Citrus Sinensis ID: 018523

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----

MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP

cccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHcccEEEEcccEEEEEEcccccEEEEEEcccEEEEccEEEEcccHHHHHHcccccccccHHHHHHHccccccEEEEEEcccccccccccccEEccccccccccccccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEcccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc

cccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHcccccHHHHHccccHHHHcHHHHHHHHHcccEEEEcccEEEEEEccccEEEEEEEEccEEEEEEEEEEEcccHHHHHHccHHHHccHHHHHHHcccccEEEEEEEEEcHHHHHHHHHHcccccccccEEHHHHcccHHHccccccEEEEEEcccccHccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEcccHHHcccccccccccccccccccEEEcccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccc

MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMrkqgvpdrVTTEVFIAMSKalnfinpdeLSMQCILIALNRFLqekhgskmafldgnpperlcLPIVEHIQSlggevrlnsrvqkielnddgtvknflltngnvidgdayvfatpvdilklqlpeNWKEMAYFKRLEklvgvpviniHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCkeyynpnqSMLELvfapaeewiscsdSEIIDATMKELAKLFpdeisadqSKAKIVKYHVVktprsvyktipncepcrplqrspvegfylagDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGkgrlaeasmcp

MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKielnddgtvKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKtprsvyktipncepcrplqRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP

***WPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARG***********

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		354	2.2.26 [Sep-21-2011]
Q07356		566	15-cis-phytoene desaturas	yes	no	0.994	0.621	0.860	0.0
P28553		570	Phytoene dehydrogenase, c	yes	no	0.994	0.617	0.869	0.0
P80093		582	15-cis-phytoene desaturas	N/A	no	0.994	0.604	0.849	0.0
P28554		583	Phytoene dehydrogenase, c	N/A	no	0.994	0.603	0.860	1e-179
Q40406		570	Phytoene dehydrogenase, c	N/A	no	0.971	0.603	0.857	1e-179
Q0DUI8		578	Phytoene dehydrogenase, c	yes	no	0.966	0.591	0.859	1e-175
A2XDA1		578	Phytoene dehydrogenase, c	N/A	no	0.966	0.591	0.859	1e-175
P49086		571	Phytoene dehydrogenase, c	N/A	no	0.980	0.607	0.844	1e-172
P26294		474	15-cis-phytoene desaturas	yes	no	0.991	0.740	0.597	1e-119
P29273		472	Phytoene dehydrogenase OS	N/A	no	0.943	0.707	0.609	1e-118

>sp\|Q07356\|PDS_ARATH 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=PDS PE=1 SV=1	Back alignment and function desciption

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/352 (86%), Positives = 338/352 (96%)

Query: 1   MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNF 60
           MLTWPEK+KFAIGLLPA++GGQAYVEAQDGL+V+EWM KQGVP+RVT EVFIAMSKALNF
Sbjct: 212 MLTWPEKIKFAIGLLPAMVGGQAYVEAQDGLSVKEWMEKQGVPERVTDEVFIAMSKALNF 271

Query: 61  INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQ 120
           INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLC+P+V+HI+SLGGEV+LNSR++
Sbjct: 272 INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPVVDHIRSLGGEVQLNSRIK 331

Query: 121 KIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPV 180
           KIELNDDGTVK+FLLTNG+ ++GDAYVFA PVDILKL LP+ WKE+ YFK+L+KLVGVPV
Sbjct: 332 KIELNDDGTVKSFLLTNGSTVEGDAYVFAAPVDILKLLLPDPWKEIPYFKKLDKLVGVPV 391

Query: 181 INIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISC 240
           IN+HIWFDRKLKNTYDHLLFSRS+LLSVYADMSLTCKEYY+PN+SMLELVFAPAEEWIS 
Sbjct: 392 INVHIWFDRKLKNTYDHLLFSRSNLLSVYADMSLTCKEYYDPNRSMLELVFAPAEEWISR 451

Query: 241 SDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPV 300
           +DS+IIDATMKEL KLFPDEISADQSKAKI+KYHVVKTPRSVYKTIPNCEPCRPLQRSP+
Sbjct: 452 TDSDIIDATMKELEKLFPDEISADQSKAKILKYHVVKTPRSVYKTIPNCEPCRPLQRSPI 511

Query: 301 EGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM 352
           EGFYLAGDYTKQKYLASMEGAVLSGK C+Q+IVQDY LLAA G  +L+EA++
Sbjct: 512 EGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAASGPRKLSEATV 563

This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene. The zeta-carotene produced has a central C15-C15' double bond in the cis configuration and it requires isomerization before being recognized as substrate by ZDS, the next enzyme in the lycopene biosynthesis pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 3EC: .EC: 5EC: .EC: 5

>sp\|P28553\|CRTI_SOYBN Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Glycine max GN=PDS1 PE=2 SV=1	Back alignment and function description

>sp\|P80093\|PDS_CAPAN 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Capsicum annuum GN=PDS PE=1 SV=1	Back alignment and function description

>sp\|P28554\|CRTI_SOLLC Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Solanum lycopersicum GN=PDS PE=2 SV=1	Back alignment and function description

>sp\|Q40406\|CRTI_NARPS Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Narcissus pseudonarcissus GN=PDS1 PE=1 SV=1	Back alignment and function description

>sp\|Q0DUI8\|CRTI_ORYSJ Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. japonica GN=PDS PE=2 SV=2	Back alignment and function description

>sp\|A2XDA1\|CRTI_ORYSI Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. indica GN=PDS1 PE=2 SV=2	Back alignment and function description

>sp\|P49086\|CRTI_MAIZE Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Zea mays GN=PDS1 PE=2 SV=1	Back alignment and function description

>sp\|P26294\|PDS_SYNE7 15-cis-phytoene desaturase OS=Synechococcus elongatus (strain PCC 7942) GN=pds PE=1 SV=1	Back alignment and function description

>sp\|P29273\|CRTI_SYNY3 Phytoene dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pds PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		354
25518260		553	phytoene desaturase (EC 1.14.99.-) 1 - c	1.0	0.640	1.0	0.0
350541925		553	phytoene desaturase [Citrus sinensis]	1.0	0.640	0.994	0.0
350541935		553	phytoene desaturase [Citrus x paradisi]	1.0	0.640	0.997	0.0
350541929		553	phytoene desaturase [Citrus x paradisi]	1.0	0.640	0.997	0.0
350541939		553	phytoene desaturase [Citrus sinensis]	1.0	0.640	0.994	0.0
350541931		553	phytoene desaturase [Citrus x paradisi]	1.0	0.640	0.994	0.0
13991882		552	phytoene desaturase [Citrus x paradisi]	0.997	0.639	0.997	0.0
350541927		553	phytoene desaturase [Citrus sinensis]	1.0	0.640	0.991	0.0
350541937		553	phytoene desaturase [Citrus sinensis]	1.0	0.640	0.994	0.0
190576745		553	phytoene desaturase [Citrus maxima]	1.0	0.640	0.988	0.0

>gi\|25518260\|pir\|\|JC7723 phytoene desaturase (EC 1.14.99.-) 1 - citrus gi\|9757659\|dbj\|BAB08179.1\| phytoene desaturase [Citrus unshiu] gi\|18073984\|emb\|CAC85666.1\| phytoene desaturase [Citrus sinensis] gi\|82394889\|gb\|ABB72445.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/354 (100%), Positives = 354/354 (100%)

Query: 1   MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNF 60
           MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNF
Sbjct: 200 MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNF 259

Query: 61  INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQ 120
           INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQ
Sbjct: 260 INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQ 319

Query: 121 KIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPV 180
           KIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPV
Sbjct: 320 KIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPV 379

Query: 181 INIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISC 240
           INIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISC
Sbjct: 380 INIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISC 439

Query: 241 SDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPV 300
           SDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPV
Sbjct: 440 SDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPV 499

Query: 301 EGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP 354
           EGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP
Sbjct: 500 EGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP 553

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|350541925\|gb\|AEQ29518.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541935\|gb\|AEQ29523.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|350541929\|gb\|AEQ29520.1\| phytoene desaturase [Citrus x paradisi] gi\|350541933\|gb\|AEQ29522.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|350541939\|gb\|AEQ29525.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541931\|gb\|AEQ29521.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|13991882\|gb\|AAK51545.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|350541927\|gb\|AEQ29519.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541937\|gb\|AEQ29524.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|190576745\|gb\|ACE79168.1\| phytoene desaturase [Citrus maxima]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		354
TAIR\|locus:2129515		566	PDS3 "phytoene desaturase 3" [	0.994	0.621	0.860	1.1e-167
TAIR\|locus:2114789		558	ZDS "zeta-carotene desaturase"	0.604	0.383	0.314	2.5e-25
TAIR\|locus:2077670		488	PAO3 "polyamine oxidase 3" [Ar	0.596	0.432	0.227	4.4e-06
TAIR\|locus:2018571		497	PAO4 "polyamine oxidase 4" [Ar	0.610	0.434	0.222	7.6e-05
TAIR\|locus:2053723		490	PAO2 "AT2G43020" [Arabidopsis	0.576	0.416	0.241	0.00027

TAIR\|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1631 (579.2 bits), Expect = 1.1e-167, P = 1.1e-167
 Identities = 303/352 (86%), Positives = 338/352 (96%)

Query:     1 MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNF 60
             MLTWPEK+KFAIGLLPA++GGQAYVEAQDGL+V+EWM KQGVP+RVT EVFIAMSKALNF
Sbjct:   212 MLTWPEKIKFAIGLLPAMVGGQAYVEAQDGLSVKEWMEKQGVPERVTDEVFIAMSKALNF 271

Query:    61 INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQ 120
             INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLC+P+V+HI+SLGGEV+LNSR++
Sbjct:   272 INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPVVDHIRSLGGEVQLNSRIK 331

Query:   121 KIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPV 180
             KIELNDDGTVK+FLLTNG+ ++GDAYVFA PVDILKL LP+ WKE+ YFK+L+KLVGVPV
Sbjct:   332 KIELNDDGTVKSFLLTNGSTVEGDAYVFAAPVDILKLLLPDPWKEIPYFKKLDKLVGVPV 391

Query:   181 INIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISC 240
             IN+HIWFDRKLKNTYDHLLFSRS+LLSVYADMSLTCKEYY+PN+SMLELVFAPAEEWIS 
Sbjct:   392 INVHIWFDRKLKNTYDHLLFSRSNLLSVYADMSLTCKEYYDPNRSMLELVFAPAEEWISR 451

Query:   241 SDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPV 300
             +DS+IIDATMKEL KLFPDEISADQSKAKI+KYHVVKTPRSVYKTIPNCEPCRPLQRSP+
Sbjct:   452 TDSDIIDATMKELEKLFPDEISADQSKAKILKYHVVKTPRSVYKTIPNCEPCRPLQRSPI 511

Query:   301 EGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM 352
             EGFYLAGDYTKQKYLASMEGAVLSGK C+Q+IVQDY LLAA G  +L+EA++
Sbjct:   512 EGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAASGPRKLSEATV 563

GO:0009507 "chloroplast" evidence=ISM;IDA;TAS

GO:0009536 "plastid" evidence=IEA

GO:0016117 "carotenoid biosynthetic process" evidence=IEA;IDA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009534 "chloroplast thylakoid" evidence=IDA

GO:0010155 "regulation of proton transport" evidence=RCA

GO:0046777 "protein autophosphorylation" evidence=RCA

GO:0016120 "carotene biosynthetic process" evidence=IDA

GO:0016166 "phytoene dehydrogenase activity" evidence=IDA

TAIR\|locus:2114789 ZDS "zeta-carotene desaturase" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2077670 PAO3 "polyamine oxidase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2018571 PAO4 "polyamine oxidase 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2053723 PAO2 "AT2G43020" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q0DUI8	CRTI_ORYSJ	1, ., 1, 4, ., 9, 9, ., -	0.8596	0.9661	0.5916	yes	no
P26294	PDS_SYNE7	1, ., 3, ., 5, ., 5	0.5977	0.9915	0.7405	yes	no
P28553	CRTI_SOYBN	1, ., 1, 4, ., 9, 9, ., -	0.8693	0.9943	0.6175	yes	no
Q40406	CRTI_NARPS	1, ., 1, 4, ., 9, 9, ., -	0.8575	0.9717	0.6035	N/A	no
P80093	PDS_CAPAN	1, ., 3, ., 5, ., 5	0.8494	0.9943	0.6048	N/A	no
P28554	CRTI_SOLLC	1, ., 1, 4, ., 9, 9, ., -	0.8607	0.9943	0.6037	N/A	no
P49086	CRTI_MAIZE	1, ., 1, 4, ., 9, 9, ., -	0.8443	0.9802	0.6077	N/A	no
Q07356	PDS_ARATH	1, ., 3, ., 5, ., 5	0.8607	0.9943	0.6219	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.14.99	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		354
PLN02612		567	PLN02612, PLN02612, phytoene desaturase	0.0
TIGR02731		453	TIGR02731, phytoene_desat, phytoene desaturase	0.0
COG3349		485	COG3349, COG3349, Uncharacterized conserved protei	2e-91
pfam01593		444	pfam01593, Amino_oxidase, Flavin containing amine	2e-64
TIGR02732		474	TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot	6e-60
PLN02487		569	PLN02487, PLN02487, zeta-carotene desaturase	1e-52
TIGR03467		411	TIGR03467, HpnE, squalene-associated FAD-dependent	3e-33
PRK07233		434	PRK07233, PRK07233, hypothetical protein; Provisio	4e-13
PLN02268		435	PLN02268, PLN02268, probable polyamine oxidase	7e-08
COG1232		444	COG1232, HemY, Protoporphyrinogen oxidase [Coenzym	1e-04
PRK11883		451	PRK11883, PRK11883, protoporphyrinogen oxidase; Re	1e-04
pfam01266		234	pfam01266, DAO, FAD dependent oxidoreductase	0.001
COG2509		486	COG2509, COG2509, Uncharacterized FAD-dependent de	0.001

>gnl\|CDD\|215330 PLN02612, PLN02612, phytoene desaturase	Back alignment and domain information

 Score =  762 bits (1970), Expect = 0.0
 Identities = 309/352 (87%), Positives = 337/352 (95%)

Query: 1   MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNF 60
           MLTWPEK+KFAIGLLPAI+GGQAYVEAQDGL+V+EWMRKQGVPDRV  EVFIAMSKALNF
Sbjct: 213 MLTWPEKIKFAIGLLPAIVGGQAYVEAQDGLSVKEWMRKQGVPDRVNDEVFIAMSKALNF 272

Query: 61  INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQ 120
           INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLC+PIV+H QSLGGEVRLNSR++
Sbjct: 273 INPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVDHFQSLGGEVRLNSRIK 332

Query: 121 KIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPV 180
           KIELNDDGTVK+FLLTNG+V++GD YV ATPVDILKL LP+ WKE+ YFK+L+KLVGVPV
Sbjct: 333 KIELNDDGTVKHFLLTNGSVVEGDVYVSATPVDILKLLLPDQWKEIPYFKKLDKLVGVPV 392

Query: 181 INIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISC 240
           IN+HIWFDRKLKNTYDHLLFSRS LLSVYADMS TCKEYY+PN+SMLELVFAPAEEWIS 
Sbjct: 393 INVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSTTCKEYYDPNKSMLELVFAPAEEWISR 452

Query: 241 SDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPV 300
           SD +IIDATMKELAKLFPDEISADQSKAKI+KYHVVKTPRSVYKT+PNCEPCRPLQRSP+
Sbjct: 453 SDEDIIDATMKELAKLFPDEISADQSKAKILKYHVVKTPRSVYKTVPNCEPCRPLQRSPI 512

Query: 301 EGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM 352
           EGFYLAGDYTKQKYLASMEGAVLSGKLCAQ+IVQDY LLAARG  +L+EA++
Sbjct: 513 EGFYLAGDYTKQKYLASMEGAVLSGKLCAQSIVQDYELLAARGPRKLSEATV 564

Length = 567

>gnl\|CDD\|131778 TIGR02731, phytoene_desat, phytoene desaturase	Back alignment and domain information

>gnl\|CDD\|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase	Back alignment and domain information

>gnl\|CDD\|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase	Back alignment and domain information

>gnl\|CDD\|215268 PLN02487, PLN02487, zeta-carotene desaturase	Back alignment and domain information

>gnl\|CDD\|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase	Back alignment and domain information

>gnl\|CDD\|235977 PRK07233, PRK07233, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|177909 PLN02268, PLN02268, probable polyamine oxidase	Back alignment and domain information

>gnl\|CDD\|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>gnl\|CDD\|216400 pfam01266, DAO, FAD dependent oxidoreductase	Back alignment and domain information

>gnl\|CDD\|225307 COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		354
PLN02612		567	phytoene desaturase	100.0
PLN02487		569	zeta-carotene desaturase	100.0
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	100.0
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	100.0
TIGR03467		419	HpnE squalene-associated FAD-dependent desaturase.	100.0
PRK07233		434	hypothetical protein; Provisional	100.0
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	99.97
PLN02576		496	protoporphyrinogen oxidase	99.97
PRK12416		463	protoporphyrinogen oxidase; Provisional	99.97
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	99.96
PRK11883		451	protoporphyrinogen oxidase; Reviewed	99.96
PRK07208		479	hypothetical protein; Provisional	99.96
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	99.94
PLN02268		435	probable polyamine oxidase	99.94
PLN02676		487	polyamine oxidase	99.94
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	99.93
PLN02568		539	polyamine oxidase	99.93
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	99.92
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	99.92
PLN02529		738	lysine-specific histone demethylase 1	99.92
PLN02976		1713	amine oxidase	99.91
COG3349		485	Uncharacterized conserved protein [Function unknow	99.91
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	99.91
PLN02328		808	lysine-specific histone demethylase 1 homolog	99.91
PLN03000		881	amine oxidase	99.91
KOG4254		561	consensus Phytoene desaturase [Coenzyme transport	99.84
KOG1276		491	consensus Protoporphyrinogen oxidase [Coenzyme tra	99.81
KOG0685		498	consensus Flavin-containing amine oxidase [Coenzym	99.8
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	99.74
KOG0029		501	consensus Amine oxidase [Secondary metabolites bio	99.72
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	99.71
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	99.28
COG2907		447	Predicted NAD/FAD-binding protein [General functio	99.21
PRK13977		576	myosin-cross-reactive antigen; Provisional	98.75
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	98.45
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	98.11
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	98.04
PF07156		368	Prenylcys_lyase: Prenylcysteine lyase; InterPro: I	97.99
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	97.84
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	97.73
KOG2820		399	consensus FAD-dependent oxidoreductase [General fu	97.66
PRK10015		429	oxidoreductase; Provisional	97.63
KOG1439		440	consensus RAB proteins geranylgeranyltransferase c	97.59
PF06100		500	Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross	97.48
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	97.47
TIGR00031		377	UDP-GALP_mutase UDP-galactopyranose mutase. The ge	97.36
COG2081		408	Predicted flavoproteins [General function predicti	97.34
PRK06847		375	hypothetical protein; Provisional	97.24
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	97.23
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	97.23
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	97.13
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	97.11
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	97.1
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.08
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.05
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	97.04
PRK07045		388	putative monooxygenase; Reviewed	97.04
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	97.0
PRK10157		428	putative oxidoreductase FixC; Provisional	96.96
COG0579		429	Predicted dehydrogenase [General function predicti	96.96
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	96.94
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	96.89
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	96.85
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	96.75
PRK06185		407	hypothetical protein; Provisional	96.52
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	96.46
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	96.45
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	96.44
PRK09126		392	hypothetical protein; Provisional	96.36
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	96.35
PRK06184		502	hypothetical protein; Provisional	96.31
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	96.3
KOG4405		547	consensus GDP dissociation inhibitor [Signal trans	96.27
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	96.15
PRK08244		493	hypothetical protein; Provisional	96.15
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	96.12
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	96.08
PRK07588		391	hypothetical protein; Provisional	95.91
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	95.89
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	95.89
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	95.87
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	95.77
PLN02463		447	lycopene beta cyclase	95.71
PRK08013		400	oxidoreductase; Provisional	95.69
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	95.68
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	95.65
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	95.61
PRK06996		398	hypothetical protein; Provisional	95.59
PTZ00383		497	malate:quinone oxidoreductase; Provisional	95.52
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	95.46
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	95.29
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	95.26
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	95.16
PRK11728		393	hydroxyglutarate oxidase; Provisional	95.12
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.11
PRK05257		494	malate:quinone oxidoreductase; Validated	95.08
PRK07121		492	hypothetical protein; Validated	95.07
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	95.06
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	94.93
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	94.85
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	94.84
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	94.83
PRK06116		450	glutathione reductase; Validated	94.76
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	94.76
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	94.75
PLN02464		627	glycerol-3-phosphate dehydrogenase	94.69
PRK08274		466	tricarballylate dehydrogenase; Validated	94.69
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	94.6
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	94.55
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	94.51
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	94.41
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	94.18
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	94.16
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	94.15
TIGR00275		400	flavoprotein, HI0933 family. The model when search	94.15
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	94.07
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	94.03
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	93.98
KOG1336		478	consensus Monodehydroascorbate/ferredoxin reductas	93.97
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	93.92
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	93.83
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	93.8
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	93.76
COG5044		434	MRS6 RAB proteins geranylgeranyltransferase compon	93.74
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	93.73
PRK08132		547	FAD-dependent oxidoreductase; Provisional	93.69
PRK12839		572	hypothetical protein; Provisional	93.61
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	93.44
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	93.44
PRK13339		497	malate:quinone oxidoreductase; Reviewed	93.43
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	93.34
PRK06175		433	L-aspartate oxidase; Provisional	93.28
PRK06834		488	hypothetical protein; Provisional	93.19
PRK14989		847	nitrite reductase subunit NirD; Provisional	93.18
PRK07190		487	hypothetical protein; Provisional	93.09
PLN02697		529	lycopene epsilon cyclase	93.07
PRK12842		574	putative succinate dehydrogenase; Reviewed	92.98
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	92.94
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	92.87
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	92.85
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	92.82
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	92.8
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	92.79
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	92.76
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	92.73
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	92.72
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	92.71
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	92.69
PRK06126		545	hypothetical protein; Provisional	92.68
COG4716		587	Myosin-crossreactive antigen [Function unknown]	92.68
PRK08275		554	putative oxidoreductase; Provisional	92.67
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	92.64
PRK11445		351	putative oxidoreductase; Provisional	92.58
KOG1335		506	consensus Dihydrolipoamide dehydrogenase [Energy p	92.38
PRK07845		466	flavoprotein disulfide reductase; Reviewed	92.34
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	92.32
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	92.28
PLN02507		499	glutathione reductase	92.22
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	92.22
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	92.2
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	92.15
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	92.13
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	92.02
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	92.0
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	91.86
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	91.83
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	91.78
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	91.73
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	91.7
PRK07804		541	L-aspartate oxidase; Provisional	91.7
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	91.7
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	91.65
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	91.54
KOG2844		856	consensus Dimethylglycine dehydrogenase precursor	91.39
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	91.31
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	91.28
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	91.28
PRK08163		396	salicylate hydroxylase; Provisional	91.27
PRK07512		513	L-aspartate oxidase; Provisional	91.0
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	90.92
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	90.78
PRK08401		466	L-aspartate oxidase; Provisional	90.76
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	90.53
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	90.46
PRK07395		553	L-aspartate oxidase; Provisional	90.46
PRK09897		534	hypothetical protein; Provisional	90.41
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	90.33
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	90.32
KOG0042		680	consensus Glycerol-3-phosphate dehydrogenase [Ener	90.08
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	90.04
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	89.89
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	89.88
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	89.81
PRK06370		463	mercuric reductase; Validated	89.76
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	89.58
PTZ00058		561	glutathione reductase; Provisional	89.36
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	89.36
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	89.18
PTZ00052		499	thioredoxin reductase; Provisional	89.0
PRK08294		634	phenol 2-monooxygenase; Provisional	88.96
KOG1346		659	consensus Programmed cell death 8 (apoptosis-induc	88.91
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	88.77
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	88.57
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	88.53
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	88.48
PRK09564		444	coenzyme A disulfide reductase; Reviewed	88.28
PRK10262		321	thioredoxin reductase; Provisional	88.23
PRK08071		510	L-aspartate oxidase; Provisional	88.2
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	88.14
TIGR02053		463	MerA mercuric reductase. This model represents the	87.94
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	87.9
PRK07236		386	hypothetical protein; Provisional	87.83
PRK13512		438	coenzyme A disulfide reductase; Provisional	87.79
PRK14727		479	putative mercuric reductase; Provisional	87.65
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	87.64
PLN02546		558	glutathione reductase	87.48
PRK14694		468	putative mercuric reductase; Provisional	87.32
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	87.19
PLN02985		514	squalene monooxygenase	87.15
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	87.04
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	87.01
PRK07846		451	mycothione reductase; Reviewed	86.29
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	86.23
PRK05868		372	hypothetical protein; Validated	86.05
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	85.92
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	85.91
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	85.83
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	85.62
PRK13748		561	putative mercuric reductase; Provisional	85.45
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	85.3
PLN02815		594	L-aspartate oxidase	85.15
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	84.78
PRK06753		373	hypothetical protein; Provisional	84.58
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	84.5
PRK09077		536	L-aspartate oxidase; Provisional	84.34
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	84.15
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	84.1
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	83.92
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	83.66
KOG2404		477	consensus Fumarate reductase, flavoprotein subunit	83.07
PRK12831		464	putative oxidoreductase; Provisional	82.74
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	82.7
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	82.56
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	82.49
PRK06475		400	salicylate hydroxylase; Provisional	82.23
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	82.1
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	82.04
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	81.44
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	81.1
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	80.81

>PLN02612 phytoene desaturase	Back alignment and domain information

Probab=100.00  E-value=8.8e-44  Score=344.84  Aligned_cols=352  Identities=88%  Similarity=1.395  Sum_probs=289.4

Q ss_pred             CCChHHHHHHhhhhhHHHhccccccccccCCCHHHHHHHcCCChHHHHHHHHHHHhhhccCCcccccHHHHHHHHHHHhh
Q 018523            1 MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQ   80 (354)
Q Consensus         1 ~ls~~~k~~~~~~~~~~~~~~~~~~~~~d~~s~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~sa~~~~~~~~~~~~   80 (354)
                      +|||.+|++++..+++......+.+.++|++|+.||+++.++++.+.+.++++++.++++.+|+++|+..++..+..++.
T Consensus       213 ~ls~~~kl~~~~~~~~~~~~~~~~~~~~d~~Sv~e~l~~~~~~~~~~~~~~~~l~~~~~~~~p~~~S~~~~l~~l~~~l~  292 (567)
T PLN02612        213 MLTWPEKIKFAIGLLPAIVGGQAYVEAQDGLSVKEWMRKQGVPDRVNDEVFIAMSKALNFINPDELSMQCILIALNRFLQ  292 (567)
T ss_pred             cCCHHHHHHHHHhhhHHhcccchhhhhcCcCcHHHHHHhcCCCHHHHHHHHHHHHHHhcCCCHHHhhHHHHHHHHHHHHh
Confidence            36899999987665544333334456789999999999999999999999999998888899999999999988877766


Q ss_pred             ccCCceeeeecCCCcccchHHHHHHHHHcCCEEEecceeeEEEecCCCCEEEEEEcCCeEEEcCEEEEccChhhHhhhCC
Q 018523           81 EKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLP  160 (354)
Q Consensus        81 ~~~g~~~~~~~Gg~~~~l~~~l~~~l~~~g~~i~~~~~V~~I~~~~~g~v~~V~~~~g~~~~ad~VI~a~p~~~l~~ll~  160 (354)
                      .+.+..+.+++|+..++|.++|++.|++.|++|++|++|++|..++++++++|.+.+|+++++|+||+|+|+..+..|++
T Consensus       293 ~~~gs~~~~~~G~~~~~l~~~l~~~l~~~G~~I~l~~~V~~I~~~~~g~v~~v~~~~G~~~~ad~VI~a~p~~~l~~Ll~  372 (567)
T PLN02612        293 EKHGSKMAFLDGNPPERLCMPIVDHFQSLGGEVRLNSRIKKIELNDDGTVKHFLLTNGSVVEGDVYVSATPVDILKLLLP  372 (567)
T ss_pred             ccCCceEeeecCCchHHHHHHHHHHHHhcCCEEEeCCeeeEEEECCCCcEEEEEECCCcEEECCEEEECCCHHHHHHhCc
Confidence            55666778888885468999999999999999999999999998767766668888898899999999999999999988


Q ss_pred             cchhhhHHHHHhhccCCccEEEEEEEeccccccccCceeeccCcccchhcccccccccccCCCCcEEEEEecCCCCCCCC
Q 018523          161 ENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISC  240 (354)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~v~l~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~g~~~l~~~~~~~~~~~~~  240 (354)
                      ....+.++.+.++++.+.++++++++|++++|....++++.+.+..+++.++|..++++++++.+++.+++.++.+|.++
T Consensus       373 ~~~~~~~~~~~l~~l~~~~v~~v~l~~dr~~~~~~~~~~~~~~~~~~~~~d~S~~~~~~~~~~~~ll~~~~~~a~~~~~~  452 (567)
T PLN02612        373 DQWKEIPYFKKLDKLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSTTCKEYYDPNKSMLELVFAPAEEWISR  452 (567)
T ss_pred             chhcCcHHHHHHHhcCCCCeEEEEEEECcccCCCCCceeecCCCCceeehhhhhcchhhcCCCCeEEEEEEEcChhhhcC
Confidence            65444456677777888899999999999987545556666655555555666656666677777777766677889999


Q ss_pred             ChHHHHHHHHHHHHHhCCCCccccccccceeEEEEEEeCCCccccCCCCCCCCCCCCCCCCceEEeeccccCCCCCchhH
Q 018523          241 SDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEG  320 (354)
Q Consensus       241 ~~ee~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~L~~aG~~~~~~~~~~~~g  320 (354)
                      +++++++.++++|+++||....++.....++.+.+.+.|.+.|...|+....+|..++|++||||||||+.++||++|+|
T Consensus       453 sdeei~e~vl~~L~~lfp~~~~~~~~~~~i~~~~~v~~P~a~~~~~pg~~~~rp~~~tPi~~l~lAGd~t~~~~~~smeG  532 (567)
T PLN02612        453 SDEDIIDATMKELAKLFPDEISADQSKAKILKYHVVKTPRSVYKTVPNCEPCRPLQRSPIEGFYLAGDYTKQKYLASMEG  532 (567)
T ss_pred             CHHHHHHHHHHHHHHHCCcccccccCCceEEEEEEeccCCceEEeCCCCcccCccccCccCCEEEeecceeCCchhhHHH
Confidence            99999999999999999976321112345677788889999888788876678888999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhHHHhccccccccCC
Q 018523          321 AVLSGKLCAQAIVQDYVLLAARGKGRLAEASM  352 (354)
Q Consensus       321 Ai~sG~~aa~~il~~~~~~~~~~~~~~~~~~~  352 (354)
                      |+.||++||++|+++++...+.+..++++++.
T Consensus       533 Av~SG~~AA~~I~~~~~~~~~~~~~~~~~~~~  564 (567)
T PLN02612        533 AVLSGKLCAQSIVQDYELLAARGPRKLSEATV  564 (567)
T ss_pred             HHHHHHHHHHHHHHHhcccccccccccccccc
Confidence            99999999999999999888899888887763

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>TIGR03467 HpnE squalene-associated FAD-dependent desaturase	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism]	Back alignment and domain information

>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis []	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only]	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>COG4716 Myosin-crossreactive antigen [Function unknown]	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism]	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms]	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		354
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	3e-36
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	5e-22
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	2e-19
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	4e-16
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	5e-15
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	7e-15
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	7e-15
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	2e-14
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	1e-13
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	7e-13
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	5e-12
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	5e-12
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	1e-11
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	1e-11
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	4e-10
1sez_A		504	Protoporphyrinogen oxidase, mitochondrial; FAD-bin	2e-07
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	2e-06
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	1e-05
2e1m_C		181	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	7e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-05

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421	Back alignment and structure

 Score =  134 bits (340), Expect = 3e-36
 Identities = 32/305 (10%), Positives = 98/305 (32%), Gaps = 28/305 (9%)

Query: 29  DGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMA 88
           + +   EW++++   +     V  + +   + ++  +L+   +   +   L         
Sbjct: 126 EEIPADEWIKEKIGENEFLLSVLESFAGWADSVSLSDLTALELAKEIRAAL---RWGGPG 182

Query: 89  FLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVF 148
            + G   + +   +   I    G++     V +I + ++  V      +      D  + 
Sbjct: 183 LIRGGC-KAVIDELERIIMENKGKILTRKEVVEINI-EEKKVY---TRDNEEYSFDVAIS 237

Query: 149 ATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSV 208
              V      +  ++ +  Y K+++ +     I  ++    + +     ++F+   +++ 
Sbjct: 238 NVGVRETVKLIGRDYFDRDYLKQVDSIEPSEGIKFNLAVPGEPRIGN-TIVFTPGLMING 296

Query: 209 YADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKA 268
           + + S   K       +++    A     +     + I+   +EL ++FP+         
Sbjct: 297 FNEPSALDKSLAREGYTLIMAHMALKNGNVK----KAIEKGWEELLEIFPEGE------- 345

Query: 269 KIVKYHVVKTPRSVYKTIP-NCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKL 327
                      +      P N          P+    + GD  +      ++G  L    
Sbjct: 346 -------PLLAQVYRDGNPVNRTRAGLHIEWPLNEVLVVGDGYRPPGGIEVDGIALGVMK 398

Query: 328 CAQAI 332
             + +
Sbjct: 399 ALEKL 403

PyMOL of 3nrn

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662	Back alignment and structure

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478	Back alignment and structure

>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342	Back alignment and structure

>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		354
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	100.0
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	99.97
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	99.96
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	99.96
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	99.96
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	99.96
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	99.95
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	99.95
3nks_A		477	Protoporphyrinogen oxidase; FAD containing protein	99.95
1sez_A		504	Protoporphyrinogen oxidase, mitochondrial; FAD-bin	99.95
4dgk_A		501	Phytoene dehydrogenase; the FAD/NAD(P)-binding ros	99.94
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	99.92
4dsg_A		484	UDP-galactopyranose mutase; rossmann fold, flavin	99.91
4gde_A		513	UDP-galactopyranose mutase; flavin adenine dinucle	99.9
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	99.9
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	99.89
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	99.89
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	99.88
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	99.86
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	99.86
1rsg_A		516	FMS1 protein; FAD binding motif, oxidoreductase; H	99.84
4gut_A		776	Lysine-specific histone demethylase 1B; histone de	99.84
3ayj_A		721	Pro-enzyme of L-phenylalanine oxidase; amino acid	99.83
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	99.72
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	99.7
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	99.46
2bcg_G		453	Secretory pathway GDP dissociation inhibitor; RABG	99.45
1vg0_A		650	RAB proteins geranylgeranyltransferase component A	99.43
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	99.43
1v0j_A		399	UDP-galactopyranose mutase; flavoprotein, isomeras	99.38
2bi7_A		384	UDP-galactopyranose mutase; FAD, flavoprotein, iso	99.34
1i8t_A		367	UDP-galactopyranose mutase; rossman fold, FAD, con	99.33
3hdq_A		397	UDP-galactopyranose mutase; substrate and inhibito	99.17
2e1m_C		181	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	99.08
3dje_A		438	Fructosyl amine: oxygen oxidoreductase; fructosyl-	98.13
2e1m_A		376	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	98.03
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	97.98
2e1m_B		130	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	97.94
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	97.83
3dme_A		369	Conserved exported protein; structural genomics, P	97.82
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	97.74
3kkj_A		336	Amine oxidase, flavin-containing; oxidoreductase,	97.64
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	97.48
3atr_A		453	Conserved archaeal protein; saturating double bond	97.44
3axb_A		448	Putative oxidoreductase; dinucleotide-binding fold	97.37
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	97.36
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	97.33
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	97.29
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	97.17
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	97.16
2qa2_A		499	CABE, polyketide oxygenase CABE; FAD, angucycline,	96.87
3oz2_A		397	Digeranylgeranylglycerophospholipid reductase; str	96.82
3ihg_A		535	RDME; flavoenzyme, anthracycline, polyketide biosy	96.75
2qa1_A		500	PGAE, polyketide oxygenase PGAE; FAD, angucycline,	96.69
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	96.57
3nyc_A		381	D-arginine dehydrogenase; FAD, imino-arginine, oxi	96.57
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	96.56
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	96.5
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	96.43
2i0z_A		447	NAD(FAD)-utilizing dehydrogenases; structural geno	96.42
4at0_A		510	3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore	96.32
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	96.22
3fmw_A		570	Oxygenase; mithramycin, baeyer-villiger, flavin bi	96.16
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	95.98
1qo8_A		566	Flavocytochrome C3 fumarate reductase; oxidoreduct	95.98
2dkh_A		639	3-hydroxybenzoate hydroxylase; flavoprotein, monoo	95.89
2uzz_A		372	N-methyl-L-tryptophan oxidase; N-methyltryptophan	95.86
3da1_A		561	Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9	95.74
3v76_A		417	Flavoprotein; structural genomics, PSI-biology, NE	95.69
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	95.67
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	95.61
2e4g_A		550	Tryptophan halogenase; flavin-binding, rebeccamyci	95.6
1pj5_A		830	N,N-dimethylglycine oxidase; channelling, FAD bind	95.6
1fec_A		490	Trypanothione reductase; redox-active center, oxid	95.6
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	95.57
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	95.57
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	95.56
2weu_A		511	Tryptophan 5-halogenase; regioselectivity, antifun	95.51
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	95.5
2ywl_A		180	Thioredoxin reductase related protein; uncharacter	95.37
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	95.36
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	95.32
2cul_A		232	Glucose-inhibited division protein A-related PROT	95.29
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	95.24
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	95.23
4dna_A		463	Probable glutathione reductase; structural genomic	95.22
2wdq_A		588	Succinate dehydrogenase flavoprotein subunit; succ	95.15
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	95.15
2rgh_A		571	Alpha-glycerophosphate oxidase; flavoprotein oxida	95.13
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	95.03
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	94.98
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	94.89
2aqj_A		538	Tryptophan halogenase, pRNA; flavin-dependent halo	94.88
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	94.78
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	94.77
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	94.7
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	94.69
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	94.62
2qcu_A		501	Aerobic glycerol-3-phosphate dehydrogenase; glycer	94.5
2pyx_A		526	Tryptophan halogenase; structural genomics, JOI fo	94.48
1k0i_A		394	P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h	94.2
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	94.17
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	93.96
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	93.86
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	93.84
2zxi_A		637	TRNA uridine 5-carboxymethylaminomethyl modificat	93.76
3c4n_A		405	Uncharacterized protein DR_0571; alpha-beta protei	93.7
3g3e_A		351	D-amino-acid oxidase; FAD, flavoprotein, oxidoredu	93.66
2bs2_A		660	Quinol-fumarate reductase flavoprotein subunit A;	93.61
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	93.6
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	93.57
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	93.53
2h88_A		621	Succinate dehydrogenase flavoprotein subunit; comp	93.45
1rp0_A		284	ARA6, thiazole biosynthetic enzyme; protein ligand	93.44
1n4w_A		504	CHOD, cholesterol oxidase; flavoenzyme, steroid me	93.4
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	93.39
3ces_A		651	MNMG, tRNA uridine 5-carboxymethylaminomethyl modi	93.37
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	93.37
3h8l_A		409	NADH oxidase; membrane protein, complete form, ros	93.2
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	93.16
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	93.1
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	93.07
1chu_A		540	Protein (L-aspartate oxidase); flavoenzyme, NAD bi	93.05
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	93.0
1y56_A		493	Hypothetical protein PH1363; dehydrogenase, protei	92.99
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	92.97
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	92.96
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	92.93
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	92.87
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	92.85
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	92.81
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	92.78
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	92.68
1coy_A		507	Cholesterol oxidase; oxidoreductase(oxygen recepto	92.48
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	92.47
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	92.45
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	92.4
3r9u_A		315	Thioredoxin reductase; structural genomics, center	92.38
3klj_A		385	NAD(FAD)-dependent dehydrogenase, NIRB-family (N-	92.25
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	92.13
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	92.1
1kf6_A		602	Fumarate reductase flavoprotein; respiration, fuma	92.04
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	91.99
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	91.97
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	91.85
1ojt_A		482	Surface protein; redox-active center, glycolysis,	91.66
3dgz_A		488	Thioredoxin reductase 2; oxidoreductase, rossmann,	91.63
1nhp_A		447	NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA	91.61
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	91.57
4g6h_A		502	Rotenone-insensitive NADH-ubiquinone oxidoreducta	91.55
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	91.43
4hb9_A		412	Similarities with probable monooxygenase; flavin,	91.35
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	91.27
4b1b_A		542	TRXR, thioredoxin reductase; oxidoreductase, FAD,	91.25
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	91.23
1jnr_A		643	Adenylylsulfate reductase; oxidoreductase; HET: FA	91.21
1c0p_A		363	D-amino acid oxidase; alpha-beta-alpha motif, flav	91.17
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	91.01
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	90.99
4eqs_A		437	Coenzyme A disulfide reductase; oxidoreductase; HE	90.94
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	90.89
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	90.65
3cp8_A		641	TRNA uridine 5-carboxymethylaminomethyl modificati	90.39
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	90.23
2bry_A		497	NEDD9 interacting protein with calponin homology a	90.22
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	90.08
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	90.08
1w4x_A		542	Phenylacetone monooxygenase; baeyer-villiger, FAD;	89.93
3h28_A		430	Sulfide-quinone reductase; monotopic membrane prot	89.84
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	89.67
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	89.58
1pn0_A		665	Phenol 2-monooxygenase; two dimers, TLS refinement	89.42
3gyx_A		662	Adenylylsulfate reductase; oxidoreductase; HET: FA	89.37
3vrd_B		401	FCCB subunit, flavocytochrome C flavin subunit; su	89.29
3k30_A		690	Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi	89.23
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	89.09
2e5v_A		472	L-aspartate oxidase; archaea, oxidoreductase; HET:	89.04
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	89.01
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	88.96
4gcm_A		312	TRXR, thioredoxin reductase; FAD/NAD-linked reduct	88.93
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	88.81
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	88.8
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	88.76
3fpz_A		326	Thiazole biosynthetic enzyme; FAD, mitochondrion,	88.54
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	88.36
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	88.11
2gjc_A		326	Thiazole biosynthetic enzyme, mitochondrial; gluta	88.06
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	87.92
1lvl_A		458	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	87.92
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	87.86
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	87.33
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	87.26
3jsk_A		344	Cypbp37 protein; octameric thiazole synthase, bios	87.1
2jbv_A		546	Choline oxidase; alcohol oxidation, flavoenyzme ox	86.79
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	86.54
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	86.35
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	86.25
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	85.6
1kdg_A		546	CDH, cellobiose dehydrogenase; GMC oxidoreductase,	85.53
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	85.11
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	84.86
3sx6_A		437	Sulfide-quinone reductase, putative; sulfide:quino	84.31
4fk1_A		304	Putative thioredoxin reductase; structural genomic	83.99
4fk1_A		304	Putative thioredoxin reductase; structural genomic	83.78
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	83.49
3hyw_A		430	Sulfide-quinone reductase; monotopic membrane prot	83.25
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	83.23
2gag_A		965	Heterotetrameric sarcosine oxidase alpha-subunit;	83.05
3hyw_A		430	Sulfide-quinone reductase; monotopic membrane prot	82.59
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	82.51
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	82.48
1cjc_A		460	Protein (adrenodoxin reductase); flavoenzyme, MAD	81.98
2r0c_A		549	REBC; flavin adenine dinucleotide, monooxygenase,	81.79
3pl8_A		623	Pyranose 2-oxidase; substrate complex, H167A mutan	81.76
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	81.76
2cul_A		232	Glucose-inhibited division protein A-related PROT	81.11
4a5l_A		314	Thioredoxin reductase; oxidoreductase, redox metab	80.93
3kd9_A		449	Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o	80.86
3r9u_A		315	Thioredoxin reductase; structural genomics, center	80.75
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	80.74
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	80.72
3qfa_A		519	Thioredoxin reductase 1, cytoplasmic; protein-prot	80.4

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei}	Back alignment and structure

Probab=100.00  E-value=2.7e-31  Score=250.21  Aligned_cols=308  Identities=18%  Similarity=0.253  Sum_probs=232.4

Q ss_pred             CChHHHHHHhhhhhHHHhccccccccccCCCHHHHHHHcCCChHHHHHHHHHHHhhhccCCcccccHHHHHHHHHHHhhc
Q 018523            2 LTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQE   81 (354)
Q Consensus         2 ls~~~k~~~~~~~~~~~~~~~~~~~~~d~~s~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~sa~~~~~~~~~~~~~   81 (354)
                      +++.+|.+++..+...  .    ....++.|+.+|++++ ++++.++.+++++....++.+++++|+..++..+..+.. 
T Consensus       113 ~~~~~~~~~~~~~~~~--~----~~~~~~~s~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~-  184 (425)
T 3ka7_A          113 LSYKDRMKIALLIVST--R----KNRPSGSSLQAWIKSQ-VSDEWLIKFADSFCGWALSLKSDEVPVEEVFEIIENMYR-  184 (425)
T ss_dssp             SCHHHHHHHHHHHHHT--T----TSCCCSSBHHHHHHHH-CCCHHHHHHHHHHHHHHHSSCGGGSBHHHHHHHHHHHHH-
T ss_pred             CCHHHHHHHHHHHHhh--h----hcCCCCCCHHHHHHHh-cCCHHHHHHHHHHHHHHhCCCcccchHHHHHHHHHHHHh-
Confidence            5777888876544311  1    0234689999999998 888889999999998888899999999988877665432 


Q ss_pred             cCCceeeeecCCCcccchHHHHHHHHHcCCEEEecceeeEEEecCCCCEEEEEEcCCeEEEcCEEEEccChhhHhhhCCc
Q 018523           82 KHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPE  161 (354)
Q Consensus        82 ~~g~~~~~~~Gg~~~~l~~~l~~~l~~~g~~i~~~~~V~~I~~~~~g~v~~V~~~~g~~~~ad~VI~a~p~~~l~~ll~~  161 (354)
                      ..+  ..+++||+ +.|+++|++.+++.|++|+++++|++|..+ ++++++|++ +|++++||+||+|+|++.+.+|+++
T Consensus       185 ~~~--~~~~~gG~-~~l~~~l~~~~~~~G~~i~~~~~V~~i~~~-~~~~~gv~~-~g~~~~ad~VV~a~~~~~~~~ll~~  259 (425)
T 3ka7_A          185 FGG--TGIPEGGC-KGIIDALETVISANGGKIHTGQEVSKILIE-NGKAAGIIA-DDRIHDADLVISNLGHAATAVLCSE  259 (425)
T ss_dssp             HCS--CEEETTSH-HHHHHHHHHHHHHTTCEEECSCCEEEEEEE-TTEEEEEEE-TTEEEECSEEEECSCHHHHHHHTTT
T ss_pred             cCC--ccccCCCH-HHHHHHHHHHHHHcCCEEEECCceeEEEEE-CCEEEEEEE-CCEEEECCEEEECCCHHHHHHhcCC
Confidence            222  45789997 799999999999999999999999999985 555766777 4788999999999999999999874


Q ss_pred             ch-h--hhHHHHHhhccCCccEEEEEEEeccccccccCceeeccC--cccchhcccccccccccCCCCcEEEEEecCCCC
Q 018523          162 NW-K--EMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRS--SLLSVYADMSLTCKEYYNPNQSMLELVFAPAEE  236 (354)
Q Consensus       162 ~~-~--~~~~~~~~~~~~~~~~~~v~l~~~~~~~~~~~~~~~~~~--~~~~~~~~~s~~~~~~~~~g~~~l~~~~~~~~~  236 (354)
                      .. .  +..+.+++.++++.+.++++++++++++. .+++++..+  ++..+ ..+|..+|+.+|+|++++.+......+
T Consensus       260 ~~~~~~~~~~~~~~~~~~~~~~~~v~l~~~~~~~~-~~~~~~~~~~~~~~~~-~~~s~~~p~~ap~G~~~l~~~~~~~~~  337 (425)
T 3ka7_A          260 ALSKEADAAYFKMVGTLQPSAGIKICLAADEPLVG-HTGVLLTPYTRRINGV-NEVTQADPELAPPGKHLTMCHQYVAPE  337 (425)
T ss_dssp             TCCTTTTHHHHHHHHHCCCBEEEEEEEEESSCSSC-SSSEEECCSSSSEEEE-ECGGGTCGGGSCTTCEEEEEEEEECGG
T ss_pred             cccccCCHHHHHHhhCcCCCceEEEEeecCCCccC-cCEEEECCChhhcceE-EeccCCCCCcCCCCCeEEEEEeccccc
Confidence            31 1  44567778888888889999999988764 345555433  22222 245556788899999888765432211


Q ss_pred             CCCCChHHHHHHHHHHHHHhCCCCccccccccceeEEEEEEeCCCccccCCCCCCCCCCCCCCCCceEEeeccccCCCCC
Q 018523          237 WISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLA  316 (354)
Q Consensus       237 ~~~~~~ee~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~L~~aG~~~~~~~~~  316 (354)
                      ..+. .++.++.++++|++++|+..      .++  ..+.+|+.+.+.+.+|.. .++..++|++|||+||||+.+.++.
T Consensus       338 ~~~~-~~~~~~~~~~~l~~~~p~~~------~~~--~~v~~~~~~~P~~~~~~~-~~~~~~~p~~gL~laG~~~~~~gg~  407 (425)
T 3ka7_A          338 NVKN-LESEIEMGLEDLKEIFPGKR------YEV--LLIQSYHDEWPVNRAASG-TDPGNETPFSGLYVVGDGAKGKGGI  407 (425)
T ss_dssp             GGGG-HHHHHHHHHHHHHHHSTTCC------EEE--EEEEEEBTTBCSBSSCTT-CCCCSBCSSBTEEECSTTSCCTTCC
T ss_pred             cccc-hHHHHHHHHHHHHHhCCCCc------eEE--EEEEEECCCccccccccC-CCCCCCCCcCCeEEeCCccCCCCCC
Confidence            1112 34557999999999999743      123  366789998888888743 4567788999999999999986668


Q ss_pred             chhHHHHHHHHHHHHHHH
Q 018523          317 SMEGAVLSGKLCAQAIVQ  334 (354)
Q Consensus       317 ~~~gAi~sG~~aa~~il~  334 (354)
                      +|++|+.||++||++|+.
T Consensus       408 gv~~~~~s~~~~~~~i~~  425 (425)
T 3ka7_A          408 EVEGVALGVMSVMEKVLG  425 (425)
T ss_dssp             HHHHHHHHHHHHHHC---
T ss_pred             ccHHHHHHHHHHHHHhhC
Confidence            999999999999999873

PyMOL of 3ka7

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ...	Back alignment and structure

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus}	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G*	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A*	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A*	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis}	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum}	Back alignment and structure

>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens}	Back alignment and structure

>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5	Back alignment and structure

>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis}	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A*	Back alignment and structure

>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A*	Back alignment and structure

>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A*	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A*	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens}	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A*	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A*	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A	Back alignment and structure

>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A*	Back alignment and structure

>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A*	Back alignment and structure

>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A*	Back alignment and structure

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A*	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7}	Back alignment and structure

>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G*	Back alignment and structure

>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R*	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A	Back alignment and structure

>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis}	Back alignment and structure

>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A*	Back alignment and structure

>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7	Back alignment and structure

>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A*	Back alignment and structure

>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A*	Back alignment and structure

>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B*	Back alignment and structure

>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis}	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*	Back alignment and structure

>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV}	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A*	Back alignment and structure

>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A*	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A*	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A*	Back alignment and structure

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A*	Back alignment and structure

>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces}	Back alignment and structure

>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum}	Back alignment and structure

>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens}	Back alignment and structure

>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces}	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A*	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A*	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A*	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A*	Back alignment and structure

>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus}	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A*	Back alignment and structure

>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1	Back alignment and structure

>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A*	Back alignment and structure

>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli}	Back alignment and structure

>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans}	Back alignment and structure

>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti}	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A	Back alignment and structure

>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A*	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A*	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A*	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii}	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A*	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A*	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A*	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa}	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A*	Back alignment and structure

>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina}	Back alignment and structure

>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ...	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A*	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A*	Back alignment and structure

>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1}	Back alignment and structure

>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A*	Back alignment and structure

>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A*	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A*	Back alignment and structure

>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ...	Back alignment and structure

>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6	Back alignment and structure

>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A*	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus}	Back alignment and structure

>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A*	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A*	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae}	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A*	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ...	Back alignment and structure

>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A*	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A*	Back alignment and structure

>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A*	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A*	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens}	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum}	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A*	Back alignment and structure

>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A*	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum}	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A*	Back alignment and structure

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A*	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A*	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A*	Back alignment and structure

>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A*	Back alignment and structure

>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex}	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii}	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp}	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea}	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae}	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A*	Back alignment and structure

>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A*	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa}	Back alignment and structure

>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A*	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A*	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A*	Back alignment and structure

>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C*	Back alignment and structure

>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C*	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A*	Back alignment and structure

>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A*	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A*	Back alignment and structure

>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A*	Back alignment and structure

>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ...	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A*	Back alignment and structure

>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		354
d2dw4a2		449	c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist	1e-19
d2bcgg1		297	c.3.1.3 (G:5-301) Guanine nucleotide dissociation	1e-05
d1b5qa1		347	c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai	1e-04
d2v5za1		383	c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H	2e-04
d1gesa2		116	c.3.1.5 (A:147-262) Glutathione reductase {Escheri	8e-04

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 87.7 bits (215), Expect = 1e-19
 Identities = 37/317 (11%), Positives = 84/317 (26%), Gaps = 13/317 (4%)

Query: 28  QDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKM 87
              L V   ++++ V D         +             +           Q K  S++
Sbjct: 136 GQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEV 195

Query: 88  AFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYV 147
                   E L       + +L  E        + +L +          +   +      
Sbjct: 196 KPPRDITAEFLVKSKHRDLTALCKEY-DELAETQGKLEEKLQELEANPPSDVYLSSRDRQ 254

Query: 148 FATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLS 207
                                 K  ++         H+         Y  +  + +  L 
Sbjct: 255 ILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNG----YSCVPVALAEGLD 310

Query: 208 VYADMSLTCKEYYNPNQSMLELVFA-PAEEWISCSDSEIIDATMKELAKLFPDEISADQS 266
           +  + ++    Y      ++ +     ++ +I   D+ +    +  L +  P        
Sbjct: 311 IKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPL 370

Query: 267 K-------AKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASME 319
                    ++V          +        P  P    P+   + AG++T + Y A++ 
Sbjct: 371 PEWKTSAVQRMVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVH 430

Query: 320 GAVLSGKLCAQAIVQDY 336
           GA+LSG   A  I   +
Sbjct: 431 GALLSGLREAGRIADQF 447

PyMOL of d2dw4a2

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347	Back information, alignment and structure

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		354
d2v5za1		383	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	99.25
d2bcgg1		297	Guanine nucleotide dissociation inhibitor, GDI {Ba	99.1
d1vg0a1		491	Rab escort protein 1 {Rat (Rattus norvegicus) [Tax	98.71
d2ivda1		347	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	98.65
d2dw4a2		449	Lysine-specific histone demethylase 1, LSD1 {Human	98.47
d1d5ta1		336	Guanine nucleotide dissociation inhibitor, GDI {Co	98.45
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	98.34
d1b5qa1		347	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	98.21
d2ivda2		108	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	98.1
d1aoga2		117	Trypanothione reductase {Trypanosoma cruzi [TaxId:	98.04
d2iida2		113	L-aminoacid oxidase {Malayan pit viper (Calloselas	97.86
d1seza2		112	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	97.83
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	97.82
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	97.77
d1onfa2		117	Glutathione reductase {Plasmodium falciparum [TaxI	97.64
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	97.58
d2v5za2		112	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	97.58
d1m6ia2		137	Apoptosis-inducing factor (AIF) {Human (Homo sapie	97.57
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	97.45
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	97.36
d1pj5a2		305	N,N-dimethylglycine oxidase {Arthrobacter globifor	97.35
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	97.33
d2dw4a3		109	Lysine-specific histone demethylase 1, LSD1 {Human	97.33
d2gf3a1		281	Sarcosine oxidase {Bacillus sp., strain b0618 [Tax	97.14
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	97.08
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	96.98
d1mo9a2		121	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	96.96
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	96.96
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	96.94
d1d7ya2		121	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	96.84
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	96.77
d2gqfa1		253	Hypothetical protein HI0933 {Haemophilus influenza	96.74
d1b5qa2		112	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	96.66
d1ojta2		125	Dihydrolipoamide dehydrogenase {Neisseria meningit	96.57
d1y0pa2		308	Flavocytochrome c3 (respiratory fumarate reductase	96.57
d1d4ca2		322	Flavocytochrome c3 (respiratory fumarate reductase	96.38
d2bi7a1		314	UDP-galactopyranose mutase, N-terminal domain {Kle	96.18
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	96.1
d1qo8a2		317	Flavocytochrome c3 (respiratory fumarate reductase	96.09
d1lvla2		115	Dihydrolipoamide dehydrogenase {Pseudomonas putida	96.05
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	96.02
d1h6va2		122	Mammalian thioredoxin reductase {Rat (Rattus norve	95.29
d1xhca2		122	NADH oxidase /nitrite reductase {Pyrococcus furios	95.17
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	94.59
d1w4xa1		298	Phenylacetone monooxygenase {Thermobifida fusca [T	94.24
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	94.18
d2gv8a1		335	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	93.27
d2cula1		230	GidA-related protein TTHA1897 {Thermus thermophilu	91.69
d2bs2a2		336	Fumarate reductase {Wolinella succinogenes [TaxId:	90.78
d1n4wa1		367	Cholesterol oxidase of GMC family {Streptomyces sp	90.22
d3coxa1		370	Cholesterol oxidase of GMC family {Brevibacterium	89.25
d1kf6a2		311	Fumarate reductase {Escherichia coli [TaxId: 562]}	89.17
d1nhpa1		198	NADH peroxidase {Enterococcus faecalis [TaxId: 135	88.08
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	87.25
d1fl2a2		126	Alkyl hydroperoxide reductase subunit F (AhpF), C-	86.83
d1xhca1		167	NADH oxidase /nitrite reductase {Pyrococcus furios	86.75
d1trba2		126	Thioredoxin reductase {Escherichia coli [TaxId: 56	86.5
d1ps9a2		162	2,4-dienoyl-CoA reductase, C-terminal domain {Esch	86.5
d2gjca1		311	Thiazole biosynthetic enzyme Thi4 {Baker's yeast (	84.31
d2f5va1		379	Pyranose 2-oxidase {White-rot fungus (Peniophora s	82.98
d1ebda1		223	Dihydrolipoamide dehydrogenase {Bacillus stearothe	82.76
d1h6va1		235	Mammalian thioredoxin reductase {Rat (Rattus norve	82.68
d2voua1		265	Dihydroxypyridine hydroxylase DhpH {Arthrobacter n	82.53
d1kdga1		360	Flavoprotein domain of flavocytochrome cellobiose	81.33
d3grsa1		221	Glutathione reductase {Human (Homo sapiens) [TaxId	80.62

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monoamine oxidase B
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.25  E-value=5.6e-11  Score=105.98  Aligned_cols=127  Identities=17%  Similarity=0.181  Sum_probs=92.0

Q ss_pred             cccccCCCHHHHHHHcCCChHHHHHHHHHHHhhhccCCcccccHHHHHHHHHHH------hhccCCceeeeecCCCcccc
Q 018523           25 VEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRF------LQEKHGSKMAFLDGNPPERL   98 (354)
Q Consensus        25 ~~~~d~~s~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~sa~~~~~~~~~~------~~~~~g~~~~~~~Gg~~~~l   98 (354)
                      ...++..|+.+++.+....+ ....++..+.....+..+...++...+......      ...........+.+++ +.+
T Consensus       135 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~  212 (383)
T d2v5za1         135 AEEWDNMTMKELLDKLCWTE-SAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGS-GQV  212 (383)
T ss_dssp             HHHHHTSBHHHHHHHHCSSH-HHHHHHHHHHHHHHSSCTTTSBHHHHHHHHHTTTCHHHHHCSTTSTTSEEETTCT-HHH
T ss_pred             hhhhhhhHHHHHHHHhccch-HHHHHHHHhhhhhhccccchhhHHHHHHHHHhhcccccccccccCcceeeeccch-hHH
Confidence            34567889999999985544 466677777776667788888888877654321      1111122234567775 677


Q ss_pred             hHHHHHHHHHcCCEEEecceeeEEEecCCCCEEEEEEcCCeEEEcCEEEEccChhhHhhh
Q 018523           99 CLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQ  158 (354)
Q Consensus        99 ~~~l~~~l~~~g~~i~~~~~V~~I~~~~~g~v~~V~~~~g~~~~ad~VI~a~p~~~l~~l  158 (354)
                      ++.++   ++.|++|++|++|++|..+++ .| .|++.||++++||+||+|+|+..+.++
T Consensus       213 ~~~l~---~~~g~~i~~~~~v~~I~~~~~-~v-~v~~~~g~~~~ad~vI~a~p~~~~~~~  267 (383)
T d2v5za1         213 SERIM---DLLGDRVKLERPVIYIDQTRE-NV-LVETLNHEMYEAKYVISAIPPTLGMKI  267 (383)
T ss_dssp             HHHHH---HHHGGGEEESCCEEEEECSSS-SE-EEEETTSCEEEESEEEECSCGGGGGGS
T ss_pred             HHHHH---HHcCCeEEecCcceEEEecCC-eE-EEEECCCCEEECCEEEECCCHHHHhhC
Confidence            77776   456999999999999998544 47 489999999999999999998766553

PyMOL of d2v5za1

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}	Back information, alignment and structure

>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}	Back information, alignment and structure

>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]}	Back information, alignment and structure

>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}	Back information, alignment and structure

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]}	Back information, alignment and structure

>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure