Citrus Sinensis ID: 018848

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MVSTLGKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCDDTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVARNESKGEPERLRFSYYTAGTGGAGPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPVVRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVWFPEEPEGIAIEAREVLLKRASQGTINFVMNKAPWMVETEPKELGLGIYI
ccccccccccEEEEEcccHHHHHHHHccccEEEEccccccccccHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccHHHHHHHHHHHcccEEEEEccEEEEEccccccEEEEccccccEEEEEEEccccHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHcccHHHHccHHHHHHHHHHccccccccccccccEEEEEEEEEEEcccEEEEEEEccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccccEEcccccEEEEccEEEcccccc
cHHHcccccEEEEEEcccHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccHHHHHHHHHHHccccEEEEccEEEEEccccccEEEEccccccccEEEEEcccccccHHHHccccEEEEEEcccHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHccccccccccccccEEEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccEEEEcccccEEEccccEEEEEEEc
mvstlgknsefaevniYNEGSLLMALRDVDLVvhaagpfqqapkctVLEAAIETKTAYIDVCDDTIYSQRAKSFKdraiaanipaittggiypgvsNVMAAELVRVArneskgeperlrfsyytagtggagpTILATSFLLLGEEvvaynkgeeitlepysgmlsvdfgkgigrkdvfllnlpevrsarevlgvptvsarfgtapffwnwgmvtmqrlfpaeylrdRSKVQQLVQLFDPVVRAFDGIAGERVSMRVDlectdgrntvgifshrrlSVSVGTAIAAFVLAVLEgatqpgvwfpeepegIAIEAREVLLKRASqgtinfvmnkapwmvetepkelglgiyi
mvstlgknsefaEVNIYNEGSLLMALRDVDLVVHAAGpfqqapkcTVLEAAIETKTAYIDVCDDTIYSQRAKSFKDRAIAANIpaittggiypgVSNVMAAELVRVarneskgeperLRFSYYTAGTGGAGPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLLNLPEVrsarevlgvptvsarFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPVVRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVWFPEEPEGIAIEAREVLLKRASQGTinfvmnkapwmvetepkelglgiyi
MVSTLGKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCDDTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVARNESKGEPERLRFSyytagtggagPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPVVRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVWFPEEPEGIAIEAREVLLKRASQGTINFVMNKAPWMVETEPKELGLGIYI
**********FAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCDDTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVAR********RLRFSYYTAGTGGAGPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPVVRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVWFPEEPEGIAIEAREVLLKRASQGTINFVMNKAPWMVETEP*ELGLG***
M**T*GKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCDDTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVARNESKGEPERLRFSYYTAGTGGAGPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPVVRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVWFPEEPEGIAIEAREVLLKRASQGTINFVMNKAPWMVETEPKELGLGIYI
MVSTLGKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCDDTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVARNESKGEPERLRFSYYTAGTGGAGPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPVVRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVWFPEEPEGIAIEAREVLLKRASQGTINFVMNKAPWMVETEPKELGLGIYI
MVSTLGKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCDDTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVARNESKGEPERLRFSYYTAGTGGAGPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPVVRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVWFPEEPEGIAIEAREVLLKRASQGTINFVMNKAPWMVETEPKELGLGIYI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSTLGKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCDDTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVARNESKGEPERLRFSYYTAGTGGAGPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPVVRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVWFPEEPEGIAIEAREVLLKRASQGTINFVMNKAPWMVETEPKELGLGIYI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
325461580430 putative astaxanthin synthase [Carica pa 1.0 0.811 0.845 1e-173
224106217431 predicted protein [Populus trichocarpa] 1.0 0.809 0.825 1e-173
359479459422 PREDICTED: uncharacterized protein LOC10 1.0 0.827 0.819 1e-171
255544942422 conserved hypothetical protein [Ricinus 1.0 0.827 0.816 1e-169
449444893416 PREDICTED: uncharacterized protein LOC10 1.0 0.838 0.811 1e-168
164521187396 unknown, partial [Nuphar advena] 1.0 0.881 0.790 1e-164
356543827429 PREDICTED: uncharacterized protein LOC10 0.997 0.811 0.785 1e-161
357474051420 Saccharopine dehydrogenase family protei 0.994 0.826 0.777 1e-160
356538501429 PREDICTED: uncharacterized protein LOC10 0.997 0.811 0.762 1e-157
18403077428 Saccharopine dehydrogenase [Arabidopsis 1.0 0.815 0.767 1e-156
>gi|325461580|gb|ADZ14892.1| putative astaxanthin synthase [Carica papaya] Back     alignment and taxonomy information
 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 295/349 (84%), Positives = 317/349 (90%)

Query: 1   MVSTLGKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYID 60
           M + LGKNSEFAEVNI    SL  AL + DLVVH AGPFQQA KCTVLEAAIETKTAYID
Sbjct: 82  MAAKLGKNSEFAEVNIDEVESLKTALSEADLVVHTAGPFQQAEKCTVLEAAIETKTAYID 141

Query: 61  VCDDTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVARNESKGEPERLRF 120
           VCDDT Y+ RAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVAR+ESKGEPERLRF
Sbjct: 142 VCDDTSYAFRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVARSESKGEPERLRF 201

Query: 121 SYYTAGTGGAGPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLL 180
            YYTAGTGGAGPTIL TSFLLLGEEVVAYNKGEEI L+PYSGML++DFGKGIG++DV+LL
Sbjct: 202 HYYTAGTGGAGPTILVTSFLLLGEEVVAYNKGEEIKLKPYSGMLNIDFGKGIGKRDVYLL 261

Query: 181 NLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPV 240
           NLPEVRSA +VLGVPTVSARFGTAPFFWNWGM  M    P E+LRDR KVQ+LVQLFDP+
Sbjct: 262 NLPEVRSAYKVLGVPTVSARFGTAPFFWNWGMTAMTNFLPMEFLRDRDKVQRLVQLFDPL 321

Query: 241 VRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVW 300
           VRA DGIAGERVSMRVDLECTDGR TVGIFSHRRLSVSVGTA AAF LA+LEG+TQPGVW
Sbjct: 322 VRAVDGIAGERVSMRVDLECTDGRRTVGIFSHRRLSVSVGTATAAFALAILEGSTQPGVW 381

Query: 301 FPEEPEGIAIEAREVLLKRASQGTINFVMNKAPWMVETEPKELGLGIYI 349
           FPEEPEGIA+EAR+ LL+RA+QGTINFVMNK PWMVET+PKELGLGIY+
Sbjct: 382 FPEEPEGIAVEARQTLLERAAQGTINFVMNKPPWMVETDPKELGLGIYV 430

Source: Carica papaya

Species: Carica papaya

Genus: Carica

Family: Caricaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106217|ref|XP_002314088.1| predicted protein [Populus trichocarpa] gi|222850496|gb|EEE88043.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359479459|ref|XP_002274681.2| PREDICTED: uncharacterized protein LOC100251769 [Vitis vinifera] gi|297734956|emb|CBI17190.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255544942|ref|XP_002513532.1| conserved hypothetical protein [Ricinus communis] gi|223547440|gb|EEF48935.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449444893|ref|XP_004140208.1| PREDICTED: uncharacterized protein LOC101209190 [Cucumis sativus] gi|449482525|ref|XP_004156312.1| PREDICTED: uncharacterized LOC101209190 [Cucumis sativus] Back     alignment and taxonomy information
>gi|164521187|gb|ABY60455.1| unknown, partial [Nuphar advena] Back     alignment and taxonomy information
>gi|356543827|ref|XP_003540361.1| PREDICTED: uncharacterized protein LOC100781532 [Glycine max] Back     alignment and taxonomy information
>gi|357474051|ref|XP_003607310.1| Saccharopine dehydrogenase family protein expressed [Medicago truncatula] gi|355508365|gb|AES89507.1| Saccharopine dehydrogenase family protein expressed [Medicago truncatula] Back     alignment and taxonomy information
>gi|356538501|ref|XP_003537742.1| PREDICTED: uncharacterized protein LOC100811957 [Glycine max] Back     alignment and taxonomy information
>gi|18403077|ref|NP_564570.1| Saccharopine dehydrogenase [Arabidopsis thaliana] gi|14517416|gb|AAK62598.1| At1g50450/F11F12_20 [Arabidopsis thaliana] gi|20453277|gb|AAM19877.1| At1g50450/F11F12_20 [Arabidopsis thaliana] gi|332194431|gb|AEE32552.1| Saccharopine dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
TAIR|locus:2008041428 AT1G50450 [Arabidopsis thalian 1.0 0.815 0.739 4.4e-139
UNIPROTKB|Q4KB25359 PFL_3454 "Saccharopine dehydro 0.478 0.465 0.218 0.00032
TAIR|locus:2008041 AT1G50450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1361 (484.2 bits), Expect = 4.4e-139, P = 4.4e-139
 Identities = 258/349 (73%), Positives = 301/349 (86%)

Query:     1 MVSTLGKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYID 60
             MV+ LG+NSEF++V+I +   L  +LRDVDLVVHAAGPFQQAP+CTVLEAAI+TKTAY+D
Sbjct:    80 MVAKLGENSEFSQVDINDAKMLETSLRDVDLVVHAAGPFQQAPRCTVLEAAIKTKTAYLD 139

Query:    61 VCDDTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELVRVARNESKGEPERLRF 120
             VCDDT Y+ RAKS +  AIAANIPA+TT GIYPGVSNVMAAE+V  AR+E KG+PE+LRF
Sbjct:   140 VCDDTSYAFRAKSLEAEAIAANIPALTTAGIYPGVSNVMAAEMVAAARSEDKGKPEKLRF 199

Query:   121 SXXXXXXXXXXPTILATSFLLLGEEVVAYNKGEEITLEPYSGMLSVDFGKGIGRKDVFLL 180
             S          PTILATSFLLLGEEV AY +GE++ L PYSGM++VDFGKGI ++DV+LL
Sbjct:   200 SYYTAGTGGAGPTILATSFLLLGEEVTAYKQGEKVKLRPYSGMITVDFGKGIRKRDVYLL 259

Query:   181 NLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRSKVQQLVQLFDPV 240
             NLPEVRS  EVLGVPTV ARFGTAPFFWNWGM  M +L P+E LRDR+KVQQ+V+LFDPV
Sbjct:   260 NLPEVRSTHEVLGVPTVVARFGTAPFFWNWGMEIMTKLLPSEVLRDRTKVQQMVELFDPV 319

Query:   241 VRAFDGIAGERVSMRVDLECTDGRNTVGIFSHRRLSVSVGTAIAAFVLAVLEGATQPGVW 300
             VRA DG AGERVSMRVDLEC+DGR TVG+FSH++LSVSVG + AAFV A+LEG+TQPGVW
Sbjct:   320 VRAMDGFAGERVSMRVDLECSDGRTTVGLFSHKKLSVSVGVSTAAFVAAMLEGSTQPGVW 379

Query:   301 FPEEPEGIAIEAREVLLKRASQGTINFVMNKAPWMVETEPKELGLGIYI 349
             FPEEP+GIA+EAREVLLKRASQGT NF++NK PWMVETEPKE+ LGIY+
Sbjct:   380 FPEEPQGIAVEAREVLLKRASQGTFNFILNKPPWMVETEPKEVVLGIYV 428
GO:0000166 "nucleotide binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
UNIPROTKB|Q4KB25 PFL_3454 "Saccharopine dehydrogenase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.44LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IX.3638.1
hypothetical protein (399 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.V.3086.1
hypothetical protein (287 aa)
  ••    0.459
gw1.XIII.1190.1
SubName- Full=Putative uncharacterized protein; (300 aa)
  ••    0.421

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
pfam03435380 pfam03435, Saccharop_dh, Saccharopine dehydrogenas 4e-25
COG1748389 COG1748, LYS9, Saccharopine dehydrogenase and rela 5e-21
>gnl|CDD|217556 pfam03435, Saccharop_dh, Saccharopine dehydrogenase Back     alignment and domain information 
 Score =  103 bits (260), Expect = 4e-25
 Identities = 67/336 (19%), Positives = 112/336 (33%), Gaps = 51/336 (15%)

Query: 4   TLGKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCD 63
            LG       V+  N  +L+  L++ DLV++ A PF      TVL+A IET   Y+D   
Sbjct: 42  KLGLRFIAIAVDADNYEALVALLKEGDLVINLAPPFLSL---TVLKACIETGVHYVDTS- 97

Query: 64  DTIYSQRAKSFKDRAIAANIPAITTGGIYPGVSNVMAAELV-RVARNESK---------G 113
                +   +  ++A  A + A+   G  PG+ ++ A   +  +A   +K         G
Sbjct: 98  --YLREAQLALHEKAKDAGVTAVLGCGFDPGLVSLFAKYALDDLADELAKVLSVKIHCGG 155

Query: 114 EPERLRFSYYTAGTGGAGPTILATSFLLLGE---EVVAYNKGEEITLEPYSGMLSVDFGK 170
            PE        A T         +   LL E       +  G+ + +   S   ++ F  
Sbjct: 156 RPEPKDNPLEFANT--------WSPEGLLEELTNPARYWENGKWVEVGWGSHERTIPFPY 207

Query: 171 GIGRKDVFLLNLPEVRSAREVLGVPTVSARFG-TAPFFWNWGMVTMQRLFPAEYLRD--- 226
           GIG    + + L    +   V      +            +  V ++ L     LR    
Sbjct: 208 GIGPGYAYEIYLNRPGTLTRVRSWLPEADGVLFGTIRIPGYLTV-IKLLGDLGLLRPTVH 266

Query: 227 ---RSKVQQLVQLFDPVVRAFDGIAGERVSMRVDLE--CTDGRNTVGIFSH--------- 272
                 +  L  L +            +V + V++E     G    G   +         
Sbjct: 267 YAYIPPLDALKSLLESPASLGPEEQD-KVRIGVEVEGIDKLGVLLTGHIYNAYGSGLSIE 325

Query: 273 --RRL-SVSVGTAIAAFVLAVLEGA-TQPGVWFPEE 304
             R     + GT        +  G   +PGV  PEE
Sbjct: 326 EGRSAMPYTTGTPAQVAAALLAGGEWAKPGVVEPEE 361

This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase. Length = 380
>gnl|CDD|224662 COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 349
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 100.0
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 100.0
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 99.95
COG3268382 Uncharacterized conserved protein [Function unknow 99.94
KOG2733423 consensus Uncharacterized membrane protein [Functi 99.87
KOG0172445 consensus Lysine-ketoglutarate reductase/saccharop 99.18
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 97.65
PRK00048257 dihydrodipicolinate reductase; Provisional 97.49
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.03
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 96.41
TIGR00036266 dapB dihydrodipicolinate reductase. 96.13
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 95.84
PRK13302271 putative L-aspartate dehydrogenase; Provisional 95.76
PRK13303265 L-aspartate dehydrogenase; Provisional 95.49
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.16
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 95.01
CHL00194317 ycf39 Ycf39; Provisional 94.79
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 94.63
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 94.09
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 94.07
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 93.82
PRK13301267 putative L-aspartate dehydrogenase; Provisional 93.78
COG0673342 MviM Predicted dehydrogenases and related proteins 93.64
COG5310481 Homospermidine synthase [Secondary metabolites bio 93.49
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 93.47
PRK11579346 putative oxidoreductase; Provisional 93.4
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 93.39
PRK06349426 homoserine dehydrogenase; Provisional 93.32
PLN02214342 cinnamoyl-CoA reductase 93.16
PRK10206344 putative oxidoreductase; Provisional 92.95
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 92.29
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 91.7
COG3804350 Uncharacterized conserved protein related to dihyd 91.32
PRK06270341 homoserine dehydrogenase; Provisional 91.22
PLN03209576 translocon at the inner envelope of chloroplast su 91.17
cd01483143 E1_enzyme_family Superfamily of activating enzymes 90.89
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 90.66
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 90.24
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 89.92
PRK08374336 homoserine dehydrogenase; Provisional 89.87
PLN02427386 UDP-apiose/xylose synthase 89.72
PRK12548289 shikimate 5-dehydrogenase; Provisional 89.71
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 89.4
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 89.23
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 88.94
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 87.54
PRK08223287 hypothetical protein; Validated 87.51
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 87.23
PRK06392326 homoserine dehydrogenase; Provisional 87.03
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 86.93
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 86.36
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 86.1
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 85.62
PF07994295 NAD_binding_5: Myo-inositol-1-phosphate synthase; 85.59
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 85.25
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 85.22
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 85.1
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 85.02
PRK11908347 NAD-dependent epimerase/dehydratase family protein 84.81
TIGR03450351 mycothiol_INO1 inositol 1-phosphate synthase, Acti 84.5
PRK06813346 homoserine dehydrogenase; Validated 84.4
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 84.35
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 84.2
PRK07877 722 hypothetical protein; Provisional 84.14
PRK05865 854 hypothetical protein; Provisional 84.04
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 83.91
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 83.65
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 83.59
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 83.54
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 83.36
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 83.17
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 82.88
PLN02240352 UDP-glucose 4-epimerase 82.66
PF00809210 Pterin_bind: Pterin binding enzyme This Prosite en 82.56
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 82.47
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 82.38
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 82.29
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 82.27
PRK09291257 short chain dehydrogenase; Provisional 82.09
PLN00198338 anthocyanidin reductase; Provisional 82.03
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 81.53
PLN02695370 GDP-D-mannose-3',5'-epimerase 81.33
PRK08328231 hypothetical protein; Provisional 81.14
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 80.47
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 80.04
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=4.7e-43  Score=334.22  Aligned_cols=305  Identities=22%  Similarity=0.255  Sum_probs=243.2

Q ss_pred             CCCCceEEEeCCCHHHHHHHhcCCcEEEEccCCCCCCCcHHHHHHHHHcCCCeEecCCChhHHHHHHHHHHHHHHcCCcE
Q 018848            6 GKNSEFAEVNIYNEGSLLMALRDVDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCDDTIYSQRAKSFKDRAIAANIPA   85 (349)
Q Consensus         6 ~~~~~~~~~Dv~d~~~l~~~~~~~dvVIn~agP~~~~~~~~v~~aci~~Gv~YvDi~~~~~~~~~~~~l~~~a~~~g~~~   85 (349)
                      +++++++++|+.|.+++.+++++.|+||||++||+.   +.+++||+++|+||||+|...+..   .++++.|+++|+++
T Consensus        46 ~~~v~~~~vD~~d~~al~~li~~~d~VIn~~p~~~~---~~i~ka~i~~gv~yvDts~~~~~~---~~~~~~a~~Agit~  119 (389)
T COG1748          46 GGKVEALQVDAADVDALVALIKDFDLVINAAPPFVD---LTILKACIKTGVDYVDTSYYEEPP---WKLDEEAKKAGITA  119 (389)
T ss_pred             cccceeEEecccChHHHHHHHhcCCEEEEeCCchhh---HHHHHHHHHhCCCEEEcccCCchh---hhhhHHHHHcCeEE
Confidence            457999999999999999999999999999988887   799999999999999999876552   57899999999999


Q ss_pred             EecCCcCcchhHHHHHHHHHHHhcccCCCCcEEEEEEeecCCCCCch------hhHHHHHHHhCCcceeeeCCeEEEecC
Q 018848           86 ITTGGIYPGVSNVMAAELVRVARNESKGEPERLRFSYYTAGTGGAGP------TILATSFLLLGEEVVAYNKGEEITLEP  159 (349)
Q Consensus        86 v~~~G~~PGls~lla~~~~~~l~~~~~~~v~~i~i~~~~~g~~~~~~------~~~~~~l~~~~~p~~~~~~G~~~~v~~  159 (349)
                      |++||++||++|+++++++++    .+|++++|+++.+..+..+.+|      .+..+++.++.+|..+|+||+|++++|
T Consensus       120 v~~~G~dPGi~nv~a~~a~~~----~~~~i~si~iy~g~~g~~~~~~l~ya~tws~e~~l~e~~~p~~~~~~Gk~~~v~~  195 (389)
T COG1748         120 VLGCGFDPGITNVLAAYAAKE----LFDEIESIDIYVGGLGEHGDNPLGYATTWSPEINLREYTRPARYWENGKWVEVDP  195 (389)
T ss_pred             EcccCcCcchHHHHHHHHHHH----hhccccEEEEEEecCCCCCCCCccceeeecHHHhHHHhcCceEEEeCCEEEEecC
Confidence            999999999999999999985    3569999999764333333112      133447899999999999999999999


Q ss_pred             CCcceeeEccCCceeeeEEeecCCcccchhhhcC-CCeEEEEeecChhHHHHHHHHHHhhhhhccccchh--------HH
Q 018848          160 YSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLG-VPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRS--------KV  230 (349)
Q Consensus       160 ~~~~~~~~fp~~~G~~~~~~~~~~e~~tl~~~~~-v~~v~~~~~~~~~~~~~~l~~~~~l~~~~~l~~~~--------~v  230 (349)
                      ++..+.++||. .|...+|.++|+|+.+|.++++ +.+.++++.+..+   ++++.++.|..+++++.++        ++
T Consensus       196 ~~~~~~~~~~~-~G~~~~y~~~~~el~sL~~~i~~~~~~~~~~t~r~~---g~~~~i~~L~~lGll~~~~v~~~~~i~p~  271 (389)
T COG1748         196 LEEREVFEFPV-IGYGDVYAFYHDELRSLVKTIPGVVRTRFEMTFRYP---GHLEVIKALRDLGLLSREPVKVQQEIVPL  271 (389)
T ss_pred             cccccccccCC-CCceeEEecCCccHHHHHHhCcccceeeEEeecCcc---cHHHHHHHHHHcCCCcccccccccccchH
Confidence            99999899996 8899999999999999999997 7788888887622   3444555556778777642        12


Q ss_pred             HHHHHhhHHHHhhcccCCCceEEEEEEEEE-cCCCeeEeeee------------cCCcchhhhHHHHHHHHHHHcCC-CC
Q 018848          231 QQLVQLFDPVVRAFDGIAGERVSMRVDLEC-TDGRNTVGIFS------------HRRLSVSVGTAIAAFVLAVLEGA-TQ  296 (349)
Q Consensus       231 ~~l~~~~~~l~~~~~~~~~~~~~~~v~v~g-~~G~~~~~~~~------------~~~~~~~Ta~~aa~~a~~ll~G~-~~  296 (349)
                      +.+.+++...... .+...+..++.++++| +||+.....|.            .++++.+|+++++++|+++++|+ ..
T Consensus       272 eflk~vl~~~~s~-~~~~~d~t~i~v~v~G~kdG~~~~~~y~~~~~~~~~~~~~~~ais~ttg~pa~~~a~ll~~g~~~~  350 (389)
T COG1748         272 EFLKAVLPDPLSL-APDYKDVTVIGVEVKGTKDGRDKTVFYNVKDHAEAYSEVGSSAISYTTGVPAAIGAELLAEGEWET  350 (389)
T ss_pred             HHHHHhccccccc-CCCcCceEEEEEEEEEEEcCeeeEEEecchhhHHHhhccccceeehhccccHHHHHHHHHcCCCCc
Confidence            2333332221111 1223677899999999 79987644222            37889999999999999999998 58


Q ss_pred             CcccCCcCCCCcchhhHHHHHHHhcccchhhhhcc--CCcccccCc
Q 018848          297 PGVWFPEEPEGIAIEAREVLLKRASQGTINFVMNK--APWMVETEP  340 (349)
Q Consensus       297 ~GV~~pe~~~~~~~~~~~~~~~~~~~g~~~~~~~~--~~~~~~~~~  340 (349)
                      +||+.||+++.+++.               +.+++  +||+...+.
T Consensus       351 ~Gv~~~E~l~~~~~~---------------~~~~~~~l~~~~~~~~  381 (389)
T COG1748         351 PGVVNPEELGPDPFL---------------EKLLIRGLPWRGVENE  381 (389)
T ss_pred             CcEecHHHhCCChhH---------------HHHhhccCcchhcccC
Confidence            899999999988877               33333  899987753

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>KOG0172 consensus Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>COG5310 Homospermidine synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF07994 NAD_binding_5: Myo-inositol-1-phosphate synthase; InterPro: IPR002587 1L-myo-Inositol-1-phosphate synthase (5 Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR03450 mycothiol_INO1 inositol 1-phosphate synthase, Actinobacterial type Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 1e-21
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 1e-09
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 2e-09
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Length = 467 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Length = 450 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 100.0
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 100.0
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 100.0
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 99.92
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 99.91
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 99.81
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.57
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.07
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 96.8
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 96.65
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.41
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.16
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.1
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.08
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.06
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.99
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 95.98
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 95.97
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.92
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 95.91
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.91
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.72
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 95.47
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 95.37
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.29
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 95.26
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 95.08
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.05
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 95.01
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 94.91
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 94.75
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.75
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 94.72
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 94.67
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 94.6
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 94.59
3euw_A344 MYO-inositol dehydrogenase; protein structure init 94.57
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 94.57
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 94.52
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 94.51
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 94.47
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 94.46
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 94.44
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 94.42
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 94.41
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 94.38
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.38
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 94.33
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 94.3
3oqb_A383 Oxidoreductase; structural genomics, protein struc 94.26
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 94.26
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.2
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 94.18
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 94.18
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 94.17
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 94.12
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 94.11
2wm3_A299 NMRA-like family domain containing protein 1; unkn 94.11
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 94.11
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 94.02
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 93.98
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 93.97
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 93.96
1xq6_A253 Unknown protein; structural genomics, protein stru 93.94
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 93.94
4h3v_A390 Oxidoreductase domain protein; structural genomics 93.91
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 93.85
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 93.82
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 93.75
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 93.73
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 93.59
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 93.58
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 93.57
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 93.5
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 93.45
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 93.39
4had_A350 Probable oxidoreductase protein; structural genomi 93.36
3slg_A372 PBGP3 protein; structural genomics, seattle struct 93.25
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 93.23
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.02
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 92.94
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 92.94
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 92.92
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 92.89
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 92.74
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 92.71
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 92.7
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 92.7
1ydw_A362 AX110P-like protein; structural genomics, protein 92.6
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 92.53
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 92.46
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 92.42
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 92.41
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 92.41
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 92.4
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 92.39
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 92.36
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 92.31
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 92.22
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 92.0
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 91.84
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 91.74
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 91.57
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 91.55
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 91.51
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 91.41
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 91.31
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 91.25
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 91.21
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 91.01
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 91.0
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 90.95
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 90.67
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 90.52
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 90.45
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 90.14
3btv_A438 Galactose/lactose metabolism regulatory protein GA 90.13
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 90.02
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 90.01
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 89.97
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 89.95
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 89.95
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 89.87
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 89.74
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 89.71
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 89.55
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 89.49
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 89.44
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 89.37
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 89.36
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 89.04
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 88.89
3imf_A257 Short chain dehydrogenase; structural genomics, in 88.79
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 88.59
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 88.45
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 88.44
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 88.43
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 88.34
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 88.27
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 88.22
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 88.21
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 88.2
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 88.12
4dqx_A277 Probable oxidoreductase protein; structural genomi 87.98
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 87.95
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 87.94
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 87.94
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 87.84
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 87.84
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 87.82
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 87.72
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 87.66
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 87.64
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 87.61
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 87.5
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 87.49
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 87.42
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 87.42
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 87.35
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 87.12
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 87.05
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 86.96
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 86.96
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 86.92
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 86.92
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 86.81
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 86.79
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 86.76
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 86.76
1nff_A260 Putative oxidoreductase RV2002; directed evolution 86.75
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 86.75
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 86.67
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 86.53
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 86.51
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 86.5
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 86.43
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 86.38
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 86.34
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 86.25
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 86.17
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 86.16
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 86.13
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 86.09
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 86.07
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 86.05
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 86.03
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 86.02
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 85.99
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 85.96
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 85.95
3edm_A259 Short chain dehydrogenase; structural genomics, ox 85.94
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 85.89
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 85.79
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 85.68
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 85.56
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 85.5
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 85.45
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 85.42
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 85.35
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 85.25
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 85.24
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 85.22
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 85.2
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 85.2
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 85.16
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 85.11
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 85.09
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 85.08
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 85.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 84.99
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 84.99
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 84.97
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 84.95
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 84.93
1spx_A278 Short-chain reductase family member (5L265); paral 84.81
3e03_A274 Short chain dehydrogenase; structural genomics, PS 84.77
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 84.76
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 84.73
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 84.73
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 84.72
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 84.7
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 84.69
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 84.67
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 84.65
2d59_A144 Hypothetical protein PH1109; COA binding, structur 84.6
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 84.6
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 84.56
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 84.55
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 84.47
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 84.4
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 84.39
3cxt_A291 Dehydrogenase with different specificities; rossma 84.38
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 84.35
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 84.28
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 84.24
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 84.21
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 84.2
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 84.17
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 84.05
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 84.01
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 84.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 83.94
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 83.9
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 83.77
3tjr_A301 Short chain dehydrogenase; structural genomics, se 83.75
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 83.74
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 83.65
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 83.47
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 83.47
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 83.43
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 83.35
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 83.32
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 83.1
4eso_A255 Putative oxidoreductase; NADP, structural genomics 82.85
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 82.85
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 82.85
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 82.84
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 82.8
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 82.78
3tox_A280 Short chain dehydrogenase; structural genomics, PS 82.75
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 82.73
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 82.68
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 82.62
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 82.4
2duw_A145 Putative COA-binding protein; ligand binding prote 82.34
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 82.32
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 82.3
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 82.24
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 82.23
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 82.15
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 82.08
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 81.81
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 81.8
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 81.75
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 81.75
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 81.74
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 81.73
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 81.68
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 81.64
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 81.55
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 81.52
3tsc_A277 Putative oxidoreductase; structural genomics, seat 81.45
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 81.45
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 81.35
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 81.34
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 81.3
1xkq_A280 Short-chain reductase family member (5D234); parra 81.23
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 81.21
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 81.15
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 81.13
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 81.02
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 80.97
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 80.8
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 80.65
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 80.51
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 80.48
1xq1_A266 Putative tropinone reducatse; structural genomics, 80.41
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 80.38
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 80.35
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 80.34
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 80.33
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 80.32
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 80.23
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 80.23
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 80.08
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 80.06
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 80.01
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
Probab=100.00  E-value=1e-38  Score=311.45  Aligned_cols=292  Identities=20%  Similarity=0.245  Sum_probs=232.8

Q ss_pred             CCCceEEEeCCCHHHHHHHhcC--CcEEEEccCCCCCCCcHHHHHHHHHcCCCeEecCCChhH------HHHHHHHHHHH
Q 018848            7 KNSEFAEVNIYNEGSLLMALRD--VDLVVHAAGPFQQAPKCTVLEAAIETKTAYIDVCDDTIY------SQRAKSFKDRA   78 (349)
Q Consensus         7 ~~~~~~~~Dv~d~~~l~~~~~~--~dvVIn~agP~~~~~~~~v~~aci~~Gv~YvDi~~~~~~------~~~~~~l~~~a   78 (349)
                      .+++.+++|+.|.+++.+++++  +|+||||+||+..   .+++++|+++|+||+|+++..+.      .....++++.|
T Consensus        53 ~~~~~~~~D~~d~~~l~~~l~~~~~DvVin~ag~~~~---~~v~~a~l~~g~~vvD~a~~~~~~~~~~~~~~~~~l~~~a  129 (405)
T 4ina_A           53 GEIDITTVDADSIEELVALINEVKPQIVLNIALPYQD---LTIMEACLRTGVPYLDTANYEHPDLAKFEYKEQWAFHDRY  129 (405)
T ss_dssp             CCCEEEECCTTCHHHHHHHHHHHCCSEEEECSCGGGH---HHHHHHHHHHTCCEEESSCCBCTTCSCBCSHHHHTTHHHH
T ss_pred             CceEEEEecCCCHHHHHHHHHhhCCCEEEECCCcccC---hHHHHHHHHhCCCEEEecCCCCcccchhhhHHHHHHHHHH
Confidence            3688999999999999999997  9999999999875   69999999999999999775421      13335789999


Q ss_pred             HHcCCcEEecCCcCcchhHHHHHHHHHHHhcccCCCCcEEEEEEeecCCCCCc---hhhHHHHHHHhCCcceeeeCCeEE
Q 018848           79 IAANIPAITTGGIYPGVSNVMAAELVRVARNESKGEPERLRFSYYTAGTGGAG---PTILATSFLLLGEEVVAYNKGEEI  155 (349)
Q Consensus        79 ~~~g~~~v~~~G~~PGls~lla~~~~~~l~~~~~~~v~~i~i~~~~~g~~~~~---~~~~~~~l~~~~~p~~~~~~G~~~  155 (349)
                      +++|+++++++|++||++++++.++++    +.+++++++++++++++..+..   ..+..++++++.+|..+|+||+++
T Consensus       130 ~~aG~~~i~g~G~~PG~~~l~a~~~~~----~~~~~i~~i~i~~~~gg~~g~~~~~~~sp~~~~~~~~~~~~~~~~G~~~  205 (405)
T 4ina_A          130 KEKGVMALLGSGFDPGVTNVFCAYAQK----HYFDEIHEIDILDCNAGDHGYPFATNFNPEINLREVSSKGRYWENGEWI  205 (405)
T ss_dssp             HHHTCEEEECCBTTTBHHHHHHHHHHH----HTCSEEEEEEEEEEECCBCSSSSCCSSCHHHHHHHTTSCEEEEETTEEE
T ss_pred             HHhCCEEEEcCCCCccHHHHHHHHHHH----hccCcccEEEEEEecCCCCCccceeeeCHHHHHHHhcCCcEEEECCEEE
Confidence            999999999999999999999999996    3588999999977655433221   123446788999999999999999


Q ss_pred             EecCCCcceeeEccCCceeeeEEeecCCcccchhhhcC-CCeEEEEeecChhHHHHHHHHHHhhhhhccccchh------
Q 018848          156 TLEPYSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLG-VPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDRS------  228 (349)
Q Consensus       156 ~v~~~~~~~~~~fp~~~G~~~~~~~~~~e~~tl~~~~~-v~~v~~~~~~~~~~~~~~l~~~~~l~~~~~l~~~~------  228 (349)
                      .++|++..+.++||. +|++++|.++++|+.||+++++ +++++||+++.+.+.+.    ++.|..++++++++      
T Consensus       206 ~~~~~~~~~~~~fp~-~G~~~~y~~~~~e~~tl~~~~~~~~~v~~~~~~~~~~~~~----~~~L~~lGl~~~~~v~~~g~  280 (405)
T 4ina_A          206 ETEPMEIMQVWDYPE-VGPKDSYLLYHEELESLVRNIKGLKRIRFFMTFGQSYLTH----MRCLENVGMLRIDEIEVNGC  280 (405)
T ss_dssp             EESTTCCEEEEEETT-TEEEEEEEECCTHHHHHHHHSTTCCEEEEEEECCHHHHHH----HHHHHHHTTTCCSCEEETTE
T ss_pred             EecCCceeEEEECCC-CceeeEEEeCCCcHHHHHhhCCCcceEEeecccCHHHHHH----HHHHHHcCCCCCCceeeCCc
Confidence            999999999999996 9999999999999999999997 79999999999875443    34445566666442      


Q ss_pred             ---HHHHHHHhhHHHHhhcccCCCceEEEEEEEEE-cCCCeeE----eeee---------cCCcchhhhHHHHHHHHHHH
Q 018848          229 ---KVQQLVQLFDPVVRAFDGIAGERVSMRVDLEC-TDGRNTV----GIFS---------HRRLSVSVGTAIAAFVLAVL  291 (349)
Q Consensus       229 ---~v~~l~~~~~~l~~~~~~~~~~~~~~~v~v~g-~~G~~~~----~~~~---------~~~~~~~Ta~~aa~~a~~ll  291 (349)
                         +++.++.++...... .+...|...+.++++| +||++..    .+.+         .++|++|||++++++|++++
T Consensus       281 ~v~p~~~l~~~l~~~~~~-~~~~~d~~~i~~~v~g~~~G~~~~~~~~~~~~~~~~~~~~~~~a~~~ttg~p~~i~a~li~  359 (405)
T 4ina_A          281 KVVPIQVLKALLPDPASL-ASRTKGKTNIGCYIKGIKEGKARTIYIYNVCDHESCYREVNAQAISYTTGVPAMIGAKLML  359 (405)
T ss_dssp             EECHHHHHHHHSCCHHHH-TTTCBSEEEEEEEEEEEETTEEEEEEEEEEEEHHHHHHHHSSCHHHHHHHHHHHHHHHHHH
T ss_pred             eecHHHHHHHhcchhhcc-CCCCCCeEEEEEEEEEEECCeEEEEEEEEEeccccccccccceEEEeccChhHHHHHHHHh
Confidence               233344443332222 2345678899999999 8998663    2222         37889999999999999999


Q ss_pred             cCC-CCCcccCCcCCCCcchh
Q 018848          292 EGA-TQPGVWFPEEPEGIAIE  311 (349)
Q Consensus       292 ~G~-~~~GV~~pe~~~~~~~~  311 (349)
                      +|+ ..+||+.||++...||.
T Consensus       360 ~G~~~~~Gv~~~e~~~~~~fl  380 (405)
T 4ina_A          360 EGKWSGKGVFNMEELDPDPFM  380 (405)
T ss_dssp             TTSSCCSEEEEGGGSCSHHHH
T ss_pred             CCccCCCceecccccCcHHHH
Confidence            999 48999999998644333
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
d1e5qa2267 Saccharopine reductase {Rice blast fungus (Magnapo 98.42
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.08
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.55
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.4
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.45
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 92.55
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 90.26
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 89.62
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 89.51
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 89.46
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 88.48
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 88.43
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 88.32
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 87.94
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 86.76
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.5
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 86.22
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 85.59
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 85.5
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 85.35
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 85.15
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 84.88
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 84.77
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 83.84
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 83.53
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 82.44
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 82.43
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 82.03
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 81.98
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 81.79
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 80.68
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 80.64
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 80.62
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 80.58
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.56
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 80.41
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 80.32
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 80.19
>d1e5qa2 d.81.1.2 (A:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: Homoserine dehydrogenase-like
domain: Saccharopine reductase
species: Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]

Probab=98.42  E-value=9.2e-08  Score=85.03  Aligned_cols=130  Identities=12%  Similarity=0.112  Sum_probs=83.4

Q ss_pred             cCcchhHHHHHHHHHHHhcccCCCCcEEEEEEeecCCCCC----ch--hhH----HHHHHHhCCcceeeeCCeEEEecC-
Q 018848           91 IYPGVSNVMAAELVRVARNESKGEPERLRFSYYTAGTGGA----GP--TIL----ATSFLLLGEEVVAYNKGEEITLEP-  159 (349)
Q Consensus        91 ~~PGls~lla~~~~~~l~~~~~~~v~~i~i~~~~~g~~~~----~~--~~~----~~~l~~~~~p~~~~~~G~~~~v~~-  159 (349)
                      ++||+++|+|..++++++ +...+++++.. || ||.+.+    .|  +.+    ..++.++.+|+.+++||+.+.+++ 
T Consensus         1 LdPGidhm~A~~~i~~~~-~~~g~i~~f~s-~c-GGLp~p~~~~np~~YkfsWsp~gvi~~~~~~A~~~~~G~~~~v~~~   77 (267)
T d1e5qa2           1 LDPGIDHLYAIKTIEEVH-AAGGKIKTFLS-YC-GGLPAPESSDNPLGYKFSWSSRGVLLALRNAASFYKDGKVTNVAGP   77 (267)
T ss_dssp             BTTBHHHHHHHHHHHHHH-HTTCEEEEEEE-EE-EEEECGGGCCSTTSCCBSSCHHHHHHHTTCCEEEEETTEEEEECGG
T ss_pred             CCCcHHHHHHHHHHHHHH-hcCCcEEEEEE-Ee-cCccCCCCCCCCccceEEeccchhHHHhcCcceeeeCCeEEEECCH
Confidence            589999999999999987 34567888875 55 676431    12  233    347888999999999999999988 


Q ss_pred             --CCcceeeEccCCceeeeEEeecCCcccchhhhcCCCeEEEEeecChhHHHHHHHHHHhhhhhccccch
Q 018848          160 --YSGMLSVDFGKGIGRKDVFLLNLPEVRSAREVLGVPTVSARFGTAPFFWNWGMVTMQRLFPAEYLRDR  227 (349)
Q Consensus       160 --~~~~~~~~fp~~~G~~~~~~~~~~e~~tl~~~~~v~~v~~~~~~~~~~~~~~l~~~~~l~~~~~l~~~  227 (349)
                        ++..+.+.|++ .+..++  +++.+.......++++++.+.....- .++++...++.+..+++++++
T Consensus        78 ~~~~~~~~~~~~~-~~~~E~--~pnrdsl~y~~~y~~~~i~t~~rgTL-Ry~G~~~~~~~l~~lGl~~~~  143 (267)
T d1e5qa2          78 ELMATAKPYFIYP-GFAFVA--YPNRDSTPYKERYQIPEADNIVRGTL-RYQGFPQFIKVLVDIGFLSDE  143 (267)
T ss_dssp             GSGGGCEECCSST-TBCEEE--EECSBCTTHHHHTTCTTCSEEEEEEE-EETTHHHHHHHHHHTTTTCCC
T ss_pred             HhhhhceeeeccC-CcceEE--EecCCCcchhhhhcCcchhhhhhhhh-cccchHHHHHHHHHHHhccCC
Confidence              44455677764 456664  57788777666666544433221111 122333344444455555543
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure