Citrus Sinensis ID: 018662


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MDMDGEKQPSAEATNPDQAVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSHSVLGFSFCQDYGT
ccccccccccccccccHHHHHccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccHHHHHHHHcccccccEEEccccccccccccccccHHHcHHHHHHHHHHHcccccccccccccccc
ccccccccccccccccccccccccccEEEEcccccccccccHcccccccEEEccccccccccHHHHccccccEEEccccccccccccccHHHHccccccEEEcccccccccccHHHcccccEEEccccccccccHHHHHHHcccEEEcccccccccHHHcccccccEEEEEEEEEcccHHHcccccccEEEEEEcccccHHHcccccccEEEcccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEccccccccccHHHHHHHcccccccEEEEcccccEEEEcEccccccccccHHHccccccccccHHHHHHHHcccc
mdmdgekqpsaeatnpdqaveIDLSntvldltsfqlhdldsvefptnlteldltANRLTSLDSRISHLSNLKKLSLRQNLiddaaiepiSRWDALAGLEELILRdnklmkipdvsifkkLSVFDVSfneitsshglsnVTDTLKELYVsknevpkmeeiehfhdlqileFGSNRLRVMENLQNLTNLqelwlgrnrikVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLshngiskmEGLSTLVNLHvldvssnkltlvdDIQNLSrledlwlndnqIESLESIVEAVAGSRETLTTIYlennpqnlqiillpsdkfSQIYSRLILMYFFRShsvlgfsfcqdygt
mdmdgekqpsaeatnpdqaVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNeitsshglsnvtdTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTnlqelwlgrNRIKVVNLCGLKCIkkislqsnrltsMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSHSVLGFSFCQDYGT
MDMDGEKQPSAEATNPDQAVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMenlqnltnlqelwlGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSHSVLGFSFCQDYGT
********************EIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSHSVLGFSFCQD***
******************AVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSHSVLGFSFCQDYGT
**************NPDQAVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSHSVLGFSFCQDYGT
*******QPSAEATNPDQAVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSHSVLGFSFCQDYG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDMDGEKQPSAEATNPDQAVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSHSVLGFSFCQDYGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query352 2.2.26 [Sep-21-2011]
Q54Q39336 Protein phosphatase 1 reg yes no 0.775 0.812 0.432 3e-48
Q5HZV9360 Protein phosphatase 1 reg yes no 0.75 0.733 0.394 8e-45
Q15435360 Protein phosphatase 1 reg yes no 0.75 0.733 0.386 9e-45
Q5RFS7360 Protein phosphatase 1 reg yes no 0.75 0.733 0.386 1e-44
Q3UM45361 Protein phosphatase 1 reg yes no 0.75 0.731 0.390 1e-44
Q3T0W4360 Protein phosphatase 1 reg yes no 0.75 0.733 0.379 9e-44
Q6DIQ3346 Protein phosphatase 1 reg yes no 0.667 0.679 0.405 7e-38
Q32PL1345 Protein phosphatase 1 reg yes no 0.75 0.765 0.375 1e-37
P36047338 Protein phosphatase 1 reg yes no 0.755 0.786 0.397 1e-32
P22194332 Protein phosphatase 1 reg yes no 0.710 0.753 0.344 3e-32
>sp|Q54Q39|PP1R7_DICDI Protein phosphatase 1 regulatory subunit pprA OS=Dictyostelium discoideum GN=pprA PE=3 SV=1 Back     alignment and function desciption
 Score =  192 bits (488), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 126/291 (43%), Positives = 181/291 (62%), Gaps = 18/291 (6%)

Query: 27  TVLDLTSFQLHDL--DSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDA 84
           T LDLT  Q H    DS   P  L +LDLT  ++T +++ I+HL NLKKL  RQNLI   
Sbjct: 28  TYLDLTG-QPHTSIGDSYNIPETLLDLDLTNCKITKIEN-INHLKNLKKLCFRQNLI--- 82

Query: 85  AIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTD--T 142
             E I   D L  LE L L DNKL  I ++  F+ L+  D+SFNEI     LS + D   
Sbjct: 83  --EKIENIDQLKELESLDLYDNKLQVIENIKDFQSLTYLDLSFNEIRIVENLS-IKDIPK 139

Query: 143 LKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRI-KVVN 201
           +KELY++ N++ K+E ++    ++ LE GSNRLR +ENL+NL N++ LWLGRN+I ++  
Sbjct: 140 IKELYLANNKITKIENLQELVPIKNLELGSNRLREIENLENLVNIETLWLGRNKITEIKG 199

Query: 202 LCGLKCIKKISLQSNRLT--SMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSS 259
           +  L  ++ +SLQSNRLT   +KG      LEELYLSHNGI+ ++GL +L  L  LD+S+
Sbjct: 200 INHLSHLRILSLQSNRLTEIGVKGLVGLNCLEELYLSHNGITDIDGLQSLKQLRTLDISA 259

Query: 260 NKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNP 310
           NK+  +  +  L  L+++W NDN ++S+++I + V  S   +  +Y E NP
Sbjct: 260 NKIKTLVGLNELPDLDEIWCNDNLVDSMDNIEQQVTKS---IKCLYFERNP 307




Regulatory subunit of protein phosphatase 1.
Dictyostelium discoideum (taxid: 44689)
>sp|Q5HZV9|PP1R7_RAT Protein phosphatase 1 regulatory subunit 7 OS=Rattus norvegicus GN=Ppp1r7 PE=1 SV=1 Back     alignment and function description
>sp|Q15435|PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens GN=PPP1R7 PE=1 SV=1 Back     alignment and function description
>sp|Q5RFS7|PP1R7_PONAB Protein phosphatase 1 regulatory subunit 7 OS=Pongo abelii GN=PPP1R7 PE=2 SV=1 Back     alignment and function description
>sp|Q3UM45|PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus GN=Ppp1r7 PE=1 SV=2 Back     alignment and function description
>sp|Q3T0W4|PP1R7_BOVIN Protein phosphatase 1 regulatory subunit 7 OS=Bos taurus GN=PPP1R7 PE=1 SV=1 Back     alignment and function description
>sp|Q6DIQ3|PP1R7_XENTR Protein phosphatase 1 regulatory subunit 7 OS=Xenopus tropicalis GN=ppp1r7 PE=2 SV=1 Back     alignment and function description
>sp|Q32PL1|PP1R7_DANRE Protein phosphatase 1 regulatory subunit 7 OS=Danio rerio GN=ppp1r7 PE=2 SV=1 Back     alignment and function description
>sp|P36047|SDS22_YEAST Protein phosphatase 1 regulatory subunit SDS22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDS22 PE=1 SV=1 Back     alignment and function description
>sp|P22194|SDS22_SCHPO Protein phosphatase 1 regulatory subunit SDS22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds22 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
224114507337 predicted protein [Populus trichocarpa] 0.872 0.910 0.797 1e-137
255546363312 protein phosphatases pp1 regulatory subu 0.875 0.987 0.790 1e-135
224142195336 predicted protein [Populus trichocarpa] 0.869 0.910 0.784 1e-131
449443173333 PREDICTED: protein phosphatase 1 regulat 0.852 0.900 0.783 1e-131
21536755328 unknown [Arabidopsis thaliana] 0.855 0.917 0.767 1e-131
15241153328 leucine-rich repeat-containing protein [ 0.823 0.884 0.806 1e-130
357520899329 Protein phosphatase 1 regulatory subunit 0.823 0.881 0.806 1e-128
363814364330 uncharacterized protein LOC100781548 [Gl 0.823 0.878 0.786 1e-127
225445122333 PREDICTED: protein phosphatase 1 regulat 0.835 0.882 0.802 1e-127
147788249324 hypothetical protein VITISV_020599 [Viti 0.835 0.907 0.802 1e-126
>gi|224114507|ref|XP_002332347.1| predicted protein [Populus trichocarpa] gi|222832068|gb|EEE70545.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 248/311 (79%), Positives = 274/311 (88%), Gaps = 4/311 (1%)

Query: 3   MDGEKQPSAEATNP---DQAVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLT 59
           MDGE Q S   +NP   DQ VEID S+TVLDLTSFQLHDL+SVE   +LTELDLTANRL+
Sbjct: 1   MDGETQ-SPRGSNPEADDQTVEIDPSSTVLDLTSFQLHDLNSVELSPSLTELDLTANRLS 59

Query: 60  SLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKK 119
           SLD RI+HLSNL KLSLRQNLIDDAAIEP SRWD+++GL+EL+LRDNKL KIPD  IFK 
Sbjct: 60  SLDPRIAHLSNLIKLSLRQNLIDDAAIEPFSRWDSISGLQELVLRDNKLKKIPDTGIFKS 119

Query: 120 LSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVME 179
           L VFDVSFNEITS HGLS  ++TLKELYVSKNEV K+EEI+H + LQILE GSNRLRVME
Sbjct: 120 LLVFDVSFNEITSLHGLSKASNTLKELYVSKNEVTKIEEIDHLYQLQILELGSNRLRVME 179

Query: 180 NLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNG 239
           N+ N T+LQELW+GRNRIKVVNLCGLKCIKK+SLQSNRLTSMKGFEEC+ALEELYLSHNG
Sbjct: 180 NMGNFTSLQELWMGRNRIKVVNLCGLKCIKKLSLQSNRLTSMKGFEECVALEELYLSHNG 239

Query: 240 ISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRE 299
           I+KMEGLSTL NLHVLDVSSNKLT VDDIQNL++LEDLWLNDNQIESL+ + EAV  SRE
Sbjct: 240 IAKMEGLSTLANLHVLDVSSNKLTSVDDIQNLTQLEDLWLNDNQIESLKGVAEAVISSRE 299

Query: 300 TLTTIYLENNP 310
            LTTIYLENNP
Sbjct: 300 KLTTIYLENNP 310




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255546363|ref|XP_002514241.1| protein phosphatases pp1 regulatory subunit, putative [Ricinus communis] gi|223546697|gb|EEF48195.1| protein phosphatases pp1 regulatory subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224142195|ref|XP_002324444.1| predicted protein [Populus trichocarpa] gi|222865878|gb|EEF03009.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449443173|ref|XP_004139355.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like [Cucumis sativus] gi|449487955|ref|XP_004157884.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|21536755|gb|AAM61087.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15241153|ref|NP_197469.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|27808582|gb|AAO24571.1| At5g19680 [Arabidopsis thaliana] gi|110736219|dbj|BAF00080.1| hypothetical protein [Arabidopsis thaliana] gi|332005354|gb|AED92737.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357520899|ref|XP_003630738.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] gi|355524760|gb|AET05214.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|363814364|ref|NP_001242821.1| uncharacterized protein LOC100781548 [Glycine max] gi|255636570|gb|ACU18623.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225445122|ref|XP_002283839.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Vitis vinifera] gi|297738769|emb|CBI28014.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147788249|emb|CAN64835.1| hypothetical protein VITISV_020599 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
TAIR|locus:2183144328 AT5G19680 [Arabidopsis thalian 0.823 0.884 0.772 1.2e-113
DICTYBASE|DDB_G0284039336 pprA "Protein phosphatase 1 re 0.823 0.863 0.387 7.1e-45
MGI|MGI:1913635361 Ppp1r7 "protein phosphatase 1, 0.75 0.731 0.364 7.3e-43
UNIPROTKB|Q15435360 PPP1R7 "Protein phosphatase 1 0.75 0.733 0.361 7.3e-43
RGD|1308169360 Ppp1r7 "protein phosphatase 1, 0.75 0.733 0.368 9.3e-43
UNIPROTKB|Q3T0W4360 PPP1R7 "Protein phosphatase 1 0.75 0.733 0.354 8.4e-42
ZFIN|ZDB-GENE-051113-288345 ppp1r7 "protein phosphatase 1, 0.855 0.872 0.325 2.8e-41
SGD|S000001676338 SDS22 "Regulatory subunit of t 0.755 0.786 0.372 1.1e-37
ASPGD|ASPL0000056701355 AN10088 [Emericella nidulans ( 0.843 0.836 0.330 4.9e-37
UNIPROTKB|G4N707381 MGG_03649 "Protein phosphatase 0.747 0.690 0.336 2.4e-35
TAIR|locus:2183144 AT5G19680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1121 (399.7 bits), Expect = 1.2e-113, P = 1.2e-113
 Identities = 224/290 (77%), Positives = 246/290 (84%)

Query:    21 EIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNL 80
             EI  SN VLDLTS+QLH LD+VE P NL ELDLTANRL+ LDSRI+ LS LKKLSLRQNL
Sbjct:    12 EIGDSNNVLDLTSYQLHSLDTVELPPNLIELDLTANRLSGLDSRIAQLSTLKKLSLRQNL 71

Query:    81 IDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVT 140
             IDD+A+EP+S WDAL+ LEEL+LRDNKL K+PDVSIF KL V+D+SFNEITS  G+S  +
Sbjct:    72 IDDSAVEPLSHWDALSDLEELVLRDNKLAKVPDVSIFTKLLVYDISFNEITSLEGISKAS 131

Query:   141 DTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMXXXXXXXXXXXXXXGRNRIKVV 200
              TLKELYVSKNEV K+ EIEH H+LQILE GSNRLRVM              GRNRIKVV
Sbjct:   132 STLKELYVSKNEVNKIMEIEHLHNLQILELGSNRLRVMENLENFTKLEELWLGRNRIKVV 191

Query:   201 NLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSN 260
             NLCGLKCIKKISLQSNRLTSMKGFEEC+ALEELYLSHNGISKMEGLS LVNL VLDVS+N
Sbjct:   192 NLCGLKCIKKISLQSNRLTSMKGFEECVALEELYLSHNGISKMEGLSALVNLRVLDVSNN 251

Query:   261 KLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNP 310
             KLT VDDIQNL++LEDLWLNDNQIESLE+I EAV GS+E LTTIYLENNP
Sbjct:   252 KLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTGSKEKLTTIYLENNP 301


GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
DICTYBASE|DDB_G0284039 pprA "Protein phosphatase 1 regulatory subunit 7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1913635 Ppp1r7 "protein phosphatase 1, regulatory (inhibitor) subunit 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q15435 PPP1R7 "Protein phosphatase 1 regulatory subunit 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1308169 Ppp1r7 "protein phosphatase 1, regulatory subunit 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0W4 PPP1R7 "Protein phosphatase 1 regulatory subunit 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-288 ppp1r7 "protein phosphatase 1, regulatory (inhibitor) subunit 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000001676 SDS22 "Regulatory subunit of the type 1 protein phosphatase (PP1) Glc7p" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000056701 AN10088 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4N707 MGG_03649 "Protein phosphatase 1 regulatory subunit SDS22" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_2110009
hypothetical protein (338 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00440129
annotation not avaliable (251 aa)
       0.498
fgenesh4_pg.C_scaffold_18994000001
hypothetical protein (346 aa)
       0.470
gw1.64.364.1
hypothetical protein (394 aa)
       0.464
eugene3.00410223
hypothetical protein (478 aa)
       0.458
eugene3.25320001
hypothetical protein (303 aa)
       0.456
fgenesh4_pg.C_scaffold_11988000001
hypothetical protein (315 aa)
       0.452
eugene3.18390001
hypothetical protein (628 aa)
       0.437
eugene3.00161216
annotation not avaliable (392 aa)
       0.434
eugene3.01850022
hypothetical protein (331 aa)
       0.432
eugene3.00970008
hypothetical protein (481 aa)
       0.425

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 6e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 63.1 bits (153), Expect = 5e-11
 Identities = 69/303 (22%), Positives = 113/303 (37%), Gaps = 14/303 (4%)

Query: 35  QLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDA 94
               L        L+   L+ + ++SLD   + L+ L   SL  NL        IS    
Sbjct: 57  NTLLLLPSSLSRLLSLDLLSPSGISSLDGSENLLNLLPLPSLDLNLNRL--RSNISELLE 114

Query: 95  LAGLEELILRDNKLMKIPDVSIF--KKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNE 152
           L  L  L L +N +  IP +       L   D+S N+I S          LK L +S N+
Sbjct: 115 LTNLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFND 174

Query: 153 VPKMEEIEHFH-DLQILEFGSNRLRVMENLQN-LTNLQELWLGRNRIKVVNLCGLKCIK- 209
           +  + ++     +L  L+   N++  +      L+ L+EL L  N I  +          
Sbjct: 175 LSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNL 234

Query: 210 -KISLQSNRLT-SMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDD 267
             + L +N+L    +       LE L LS+N IS +  L +L NL  LD+S N L+    
Sbjct: 235 SGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSISSLGSLTNLRELDLSGNSLSNALP 294

Query: 268 IQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIY 327
           +  L     L L    + +L   ++A+     ++       +          S   S   
Sbjct: 295 LIAL-----LLLLLELLLNLLLTLKALELKLNSILLNNNILSNGETSSPEALSILESLNN 349

Query: 328 SRL 330
              
Sbjct: 350 LWT 352


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 352
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.64
KOG4237498 consensus Extracellular matrix protein slit, conta 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.46
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.43
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.4
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.34
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.25
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.22
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.2
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.84
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.64
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.56
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.55
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.55
KOG4341483 consensus F-box protein containing LRR [General fu 98.5
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.43
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.4
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.38
PLN03150623 hypothetical protein; Provisional 98.38
PLN03150623 hypothetical protein; Provisional 98.37
KOG4341483 consensus F-box protein containing LRR [General fu 98.36
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.35
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.26
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.18
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.14
KOG2123 388 consensus Uncharacterized conserved protein [Funct 98.13
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.09
PRK15386426 type III secretion protein GogB; Provisional 97.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.88
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.77
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.7
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.68
PRK15386 426 type III secretion protein GogB; Provisional 97.48
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.77
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.64
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.46
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.88
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.74
KOG4308 478 consensus LRR-containing protein [Function unknown 93.67
KOG1947 482 consensus Leucine rich repeat proteins, some prote 93.49
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 91.61
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.53
KOG4308478 consensus LRR-containing protein [Function unknown 91.48
smart0037026 LRR Leucine-rich repeats, outliers. 90.9
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.9
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 90.19
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.07
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.31
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.48
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.74
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 85.19
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 85.02
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.05
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 81.47
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.96  E-value=2.1e-30  Score=230.05  Aligned_cols=288  Identities=30%  Similarity=0.396  Sum_probs=183.3

Q ss_pred             ccCceeecCCCCCcCCCCC--CCCCcccEEEcCCCCCCcchhhhhcCCCCcEEeccCCccCccccccccccccCCCCcEE
Q 018662           24 LSNTVLDLTSFQLHDLDSV--EFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEEL  101 (352)
Q Consensus        24 ~~l~~L~l~~~~l~~~~~~--~~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~l~~L~~L  101 (352)
                      +..+.|++++|++..+...  .-+++|+++++..|.++.||.......+|+.|+|.+|.|+.+..   ..+..++-|+.|
T Consensus        78 ~~t~~LdlsnNkl~~id~~~f~nl~nLq~v~l~~N~Lt~IP~f~~~sghl~~L~L~~N~I~sv~s---e~L~~l~alrsl  154 (873)
T KOG4194|consen   78 SQTQTLDLSNNKLSHIDFEFFYNLPNLQEVNLNKNELTRIPRFGHESGHLEKLDLRHNLISSVTS---EELSALPALRSL  154 (873)
T ss_pred             cceeeeeccccccccCcHHHHhcCCcceeeeeccchhhhcccccccccceeEEeeeccccccccH---HHHHhHhhhhhh
Confidence            4456677777777766543  33577777777777777777654455567777777777766533   345556777788


Q ss_pred             EccCCCCCCCCC--CccccCCcEEEccCCCcccccCCc-ccccCcceEEccCCcCCCc--ccccCCCCCcEEEcCCCccC
Q 018662          102 ILRDNKLMKIPD--VSIFKKLSVFDVSFNEITSSHGLS-NVTDTLKELYVSKNEVPKM--EEIEHFHDLQILEFGSNRLR  176 (352)
Q Consensus       102 ~l~~~~l~~l~~--~~~~~~L~~L~l~~~~~~~~~~~~-~~~~~L~~L~l~~~~~~~~--~~~~~~~~L~~L~l~~~~l~  176 (352)
                      |++.|.|..++.  +..-.++++|++++|.++.+.... ..+.+|..|.+++|.++.+  ..|.++++|+.|++..|+++
T Consensus       155 DLSrN~is~i~~~sfp~~~ni~~L~La~N~It~l~~~~F~~lnsL~tlkLsrNrittLp~r~Fk~L~~L~~LdLnrN~ir  234 (873)
T KOG4194|consen  155 DLSRNLISEIPKPSFPAKVNIKKLNLASNRITTLETGHFDSLNSLLTLKLSRNRITTLPQRSFKRLPKLESLDLNRNRIR  234 (873)
T ss_pred             hhhhchhhcccCCCCCCCCCceEEeeccccccccccccccccchheeeecccCcccccCHHHhhhcchhhhhhcccccee
Confidence            888877777664  555567888888888777665433 2356777788888877773  34666788888888887776


Q ss_pred             Ccc--cccCCCCCcEEEccCCcccee---cCCCCCCCCEEEcCCCcCCCC--cCccccccCcEEECCCCCCCCC--CCCC
Q 018662          177 VME--NLQNLTNLQELWLGRNRIKVV---NLCGLKCIKKISLQSNRLTSM--KGFEECIALEELYLSHNGISKM--EGLS  247 (352)
Q Consensus       177 ~~~--~~~~~~~L~~L~l~~~~l~~~---~~~~~~~L~~L~l~~~~~~~~--~~~~~~~~L~~L~l~~n~l~~~--~~~~  247 (352)
                      ...  .+.++++|+.+.+..|.+...   .|..+.++++|++..|++..+  .++.++..|+.|++++|.|..+  ++++
T Consensus       235 ive~ltFqgL~Sl~nlklqrN~I~kL~DG~Fy~l~kme~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~rih~d~Ws  314 (873)
T KOG4194|consen  235 IVEGLTFQGLPSLQNLKLQRNDISKLDDGAFYGLEKMEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQRIHIDSWS  314 (873)
T ss_pred             eehhhhhcCchhhhhhhhhhcCcccccCcceeeecccceeecccchhhhhhcccccccchhhhhccchhhhheeecchhh
Confidence            553  356777777777777766655   555666777777777766655  2455666666667776666653  4556


Q ss_pred             CCCCCcEEEcCCCcCCCc--ccccCCCCCCeEEcCCCCCcchHHHHHHHhccccCccEeeccCCCccccccc
Q 018662          248 TLVNLHVLDVSSNKLTLV--DDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIIL  317 (352)
Q Consensus       248 ~~~~L~~L~l~~n~l~~~--~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~  317 (352)
                      ..++|+.|++++|.++.+  +.+..++.|++|++++|.|+.+.   ...+..+++|++|||+.|.+..-|.+
T Consensus       315 ftqkL~~LdLs~N~i~~l~~~sf~~L~~Le~LnLs~Nsi~~l~---e~af~~lssL~~LdLr~N~ls~~IED  383 (873)
T KOG4194|consen  315 FTQKLKELDLSSNRITRLDEGSFRVLSQLEELNLSHNSIDHLA---EGAFVGLSSLHKLDLRSNELSWCIED  383 (873)
T ss_pred             hcccceeEeccccccccCChhHHHHHHHhhhhcccccchHHHH---hhHHHHhhhhhhhcCcCCeEEEEEec
Confidence            666666666666666655  34455555555555555555333   22334445555555555554444433



>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-14
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 8e-07
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-14
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 8e-07
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-14
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 5e-07
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 6e-13
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 6e-13
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 9e-13
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 9e-13
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 3e-11
4fmz_A 347 Crystal Structure Of An Internalin (Inlf) From List 1e-06
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 5e-09
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 5e-09
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 7e-07
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 7e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 7e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 9e-06
4aw4_A311 Engineered Variant Of Listeria Monocytogenes Inlb I 1e-05
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 2e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 7e-05
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 8e-05
1xeu_A263 Crystal Structure Of Internalin C From Listeria Mon 2e-04
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 2e-04
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 7e-04
1otm_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 9e-04
1otn_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 9e-04
1oto_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 9e-04
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Iteration: 1

Score = 77.4 bits (189), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 73/268 (27%), Positives = 130/268 (48%), Gaps = 14/268 (5%) Query: 27 TVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLS---LRQNLIDD 83 T L + +D VE+ NLT+++ + N+LT I+ L NL KL + N I D Sbjct: 44 TTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTD----ITPLKNLTKLVDILMNNNQIAD 99 Query: 84 AAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTL 143 I P++ L GL L +N++ I + L+ ++S N I+ LS +T +L Sbjct: 100 --ITPLANLTNLTGLT---LFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLT-SL 153 Query: 144 KELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMXXXXXXXXXXXXXXGRNRIKVVNLC 203 ++L S N+V ++ + + L+ L+ SN++ + N+I + Sbjct: 154 QQLSFSSNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPL 213 Query: 204 G-LKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKL 262 G L + ++SL N+L + L +L L++N IS + LS L L L + +N++ Sbjct: 214 GILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQI 273 Query: 263 TLVDDIQNLSRLEDLWLNDNQIESLESI 290 + + + L+ L +L LN+NQ+E + I Sbjct: 274 SNISPLAGLTALTNLELNENQLEDISPI 301
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|4AW4|A Chain A, Engineered Variant Of Listeria Monocytogenes Inlb Internalin Domain With An Additional Leucine Rich Repeat Inserted Length = 311 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|1XEU|A Chain A, Crystal Structure Of Internalin C From Listeria Monocytogenes Length = 263 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|1OTM|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTN|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTO|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-66
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-50
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-33
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-55
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-51
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-50
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-50
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-31
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-49
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-48
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-28
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-46
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-41
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-38
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-44
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-44
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-43
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-34
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-38
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-34
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-24
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-33
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-32
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-30
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-26
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-32
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-32
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-32
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-31
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-31
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-31
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-30
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-30
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-30
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-29
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-20
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-14
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-18
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-16
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-12
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-13
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-09
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 2e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
 Score =  210 bits (538), Expect = 6e-66
 Identities = 75/286 (26%), Positives = 139/286 (48%), Gaps = 12/286 (4%)

Query: 27  TVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAI 86
           T L +   ++  +  +E+ TNL  L+L  N++T +   +S+L  L  L +  N I D  I
Sbjct: 47  TKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISP-LSNLVKLTNLYIGTNKITD--I 103

Query: 87  EPISRWDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSS-HGLSNVTDTLKE 145
             +     L  L EL L ++ +  I  ++   K+   ++  N   S    LSN+T  L  
Sbjct: 104 SALQ---NLTNLRELYLNEDNISDISPLANLTKMYSLNLGANHNLSDLSPLSNMT-GLNY 159

Query: 146 LYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRI-KVVNLCG 204
           L V++++V  +  I +  DL  L    N++  +  L +LT+L       N+I  +  +  
Sbjct: 160 LTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLTSLHYFTAYVNQITDITPVAN 219

Query: 205 LKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTL 264
           +  +  + + +N++T +        L  L +  N IS +  +  L  L +L+V SN+++ 
Sbjct: 220 MTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQISD 279

Query: 265 VDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNP 310
           +  + NLS+L  L+LN+NQ+ +    +E + G    LTT++L  N 
Sbjct: 280 ISVLNNLSQLNSLFLNNNQLGNE--DMEVI-GGLTNLTTLFLSQNH 322


>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.53
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.45
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.37
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.31
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.22
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.04
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.02
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.77
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.76
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.65
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.55
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.43
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.37
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.12
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.98
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.56
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.55
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.36
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.99
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=100.00  E-value=8.6e-35  Score=260.46  Aligned_cols=305  Identities=25%  Similarity=0.339  Sum_probs=269.0

Q ss_pred             cccccCceeecCCCCCcCCCCCCCCCcccEEEcCCCCCCcchhhhhcCCCCcEEeccCCccCccccccccccccCCCCcE
Q 018662           21 EIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEE  100 (352)
Q Consensus        21 ~~~~~l~~L~l~~~~l~~~~~~~~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~l~~L~~  100 (352)
                      ...+++++|+++++.+..++.+..+++|++|++++|.++.++. +.++++|++|++++|.++..     +.+..+++|++
T Consensus        41 ~~l~~L~~L~l~~~~i~~~~~~~~~~~L~~L~l~~n~i~~~~~-~~~l~~L~~L~L~~n~i~~~-----~~~~~l~~L~~  114 (347)
T 4fmz_A           41 EELESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISP-LSNLVKLTNLYIGTNKITDI-----SALQNLTNLRE  114 (347)
T ss_dssp             HHHTTCSEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCC-----GGGTTCTTCSE
T ss_pred             hhcccccEEEEeCCccccchhhhhcCCccEEEccCCccccchh-hhcCCcCCEEEccCCcccCc-----hHHcCCCcCCE
Confidence            3557899999999999999988889999999999999999887 89999999999999998873     35788999999


Q ss_pred             EEccCCCCCCCCCCccccCCcEEEccCCCcccccCCcccccCcceEEccCCcCCCcccccCCCCCcEEEcCCCccCCccc
Q 018662          101 LILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMEN  180 (352)
Q Consensus       101 L~l~~~~l~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~  180 (352)
                      |++++|.+..++.+..+++|++|++++|......+....+++|++|++++|.+.....+..+++|+++++++|.+...+.
T Consensus       115 L~l~~n~i~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~  194 (347)
T 4fmz_A          115 LYLNEDNISDISPLANLTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISP  194 (347)
T ss_dssp             EECTTSCCCCCGGGTTCTTCCEEECTTCTTCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGCTTCSEEECTTSCCCCCGG
T ss_pred             EECcCCcccCchhhccCCceeEEECCCCCCcccccchhhCCCCcEEEecCCCcCCchhhccCCCCCEEEccCCccccccc
Confidence            99999999998888899999999999996655444466689999999999999887778999999999999999987777


Q ss_pred             ccCCCCCcEEEccCCcccee-cCCCCCCCCEEEcCCCcCCCCcCccccccCcEEECCCCCCCCCCCCCCCCCCcEEEcCC
Q 018662          181 LQNLTNLQELWLGRNRIKVV-NLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSS  259 (352)
Q Consensus       181 ~~~~~~L~~L~l~~~~l~~~-~~~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~L~~L~l~~  259 (352)
                      +..+++|+.+++++|.+... .+..+++|+.|++++|.++..+.+..+++|+.|++++|.+.+++.+..+++|++|++++
T Consensus       195 ~~~l~~L~~L~l~~n~l~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~  274 (347)
T 4fmz_A          195 LASLTSLHYFTAYVNQITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGS  274 (347)
T ss_dssp             GGGCTTCCEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCS
T ss_pred             ccCCCccceeecccCCCCCCchhhcCCcCCEEEccCCccCCCcchhcCCCCCEEECCCCccCCChhHhcCCCcCEEEccC
Confidence            89999999999999998877 57889999999999999999877889999999999999999998899999999999999


Q ss_pred             CcCCCcccccCCCCCCeEEcCCCCCcchHHHHHHHhccccCccEeeccCCCccccccccCCccHHHHHHHHHHhhhhccC
Q 018662          260 NKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRETLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSH  339 (352)
Q Consensus       260 n~l~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  339 (352)
                      |++++++.+..+++|+.|++++|.++..+   ...+..+++|++|++++|++.+..   |   +.          .+.++
T Consensus       275 n~l~~~~~~~~l~~L~~L~L~~n~l~~~~---~~~l~~l~~L~~L~L~~n~l~~~~---~---~~----------~l~~L  335 (347)
T 4fmz_A          275 NQISDISVLNNLSQLNSLFLNNNQLGNED---MEVIGGLTNLTTLFLSQNHITDIR---P---LA----------SLSKM  335 (347)
T ss_dssp             SCCCCCGGGGGCTTCSEEECCSSCCCGGG---HHHHHTCTTCSEEECCSSSCCCCG---G---GG----------GCTTC
T ss_pred             CccCCChhhcCCCCCCEEECcCCcCCCcC---hhHhhccccCCEEEccCCcccccc---C---hh----------hhhcc
Confidence            99999988899999999999999998654   345667899999999999765543   1   22          26789


Q ss_pred             ceeceeeeecc
Q 018662          340 SVLGFSFCQDY  350 (352)
Q Consensus       340 ~~~~~~~~~~~  350 (352)
                      +.+++++|+..
T Consensus       336 ~~L~l~~N~i~  346 (347)
T 4fmz_A          336 DSADFANQVIK  346 (347)
T ss_dssp             SEESSSCC---
T ss_pred             ceeehhhhccc
Confidence            99999998763



>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 352
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-13
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-11
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-12
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-10
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-08
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-09
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-09
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-07
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 92.0 bits (227), Expect = 2e-21
 Identities = 46/192 (23%), Positives = 96/192 (50%), Gaps = 2/192 (1%)

Query: 92  WDALAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKN 151
              L  LE LI  +N++  I  + I   L    ++ N++     L+++T  L +L ++ N
Sbjct: 193 LAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLT-NLTDLDLANN 251

Query: 152 EVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIK-VVNLCGLKCIKK 210
           ++  +  +     L  L+ G+N++  +  L  LT L  L L  N+++ +  +  LK +  
Sbjct: 252 QISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTY 311

Query: 211 ISLQSNRLTSMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQN 270
           ++L  N ++ +        L+ L+ ++N +S +  L+ L N++ L    N+++ +  + N
Sbjct: 312 LTLYFNNISDISPVSSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLTPLAN 371

Query: 271 LSRLEDLWLNDN 282
           L+R+  L LND 
Sbjct: 372 LTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.65
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.58
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.57
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.54
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.47
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.47
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.93
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.91
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.17
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.97  E-value=2.5e-29  Score=225.62  Aligned_cols=299  Identities=23%  Similarity=0.376  Sum_probs=240.1

Q ss_pred             cccCceeecCCCCCcCCCCCCCCCcccEEEcCCCCCCcchhhhhcCCCCcEEeccCCccCccccccccccccCCCCcEEE
Q 018662           23 DLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKKLSLRQNLIDDAAIEPISRWDALAGLEELI  102 (352)
Q Consensus        23 ~~~l~~L~l~~~~l~~~~~~~~~~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~l~~L~~L~  102 (352)
                      ..++++|+++++.+++++.++.+++|++|++++|+++.+++ +.++++|++|++++|.+.+.     ..+..+++|+.|+
T Consensus        43 l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~i~~i-----~~l~~l~~L~~L~  116 (384)
T d2omza2          43 LDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQIADI-----TPLANLTNLTGLT  116 (384)
T ss_dssp             HTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCC-----GGGTTCTTCCEEE
T ss_pred             hCCCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCcc-ccCCcccccccccccccccc-----ccccccccccccc
Confidence            35799999999999999888899999999999999999875 89999999999999998874     2467789999999


Q ss_pred             ccCCCCCCCCCCccccCCcEEEccCCCcc------------------------------------------cccCCcccc
Q 018662          103 LRDNKLMKIPDVSIFKKLSVFDVSFNEIT------------------------------------------SSHGLSNVT  140 (352)
Q Consensus       103 l~~~~l~~l~~~~~~~~L~~L~l~~~~~~------------------------------------------~~~~~~~~~  140 (352)
                      +.++.+..++.......+.......+.+.                                          ........+
T Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  196 (384)
T d2omza2         117 LFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKL  196 (384)
T ss_dssp             CCSSCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGC
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccccccc
Confidence            99888776544333333333332221110                                          001122336


Q ss_pred             cCcceEEccCCcCCCcccccCCCCCcEEEcCCCccCCcccccCCCCCcEEEccCCcccee-cCCCCCCCCEEEcCCCcCC
Q 018662          141 DTLKELYVSKNEVPKMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVV-NLCGLKCIKKISLQSNRLT  219 (352)
Q Consensus       141 ~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~L~~L~l~~~~l~~~-~~~~~~~L~~L~l~~~~~~  219 (352)
                      +.++.+.+++|.+........+++|+++++.+|.+..++.+..+++|+.+++.+|.+... .+..+++|++++++++.+.
T Consensus       197 ~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~L~~L~l~~~~l~  276 (384)
T d2omza2         197 TNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQIS  276 (384)
T ss_dssp             TTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCC
T ss_pred             cccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcchhhcccccchhccccCccCCCCcccccccCCEeeccCcccC
Confidence            788899999998888766778889999999999998888888999999999999988877 7788899999999999998


Q ss_pred             CCcCccccccCcEEECCCCCCCCCCCCCCCCCCcEEEcCCCcCCCcccccCCCCCCeEEcCCCCCcchHHHHHHHhcccc
Q 018662          220 SMKGFEECIALEELYLSHNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAGSRE  299 (352)
Q Consensus       220 ~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~~~  299 (352)
                      ..+.+..++.++.+.+..|.+.+++.+..+++++.|++++|+++++..+..+++|++|++++|+|+.++.     +..++
T Consensus       277 ~~~~~~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~l~~l~~l~~l~~L~~L~L~~n~l~~l~~-----l~~l~  351 (384)
T d2omza2         277 NISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNKVSDVSS-----LANLT  351 (384)
T ss_dssp             CCGGGTTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSSCCSCCGGGGGCTTCCEEECCSSCCCCCGG-----GGGCT
T ss_pred             CCCccccccccccccccccccccccccchhcccCeEECCCCCCCCCcccccCCCCCEEECCCCCCCCChh-----HcCCC
Confidence            8877888899999999999998888888888999999999999988778889999999999999997652     46789


Q ss_pred             CccEeeccCCCccccccccCCccHHHHHHHHHHhhhhccCceeceeeee
Q 018662          300 TLTTIYLENNPQNLQIILLPSDKFSQIYSRLILMYFFRSHSVLGFSFCQ  348 (352)
Q Consensus       300 ~L~~L~l~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  348 (352)
                      +|++|++++|+++    .+++  +.+          +.++.+++++++|
T Consensus       352 ~L~~L~l~~N~l~----~l~~--l~~----------l~~L~~L~L~~Na  384 (384)
T d2omza2         352 NINWLSAGHNQIS----DLTP--LAN----------LTRITQLGLNDQA  384 (384)
T ss_dssp             TCCEEECCSSCCC----BCGG--GTT----------CTTCSEEECCCEE
T ss_pred             CCCEEECCCCcCC----CChh--hcc----------CCCCCEeeCCCCc
Confidence            9999999999654    3332  332          5688888888775



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure