH
Q 018508          151 KKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGID--EGYLSNYEEELLIMCQVESEEGVKRA  228 (355)
Q Consensus       151 ~~aLdaGa~GImvP~Vesaeea~~vv~a~~~pP~G~Rg~g~~~~ra~~~g~~--~~y~~~~n~~i~vi~mIET~~av~ni  228 (355)
                      +++++.|++|||+|||+|++|+++++++++|||.|.||+++  .|+.+||..  .+|++..|+++.+++||||++|+.|+
T Consensus        82 ~~~ld~G~~gI~lP~v~saed~~~~~~~~~~~p~G~Rg~~~--~r~~~~g~~~~~~y~~~~~~~~~v~~mIEt~~av~~~  159 (261)
T 3qz6_A           82 QRLLDIGAEGFMIPGVQSAETMRETVRLAKYPPLGERGVGG--SIVTDFKPVNWAEWVQERNDEIFIMAQIEHVKAVEDI  159 (261)
T ss_dssp             HHHHHHTCCEEEETTCCSHHHHHHHHHHHSCTTTCCCCCCC--GGGGTTCCCCHHHHHHHHHTTCEEEEEECCHHHHHTH
T ss_pred             HHHHhcCCCEEEECCcCCHHHHHHHHHHhccCCCCCcCccc--chhhhccccchhhHHhcCCCCeEEEEEECCHHHHHHH
Confidence            99999999999999999999999999999999999999984  688999974  68999999999999999999999999


Q ss_pred             HHHhccCCccEEEEChhhHHhhcCCCCCCCCHHHHHHHHHHHHHHHhCCCceeecccCCchhH-HHHHHCCCCEEEecch
Q 018508          229 EDIAAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAP-LEMKSRGYHMVSGAVD  307 (355)
Q Consensus       229 eeIaavpgVD~l~iGp~DLs~slG~~~~~~~p~v~~ai~~iv~aa~a~g~~~~g~~~~d~~~a-~~~~~~G~~~vs~~~D  307 (355)
                      ++|+++|+||+|+||++||+++||+++++.||++.+++++++.+|+++|+. +|..+.+++.+ +.++++||+++++++|
T Consensus       160 ~eIaa~~~vd~l~iG~~DL~~~lg~~~~~~~p~v~~a~~~iv~aa~aaG~~-~g~~~~~~~~~~~~~~~~G~~~~s~~~D  238 (261)
T 3qz6_A          160 DSILAVQGVDAVIFGPRDLSNDLGIIGQTEHPKVYECYEKVYRAADRQGVV-KGFFTAADAAKMGWAVERGAQMLLWSGD  238 (261)
T ss_dssp             HHHHTSTTCCEEEECHHHHHHHTTCTTCTTCHHHHHHHHHHHHHHHHHTCE-EEEEESSCGGGGHHHHHTTCCEEEEEEH
T ss_pred             HHHhCCCCCCEEEECHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCC-EEEEeCCHHHHHHHHHHCCCCEEEEhhH
Confidence            999999999999999999999999999999999999999999999999976 46677889999 9999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhcCC
Q 018508          308 VGLFRSAAVEDVARFKMNLTD  328 (355)
Q Consensus       308 ~~ll~~~~~~~~~~~r~~~~~  328 (355)
                      +.+|++++++.++.+|....-
T Consensus       239 ~~~l~~~~~~~~~~~~~~~~~  259 (261)
T 3qz6_A          239 VAALQTYTAKGVKTIKELPGF  259 (261)
T ss_dssp             HHHHHHHHHHHHHHHHTSTTC
T ss_pred             HHHHHHHHHHHHHHHHHhhcc
Confidence            999999999999999986543
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic DEGR aromatic hydrocarbons catabolism; 1.60A {Escherichia coli} PDB: 2v5k_A Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Back     alignment and structure
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, 2-keto-3-deoxy SU aldolase, degradation of homoprotocatechuate; 1.39A {Escherichia coli} PDB: 2vwt_A Back     alignment and structure
>1izc_A Macrophomate synthase intermolecular diels-aldera; TIM-barrel, pyruvate Mg(II) complex, lyase; 1.70A {Macrophoma commelinae} SCOP: c.1.12.5 Back     alignment and structure
>1sgj_A Citrate lyase, beta subunit; trimer, TIM barrel, structural genomics, PSI, protein structure initiative; 1.84A {Deinococcus radiodurans} SCOP: c.1.12.5 Back     alignment and structure
>2xz9_A Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria); thermophilic, PEP-utilising enzyme, transferase; 1.68A {Thermoanaerobacter tengcongensis} PDB: 2bg5_A 2xz7_A* Back     alignment and structure
>1u5h_A CITE; TIM barrel, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC, lyase; 1.65A {Mycobacterium tuberculosis} SCOP: c.1.12.5 PDB: 1u5v_A* 1z6k_A Back     alignment and structure
>3qll_A Citrate lyase; beta barrel; 2.45A {Yersinia pestis} Back     alignment and structure
>3qqw_A Putative citrate lyase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.44A {Ralstonia eutropha} Back     alignment and structure
>2hwg_A Phosphoenolpyruvate-protein phosphotransferase; enzyme I, phosphoenolpyruvate:sugar phosphotransferase system, PTS; HET: NEP; 2.70A {Escherichia coli} PDB: 2kx9_A 2xdf_A 2l5h_A Back     alignment and structure
>2wqd_A Phosphoenolpyruvate-protein phosphotransferase; kinase, cytoplasm, transport, magnesium, PEP- utilising enzyme, phosphotransferase system; 2.40A {Staphylococcus aureus} PDB: 2hro_A Back     alignment and structure
>3r4i_A Citrate lyase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.24A {Burkholderia xenovorans} Back     alignment and structure
>3oyz_A Malate synthase; TIM barrel, transferase; HET: ACO; 1.95A {Haloferax volcanii} PDB: 3oyx_A* 3pug_A Back     alignment and structure
>2ols_A Phosphoenolpyruvate synthase; MC structural genomics, PSI-2, protein structure initiative, M center for structural genomics, transferase; 2.40A {Neisseria meningitidis} Back     alignment and structure
>1vbg_A Pyruvate,orthophosphate dikinase; transferase, maize, riken structural genomics/proteomics INI RSGI, structural genomics; 2.30A {Zea mays} SCOP: c.1.12.2 c.8.1.1 d.142.1.5 PDB: 1vbh_A* Back     alignment and structure
>3cux_A Malate synthase; TIM barrel, glyoxylate bypass, transferase, tricarboxylic acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3cuz_A MSA, malate synthase A; TIM barrel, cytoplasm, glyoxylate bypass, transferase, tricarboxylic acid cycle; 1.04A {Escherichia coli} PDB: 3cv1_A 3cv2_A* Back     alignment and structure
>1a3w_A Pyruvate kinase; allosteric regulation, tranferase, transfer; HET: FBP; 3.00A {Saccharomyces cerevisiae} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1a3x_A Back     alignment and structure
>1kbl_A PPDK, pyruvate phosphate dikinase; transferase, phosphotransferase; 1.94A {Clostridium symbiosum} SCOP: c.1.12.2 c.8.1.1 d.142.1.5 PDB: 1kc7_A* 1dik_A 1ggo_A 1jde_A 2dik_A 2r82_A 2fm4_A Back     alignment and structure
>1h6z_A Pyruvate phosphate dikinase; transferase, tropical parasite, trypanosome; 3.00A {Trypanosoma brucei} PDB: 2x0s_A Back     alignment and structure
>2x0s_A Pyruvate phosphate dikinase; transferase, tropical parasite; 3.00A {Trypanosoma brucei} Back     alignment and structure
>1p7t_A MSG, malate synthase G; TIM barrel, glyoxylate cycle, acetyl-COA, cysteine-sulfenic lyase; HET: ACO PG4; 1.95A {Escherichia coli str} SCOP: c.1.13.1 PDB: 1y8b_A 1d8c_A* 2jqx_A Back     alignment and structure
>1e0t_A Pyruvate kinase, PK; phosphotransferase, glycolysis, allostery; 1.8A {Escherichia coli} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1pky_A 1e0u_A Back     alignment and structure
>2e28_A Pyruvate kinase, PK; allosteric, transferase; 2.40A {Geobacillus stearothermophilus} Back     alignment and structure
>3gr4_A Pyruvate kinase isozymes M1/M2; activator, acetylation, allosteric enzyme, alternative splicing, glycolysis, magnesium, metal-binding; HET: FBP TLA DYY ADP; 1.60A {Homo sapiens} PDB: 3gqy_A* 3h6o_A* 3me3_A* 3srh_A 3srd_A 1zjh_A 4b2d_A* 4b2d_D* 3u2z_A* 3g2g_A 1t5a_A* 3bjt_A 4g1n_A* 3bjf_A* 3srf_C 1f3x_A 3n25_A 1f3w_A 1a49_A* 1a5u_A* ... Back     alignment and structure
>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, binding, glycolysis, magnesium, metal-binding, NUCL binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3is4_A* 3ktx_A* 3qv6_A* 3qv7_D* 3qv8_D* 3srk_A* 3e0w_A 3e0v_A 3pp7_A* 3qv9_A* Back     alignment and structure
>3qtg_A Pyruvate kinase, PK; TIM barrel, glycolysis, transferase; 2.20A {Pyrobaculum aerophilum} Back     alignment and structure
>3khd_A Pyruvate kinase; malaria, structural genomics, structural GE consortium, SGC, transferase; 2.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>3gg8_A Pyruvate kinase; malaria, genomics, proteomics, glycolysis, magnesium, transferase, structural genomics, STRU genomics consortium, SGC; 2.21A {Toxoplasma gondii} PDB: 3eoe_A Back     alignment and structure
>3t05_A Pyruvate kinase, PK; tetramer, glycolysis, transferase; 3.05A {Staphylococcus aureus subsp} PDB: 3t07_A* 3t0t_A* Back     alignment and structure
>4drs_A Pyruvate kinase; glycolysis, allosteric EN transferase; 2.50A {Cryptosporidium parvum} PDB: 3ma8_A* Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3odm_A Pepcase, PEPC, phosphoenolpyruvate carboxylase; beta-barrel, lyase; 2.95A {Clostridium perfringens} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>3s9z_A Malate synthase G; inhibitor complex, structural genomics, mycobacterium tuberc structural proteomics project, XMTB; HET: I92; 1.79A {Mycobacterium tuberculosis} PDB: 3s9i_A* 3sad_A* 3saz_A* 3sb0_A* 1n8i_A 1n8w_A* 2gq3_A* 4ex4_A Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1jqn_A Pepcase, PEPC, phosphoenolpyruvate carboxylase; beta barrel, Mn2+ and DCDP complex, lyase; HET: DCO; 2.35A {Escherichia coli} SCOP: c.1.12.3 PDB: 1fiy_A* 1qb4_A Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>1jqo_A Phosphoenolpyruvate carboxylase; beta barrel, carbon dioxide fixation, lyase; 3.00A {Zea mays} SCOP: c.1.12.3 Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 355
d1dxea_253 c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldola 2e-55
d1izca_299 c.1.12.5 (A:) Macrophomate synthase {Macrophoma co 7e-49
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: HpcH/HpaI aldolase
domain: 2-dehydro-3-deoxy-galactarate aldolase
species: Escherichia coli [TaxId: 562]

 Score =  179 bits (456), Expect = 2e-55
 Identities = 75/251 (29%), Positives = 126/251 (50%), Gaps = 2/251 (0%)

Query: 73  PESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALA 132
           P   K  L + +   G +    +P   E+ GLAG+D++V+D EH P  IS  +  L AL 
Sbjct: 4   PNKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALK 63

Query: 133 ATGTPAILRLPESCPTWAKKALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHT 192
            + +  ++R+P + P   K+ LD+G    + P +++ E A+ AV+  R+PP G       
Sbjct: 64  GSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEG-IRGVSV 122

Query: 193 VVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDIAAVDGVDCVQMGPLDLSASMG 252
             RA+ +G    Y +   + + I+ Q+ES++GV   + IAA +GVD + +GP DL+A++G
Sbjct: 123 SHRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDLAAALG 182

Query: 253 YLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLFR 312
           +L +  H  V++ ++         GK      A            G   V+   D+G+FR
Sbjct: 183 HLGNASHPDVQKAIQHIFNRASAHGKP-SGILAPVEADARRYLEWGATFVAVGSDLGVFR 241

Query: 313 SAAVEDVARFK 323
           SA  +    FK
Sbjct: 242 SATQKLADTFK 252
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query355
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 100.0
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 100.0
d1u5ha_223 Citrate lyase, beta subunit {Mycobacterium tubercu 99.95
d1sgja_231 Citrate lyase, beta subunit {Deinococcus radiodura 99.94
d1vbga1356 Pyruvate phosphate dikinase, C-terminal domain {Ma 99.73
d1kbla1364 Pyruvate phosphate dikinase, C-terminal domain {Cl 99.71
d1h6za1366 Pyruvate phosphate dikinase, C-terminal domain {Tr 99.65
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 99.27
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 99.27
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 99.24
d2g50a2282 Pyruvate kinase, N-terminal domain {Rabbit (Orycto 99.23
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 97.2
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 96.42
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 95.71
d1d8ca_ 720 Malate synthase G {Escherichia coli [TaxId: 562]} 95.64
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 95.59
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 94.89
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 94.07
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 94.03
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 93.37
d1n8ia_ 726 Malate synthase G {Mycobacterium tuberculosis [Tax 93.09
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 92.17
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 92.17
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 91.89
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 91.36
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 91.34
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 91.06
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 90.22
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 89.67
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 89.43
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 88.79
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 85.87
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 85.73
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 84.8
d1k68a_140 Response regulator for cyanobacterial phytochrome 84.03
d1i3ca_144 Response regulator for cyanobacterial phytochrome 83.89
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 83.38
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 83.31
d1jqna_ 880 Phosphoenolpyruvate carboxylase {Escherichia coli 83.25
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 83.07
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 82.78
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 82.55
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 81.22
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 80.41
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: HpcH/HpaI aldolase
domain: 2-dehydro-3-deoxy-galactarate aldolase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.7e-62  Score=460.20  Aligned_cols=251  Identities=31%  Similarity=0.511  Sum_probs=240.2

Q ss_pred             CchHHHHHHHcCCcEEEEEEecCCHHHHHHhhhcCCcEEEEeCCCCCCCHHHHHHHHHHHHhCCCCeEEcCCCCCHHHHH
Q 018508           72 SPESLKYRLQSNETLYGLFLLSFSPTLAEISGLAGYDFVVVDMEHGPGGISDALACLHALAATGTPAILRLPESCPTWAK  151 (355)
Q Consensus        72 ~~n~lk~~L~~G~~~~gl~v~~~sp~~~e~aa~~G~D~vilDlEh~~~~~~~a~~~i~a~~~~g~~~iVRV~~~~~~~i~  151 (355)
                      .||+||++|++||+++|+|+.+++|..+|+++.+|||||+||+||++++.+++.+++++++..+..++|||+..++..|+
T Consensus         3 ~~N~lk~~l~~g~~~~G~~~~~~~p~~~ei~a~~G~Dfv~iD~EHg~~~~~~~~~~i~a~~~~g~~~~VRvp~~~~~~i~   82 (253)
T d1dxea_           3 FPNKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALKGSASAPVVRVPTNEPVIIK   82 (253)
T ss_dssp             CSCHHHHHHHTTCCEEEEEECSCSHHHHHHHTTSCCSEEEEESSSSSCCHHHHHHHHHHTTTCSSEEEEECSSSCHHHHH
T ss_pred             CchHHHHHHHCCCCEEEEEecCCCHHHHHHHHcCCCCEEEEecccCCCChhHHHHHHHHHhccCCCceecCCCCCHHHHH
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCeEeecCCCCHHHHHHHHHHcCCCCCCCCCCcccccccccCCCCccccccCCCceEEEEEEccHHHHHHHHHH
Q 018508          152 KALDLGPQGVMFPMIDSPEAAKEAVSYCRFPPSGVRGSAHTVVRASGYGIDEGYLSNYEEELLIMCQVESEEGVKRAEDI  231 (355)
Q Consensus       152 ~aLdaGa~GImvP~Vesaeea~~vv~a~~~pP~G~Rg~g~~~~ra~~~g~~~~y~~~~n~~i~vi~mIET~~av~nieeI  231 (355)
                      ++||+|++|||+|||+|+||++++++++||||.|.||+++. .++..|+...+|+++.|+++.+++||||++||+|+|||
T Consensus        83 ~~LD~Ga~GIivP~v~s~eea~~~v~~~~ypP~G~Rg~~~~-~~~~~~~~~~~~~~~~n~~~~vi~~IEt~~av~nleeI  161 (253)
T d1dxea_          83 RLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGVSVS-HRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAI  161 (253)
T ss_dssp             HHHHTTCCEEEESCCCSHHHHHHHHHTTSCTTTCCCCCCSS-SGGGGGGTSTTHHHHHTTSCEEEEEECSHHHHHTHHHH
T ss_pred             HHHhcCccEEEecccCCHHHHHHHHHhheeCCCCCcCcCcc-eeccccccccccccccccceEEEeecccHHHHHHHHHH
Confidence            99999999999999999999999999999999999999854 45556777789999999999999999999999999999


Q ss_pred             hccCCccEEEEChhhHHhhcCCCCCCCCHHHHHHHHHHHHHHHhCCCceeecccCCchhHHHHHHCCCCEEEecchHHHH
Q 018508          232 AAVDGVDCVQMGPLDLSASMGYLWDPGHRKVREMMRVAEKGVLGGGKAYLAGFAMPHDAPLEMKSRGYHMVSGAVDVGLF  311 (355)
Q Consensus       232 aavpgVD~l~iGp~DLs~slG~~~~~~~p~v~~ai~~iv~aa~a~g~~~~g~~~~d~~~a~~~~~~G~~~vs~~~D~~ll  311 (355)
                      +++||||+|||||+|||++||+++++.||++.+++++++++|+++|+. +|.++.++++++.++++||+++++++|+.+|
T Consensus       162 ~av~giD~i~iGp~DLs~slG~~g~~~~p~v~~ai~~v~~~~~~~gk~-~g~~~~~~~~~~~~~~~G~~~i~~g~D~~~l  240 (253)
T d1dxea_         162 AATEGVDGIFVGPSDLAAALGHLGNASHPDVQKAIQHIFNRASAHGKP-SGILAPVEADARRYLEWGATFVAVGSDLGVF  240 (253)
T ss_dssp             HTSTTCCEEEECHHHHHHHTTCTTCTTSHHHHHHHHHHHHHHHHTTCC-EEEECCSHHHHHHHHHTTCCEEEEEEHHHHH
T ss_pred             hccCCCceEEEecCcHHhhccCCCCCCChhHHHHHHHHHHHHHHcCCC-eEEecCCHHHHHHHHHcCCCEEEehHHHHHH
Confidence            999999999999999999999999999999999999999999999875 6778889999999999999999999999999


Q ss_pred             HHHHHHHHHHHHH
Q 018508          312 RSAAVEDVARFKM  324 (355)
Q Consensus       312 ~~~~~~~~~~~r~  324 (355)
                      ++++++.++++|+
T Consensus       241 ~~~~~~~~~~~r~  253 (253)
T d1dxea_         241 RSATQKLADTFKK  253 (253)
T ss_dssp             HHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHhcC
Confidence            9999999999874
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1u5ha_ c.1.12.5 (A:) Citrate lyase, beta subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgja_ c.1.12.5 (A:) Citrate lyase, beta subunit {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1vbga1 c.1.12.2 (A:521-876) Pyruvate phosphate dikinase, C-terminal domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1kbla1 c.1.12.2 (A:510-873) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1h6za1 c.1.12.2 (A:538-903) Pyruvate phosphate dikinase, C-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d8ca_ c.1.13.1 (A:) Malate synthase G {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1n8ia_ c.1.13.1 (A:) Malate synthase G {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1jqna_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure