Citrus Sinensis ID: 018957
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 348 | ||||||
| 242129046 | 557 | ATP synthase beta subunit 1 [Gossypium h | 0.985 | 0.615 | 0.851 | 1e-160 | |
| 356575611 | 559 | PREDICTED: ATP synthase subunit beta, mi | 0.985 | 0.613 | 0.837 | 1e-160 | |
| 3893824 | 553 | ATPase beta subunit [Nicotiana sylvestri | 0.965 | 0.607 | 0.818 | 1e-159 | |
| 3676296 | 556 | mitochondrial ATPase beta subunit [Nicot | 0.977 | 0.611 | 0.817 | 1e-157 | |
| 255582911 | 561 | ATP synthase beta subunit, putative [Ric | 0.931 | 0.577 | 0.875 | 1e-157 | |
| 356536246 | 559 | PREDICTED: ATP synthase subunit beta, mi | 0.985 | 0.613 | 0.837 | 1e-156 | |
| 3893822 | 555 | ATPase beta subunit [Nicotiana sylvestri | 0.974 | 0.610 | 0.812 | 1e-155 | |
| 357444609 | 1127 | ATP synthase subunit beta [Medicago trun | 0.988 | 0.305 | 0.843 | 1e-155 | |
| 218188864 | 625 | hypothetical protein OsI_03305 [Oryza sa | 0.982 | 0.547 | 0.817 | 1e-154 | |
| 115439241 | 557 | Os01g0685800 [Oryza sativa Japonica Grou | 0.982 | 0.614 | 0.817 | 1e-154 |
| >gi|242129046|gb|ACS83602.1| ATP synthase beta subunit 1 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
Score = 570 bits (1470), Expect = e-160, Method: Compositional matrix adjust.
Identities = 293/344 (85%), Positives = 310/344 (90%), Gaps = 1/344 (0%)
Query: 1 MASRRLLSSLLRSSVRRSPSKSSLSNSSVFSPAATRRASPYGHLLSRVSEYATSAAATAP 60
MASRRLLSS LRS+ RRS SKS + SP+ TRR P + LSR +EY+TSAAA A
Sbjct: 1 MASRRLLSSFLRSTSRRSLSKSPSPTPRLPSPSPTRRPFPCPYFLSRDAEYSTSAAAAAS 60
Query: 61 PAQTPKSDVKKGGGGKITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSV 120
KKGG GKITDEFTG GAIGQVCQVIGAVVDVRFDEGLPPILTALEV+DHS+
Sbjct: 61 APSQ-PPPAKKGGKGKITDEFTGAGAIGQVCQVIGAVVDVRFDEGLPPILTALEVMDHSI 119
Query: 121 RLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPID 180
RLVLEVAQH+GE +VRTIAMDGTEGLVRGQ VLNTGSPITVPVGR TLGRI+NVIGEPID
Sbjct: 120 RLVLEVAQHLGENMVRTIAMDGTEGLVRGQPVLNTGSPITVPVGRATLGRIINVIGEPID 179
Query: 181 EKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKT 240
EKG+LKT+H+LPIHREAPAFV+QATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKT
Sbjct: 180 EKGELKTDHFLPIHREAPAFVDQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKT 239
Query: 241 VLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQ 300
VLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLG+KQADSKCALVYGQ
Sbjct: 240 VLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGEKQADSKCALVYGQ 299
Query: 301 MNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQVS 344
MNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQ +
Sbjct: 300 MNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQAN 343
|
Source: Gossypium hirsutum Species: Gossypium hirsutum Genus: Gossypium Family: Malvaceae Order: Malvales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356575611|ref|XP_003555932.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|3893824|gb|AAD03394.1| ATPase beta subunit [Nicotiana sylvestris] | Back alignment and taxonomy information |
|---|
| >gi|3676296|gb|AAD03392.1| mitochondrial ATPase beta subunit [Nicotiana sylvestris] | Back alignment and taxonomy information |
|---|
| >gi|255582911|ref|XP_002532227.1| ATP synthase beta subunit, putative [Ricinus communis] gi|223528084|gb|EEF30158.1| ATP synthase beta subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356536246|ref|XP_003536650.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|3893822|gb|AAD03393.1| ATPase beta subunit [Nicotiana sylvestris] | Back alignment and taxonomy information |
|---|
| >gi|357444609|ref|XP_003592582.1| ATP synthase subunit beta [Medicago truncatula] gi|355481630|gb|AES62833.1| ATP synthase subunit beta [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|218188864|gb|EEC71291.1| hypothetical protein OsI_03305 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|115439241|ref|NP_001043900.1| Os01g0685800 [Oryza sativa Japonica Group] gi|113533431|dbj|BAF05814.1| Os01g0685800 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 348 | ||||||
| UNIPROTKB|Q01859 | 552 | ATPB "ATP synthase subunit bet | 0.882 | 0.556 | 0.853 | 2.8e-137 | |
| TAIR|locus:505006590 | 556 | AT5G08690 [Arabidopsis thalian | 0.890 | 0.557 | 0.768 | 6.1e-126 | |
| TAIR|locus:504956338 | 559 | AT5G08680 [Arabidopsis thalian | 0.896 | 0.558 | 0.764 | 2.6e-125 | |
| RGD|621368 | 529 | Atp5b "ATP synthase, H+ transp | 0.732 | 0.482 | 0.809 | 5.1e-106 | |
| UNIPROTKB|G3V6D3 | 529 | Atp5b "ATP synthase subunit be | 0.732 | 0.482 | 0.809 | 5.1e-106 | |
| UNIPROTKB|P06576 | 529 | ATP5B "ATP synthase subunit be | 0.732 | 0.482 | 0.805 | 1.4e-105 | |
| MGI|MGI:107801 | 529 | Atp5b "ATP synthase, H+ transp | 0.732 | 0.482 | 0.805 | 1.4e-105 | |
| UNIPROTKB|F1PDB4 | 527 | ATP5B "ATP synthase subunit be | 0.732 | 0.483 | 0.805 | 4.6e-105 | |
| UNIPROTKB|P00829 | 528 | ATP5B "ATP synthase subunit be | 0.727 | 0.479 | 0.807 | 9.5e-105 | |
| UNIPROTKB|F1SLA0 | 528 | ATP5B "ATP synthase subunit be | 0.732 | 0.482 | 0.801 | 9.5e-105 |
| UNIPROTKB|Q01859 ATPB "ATP synthase subunit beta, mitochondrial" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 1344 (478.2 bits), Expect = 2.8e-137, P = 2.8e-137
Identities = 263/308 (85%), Positives = 278/308 (90%)
Query: 37 RASPYGHLLSRVSEYXXXXXXXXXXXXXXKSDVKKGGGGKITDEFTGKGAIGQVCQVIGA 96
R SP G+L +R + Y + K GGGKITDEFTG GA+GQVCQVIGA
Sbjct: 32 RPSPSGYLFNRAAAYATAAAAKEAAPPAPATG-KATGGGKITDEFTGAGAVGQVCQVIGA 90
Query: 97 VVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTG 156
VVDVRFDEGLPPILTALEV+DH++RLVLEVAQH+GE +VRTIAMDGTEGLVRGQRVLNTG
Sbjct: 91 VVDVRFDEGLPPILTALEVLDHNIRLVLEVAQHLGENMVRTIAMDGTEGLVRGQRVLNTG 150
Query: 157 SPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKV 216
SPITVPVGR TLGRIMNVIGEPIDEKGD+ T H+LPIHREAPAFVEQATEQQILVTGIKV
Sbjct: 151 SPITVPVGRATLGRIMNVIGEPIDEKGDITTNHFLPIHREAPAFVEQATEQQILVTGIKV 210
Query: 217 VDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYRE 276
VDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYRE
Sbjct: 211 VDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYRE 270
Query: 277 MIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDN 336
MIESGVIKLGDKQ++SKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDN
Sbjct: 271 MIESGVIKLGDKQSESKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDN 330
Query: 337 IFRFTQVS 344
IFRFTQ +
Sbjct: 331 IFRFTQAN 338
|
|
| TAIR|locus:505006590 AT5G08690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956338 AT5G08680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|621368 Atp5b "ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V6D3 Atp5b "ATP synthase subunit beta" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P06576 ATP5B "ATP synthase subunit beta, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107801 Atp5b "ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PDB4 ATP5B "ATP synthase subunit beta" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00829 ATP5B "ATP synthase subunit beta, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SLA0 ATP5B "ATP synthase subunit beta" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 348 | |||
| PRK09280 | 463 | PRK09280, PRK09280, F0F1 ATP synthase subunit beta | 1e-178 | |
| COG0055 | 468 | COG0055, AtpD, F0F1-type ATP synthase, beta subuni | 1e-159 | |
| TIGR01039 | 461 | TIGR01039, atpD, ATP synthase, F1 beta subunit | 1e-147 | |
| CHL00060 | 494 | CHL00060, atpB, ATP synthase CF1 beta subunit | 1e-139 | |
| PRK12597 | 461 | PRK12597, PRK12597, F0F1 ATP synthase subunit beta | 1e-127 | |
| cd01133 | 274 | cd01133, F1-ATPase_beta, F1 ATP synthase beta subu | 1e-125 | |
| TIGR03305 | 449 | TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, | 5e-92 | |
| pfam00006 | 213 | pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa | 4e-40 | |
| COG1157 | 441 | COG1157, FliI, Flagellar biosynthesis/type III sec | 3e-38 | |
| cd01136 | 326 | cd01136, ATPase_flagellum-secretory_path_III, Flag | 6e-33 | |
| TIGR03496 | 411 | TIGR03496, FliI_clade1, flagellar protein export A | 2e-31 | |
| TIGR02546 | 422 | TIGR02546, III_secr_ATP, type III secretion appara | 1e-30 | |
| TIGR03498 | 418 | TIGR03498, FliI_clade3, flagellar protein export A | 1e-30 | |
| TIGR01026 | 440 | TIGR01026, fliI_yscN, ATPase FliI/YscN family | 8e-30 | |
| TIGR03497 | 413 | TIGR03497, FliI_clade2, flagellar protein export A | 2e-29 | |
| PRK06002 | 450 | PRK06002, fliI, flagellum-specific ATP synthase; V | 5e-25 | |
| PRK13343 | 502 | PRK13343, PRK13343, F0F1 ATP synthase subunit alph | 8e-25 | |
| PRK06936 | 439 | PRK06936, PRK06936, type III secretion system ATPa | 3e-24 | |
| PRK08472 | 434 | PRK08472, fliI, flagellum-specific ATP synthase; V | 4e-24 | |
| TIGR00962 | 501 | TIGR00962, atpA, proton translocating ATP synthase | 2e-23 | |
| PRK08927 | 442 | PRK08927, fliI, flagellum-specific ATP synthase; V | 6e-23 | |
| PRK09099 | 441 | PRK09099, PRK09099, type III secretion system ATPa | 2e-22 | |
| PRK06820 | 440 | PRK06820, PRK06820, type III secretion system ATPa | 3e-22 | |
| PRK08149 | 428 | PRK08149, PRK08149, ATP synthase SpaL; Validated | 7e-22 | |
| PRK06315 | 442 | PRK06315, PRK06315, type III secretion system ATPa | 5e-21 | |
| PRK08972 | 444 | PRK08972, fliI, flagellum-specific ATP synthase; V | 2e-19 | |
| PRK07594 | 433 | PRK07594, PRK07594, type III secretion system ATPa | 2e-19 | |
| PRK05688 | 451 | PRK05688, fliI, flagellum-specific ATP synthase; V | 5e-19 | |
| COG0056 | 504 | COG0056, AtpA, F0F1-type ATP synthase, alpha subun | 7e-19 | |
| PRK07721 | 438 | PRK07721, fliI, flagellum-specific ATP synthase; V | 9e-19 | |
| PRK06793 | 432 | PRK06793, fliI, flagellum-specific ATP synthase; V | 1e-18 | |
| TIGR03324 | 497 | TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, | 3e-18 | |
| cd01132 | 274 | cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c | 4e-18 | |
| PRK05922 | 434 | PRK05922, PRK05922, type III secretion system ATPa | 2e-17 | |
| PRK07196 | 434 | PRK07196, fliI, flagellum-specific ATP synthase; V | 4e-16 | |
| pfam02874 | 69 | pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta | 2e-15 | |
| PRK09281 | 502 | PRK09281, PRK09281, F0F1 ATP synthase subunit alph | 2e-15 | |
| pfam11421 | 48 | pfam11421, Synthase_beta, ATP synthase F1 beta sub | 4e-14 | |
| COG1156 | 463 | COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su | 1e-13 | |
| TIGR01041 | 458 | TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, | 2e-12 | |
| PRK04196 | 460 | PRK04196, PRK04196, V-type ATP synthase subunit B; | 5e-12 | |
| TIGR01043 | 578 | TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, | 1e-11 | |
| COG1155 | 588 | COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su | 5e-11 | |
| cd01135 | 276 | cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- | 6e-11 | |
| cd01120 | 165 | cd01120, RecA-like_NTPases, RecA-like NTPases | 8e-11 | |
| PTZ00185 | 574 | PTZ00185, PTZ00185, ATPase alpha subunit; Provisio | 2e-10 | |
| cd01134 | 369 | cd01134, V_A-ATPase_A, V/A-type ATP synthase catal | 5e-09 | |
| CHL00059 | 485 | CHL00059, atpA, ATP synthase CF1 alpha subunit | 9e-09 | |
| PRK07960 | 455 | PRK07960, fliI, flagellum-specific ATP synthase; V | 1e-08 | |
| TIGR01042 | 591 | TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A | 6e-08 | |
| TIGR01040 | 466 | TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B | 2e-07 | |
| PRK02118 | 436 | PRK02118, PRK02118, V-type ATP synthase subunit B; | 5e-07 | |
| PRK04192 | 586 | PRK04192, PRK04192, V-type ATP synthase subunit A; | 2e-04 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 2e-04 | |
| PRK14698 | 1017 | PRK14698, PRK14698, V-type ATP synthase subunit A; | 3e-04 | |
| PRK14698 | 1017 | PRK14698, PRK14698, V-type ATP synthase subunit A; | 7e-04 |
| >gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
Score = 502 bits (1295), Expect = e-178
Identities = 182/260 (70%), Positives = 208/260 (80%), Gaps = 10/260 (3%)
Query: 85 GAIGQVCQVIGAVVDVRFDEG-LPPILTALEVVD-HSVRLVLEVAQHMGEGVVRTIAMDG 142
G++ QVIG VVDV F G LP I ALEV +LVLEVAQH+G+GVVRTIAM
Sbjct: 1 MNTGKIVQVIGPVVDVEFPRGELPKIYNALEVEKGDGKKLVLEVAQHLGDGVVRTIAMGS 60
Query: 143 TEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVE 202
T+GLVRG V++TG+PI+VPVG+ TLGRI NV+GEPIDEKG + E PIHR+AP+F E
Sbjct: 61 TDGLVRGMEVIDTGAPISVPVGKATLGRIFNVLGEPIDEKGPIGAEERWPIHRKAPSFEE 120
Query: 203 QATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAG 262
+T+ +IL TGIKV+DLLAPY +GGKIGLFGGAGVGKTVLI ELINN+AK HGG+SVFAG
Sbjct: 121 LSTKTEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGYSVFAG 180
Query: 263 VGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHF 322
VGERTREGNDLY EM ESGV+ K ALV+GQMNEPPGAR RV LTGLT+AE+F
Sbjct: 181 VGERTREGNDLYHEMKESGVLD--------KTALVFGQMNEPPGARLRVALTGLTMAEYF 232
Query: 323 RDAEGQDVLLFIDNIFRFTQ 342
RD EGQDVLLFIDNIFRFTQ
Sbjct: 233 RDVEGQDVLLFIDNIFRFTQ 252
|
Length = 463 |
| >gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|214349 CHL00060, atpB, ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238553 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain | Back alignment and domain information |
|---|
| >gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|204648 pfam11421, Synthase_beta, ATP synthase F1 beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases | Back alignment and domain information |
|---|
| >gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238554 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| COG0055 | 468 | AtpD F0F1-type ATP synthase, beta subunit [Energy | 100.0 | |
| KOG1350 | 521 | consensus F0F1-type ATP synthase, beta subunit [En | 100.0 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 100.0 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 100.0 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 100.0 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 100.0 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 100.0 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 100.0 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 100.0 | |
| PRK02118 | 436 | V-type ATP synthase subunit B; Provisional | 100.0 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 100.0 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 100.0 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 100.0 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 100.0 | |
| PRK13343 | 502 | F0F1 ATP synthase subunit alpha; Provisional | 100.0 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 100.0 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 100.0 | |
| TIGR01043 | 578 | ATP_syn_A_arch ATP synthase archaeal, A subunit. A | 100.0 | |
| PRK04192 | 586 | V-type ATP synthase subunit A; Provisional | 100.0 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 100.0 | |
| TIGR01042 | 591 | V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th | 100.0 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK07165 | 507 | F0F1 ATP synthase subunit alpha; Validated | 100.0 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 100.0 | |
| COG0056 | 504 | AtpA F0F1-type ATP synthase, alpha subunit [Energy | 100.0 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 100.0 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 100.0 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 100.0 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 100.0 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 100.0 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 100.0 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 100.0 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 100.0 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 100.0 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 100.0 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 100.0 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 100.0 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 100.0 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06315 | 442 | type III secretion system ATPase; Provisional | 100.0 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 100.0 | |
| COG1155 | 588 | NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E | 100.0 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 100.0 | |
| PRK14698 | 1017 | V-type ATP synthase subunit A; Provisional | 100.0 | |
| KOG1352 | 618 | consensus Vacuolar H+-ATPase V1 sector, subunit A | 100.0 | |
| COG1156 | 463 | NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E | 100.0 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 100.0 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 100.0 | |
| KOG1351 | 489 | consensus Vacuolar H+-ATPase V1 sector, subunit B | 100.0 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 100.0 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 100.0 | |
| KOG1353 | 340 | consensus F0F1-type ATP synthase, alpha subunit [E | 99.97 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 99.95 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 99.94 | |
| COG1158 | 422 | Rho Transcription termination factor [Transcriptio | 99.94 | |
| PF11421 | 49 | Synthase_beta: ATP synthase F1 beta subunit; Inter | 98.94 | |
| PF02874 | 69 | ATP-synt_ab_N: ATP synthase alpha/beta family, bet | 98.67 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 98.37 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 98.22 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 98.19 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 98.08 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.97 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.95 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.94 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 97.91 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.88 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.88 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.81 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 97.8 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 97.73 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 97.71 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 97.69 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 97.69 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.67 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.67 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.58 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 97.53 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 97.53 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 97.49 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 97.49 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 97.43 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.38 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 97.35 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.33 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 97.29 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 97.27 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 97.27 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 97.24 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 97.21 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.17 | |
| PF05729 | 166 | NACHT: NACHT domain | 97.12 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.06 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 97.03 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 96.98 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 96.96 | |
| PF13173 | 128 | AAA_14: AAA domain | 96.92 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 96.84 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 96.8 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 96.73 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 96.72 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.47 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.42 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.26 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 96.22 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 96.13 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 96.13 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 96.12 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 96.04 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 96.02 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 95.99 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.85 | |
| PRK08181 | 269 | transposase; Validated | 95.85 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 95.84 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 95.84 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 95.81 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.8 | |
| PRK12377 | 248 | putative replication protein; Provisional | 95.75 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 95.7 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 95.68 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.67 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 95.63 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 95.62 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 95.62 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 95.57 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.51 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 95.48 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 95.47 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 95.47 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.46 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.45 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 95.43 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 95.42 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 95.4 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.4 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 95.38 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 95.37 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 95.37 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 95.35 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 95.34 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 95.33 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 95.33 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 95.32 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 95.3 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 95.3 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 95.3 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 95.26 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 95.26 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.25 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 95.25 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 95.24 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 95.23 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 95.22 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 95.22 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 95.18 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 95.18 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 95.16 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 95.16 | |
| PRK06526 | 254 | transposase; Provisional | 95.15 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 95.15 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 95.14 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 95.14 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 95.13 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 95.13 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 95.12 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 95.12 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 95.11 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 95.1 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 95.1 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 95.09 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 95.09 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 95.09 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 95.07 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 95.07 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 95.06 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 95.06 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 95.05 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 95.05 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 95.03 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 95.03 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 95.02 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 95.01 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 95.0 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 95.0 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 95.0 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 94.99 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 94.97 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 94.97 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 94.96 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 94.94 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 94.94 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 94.93 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 94.93 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 94.91 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 94.91 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 94.91 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 94.9 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 94.9 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 94.88 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 94.88 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 94.87 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 94.86 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 94.85 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 94.84 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 94.84 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 94.84 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 94.83 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 94.83 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 94.82 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 94.81 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 94.81 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 94.8 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 94.79 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 94.78 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 94.78 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 94.76 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 94.76 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 94.76 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.75 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 94.75 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 94.73 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 94.73 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 94.73 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 94.73 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 94.73 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 94.73 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 94.72 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 94.72 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 94.71 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 94.71 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 94.68 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 94.67 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 94.65 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.65 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 94.65 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 94.64 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 94.64 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 94.64 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 94.64 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 94.63 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 94.62 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 94.62 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 94.62 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 94.6 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 94.6 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 94.59 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.58 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 94.58 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 94.57 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.57 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 94.56 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 94.56 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 94.54 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 94.54 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 94.54 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.54 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.53 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 94.53 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 94.52 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 94.52 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 94.52 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 94.52 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 94.5 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 94.49 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 94.49 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 94.48 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 94.47 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 94.47 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 94.47 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.46 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 94.46 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 94.45 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.44 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 94.44 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 94.44 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 94.44 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.43 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 94.42 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 94.42 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 94.41 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 94.4 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 94.4 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 94.4 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 94.4 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.38 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 94.37 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 94.37 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 94.36 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 94.36 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 94.35 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 94.34 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 94.34 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 94.33 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 94.33 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 94.33 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 94.31 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 94.31 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 94.31 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 94.3 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 94.29 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 94.26 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 94.24 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 94.24 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 94.24 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 94.24 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 94.24 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 94.23 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 94.22 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 94.22 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 94.22 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 94.22 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 94.21 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 94.21 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 94.21 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 94.2 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 94.19 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 94.19 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.19 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 94.19 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 94.18 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 94.17 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 94.17 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 94.17 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 94.17 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 94.17 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 94.15 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 94.15 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 94.15 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 94.14 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 94.13 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 94.13 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 94.13 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.12 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.12 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 94.11 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 94.11 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 94.09 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 94.08 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 94.08 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 94.07 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 94.06 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 94.05 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.05 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 94.05 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 94.04 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 94.04 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 94.03 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 94.03 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 94.03 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 94.03 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 94.02 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 94.01 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 94.01 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 94.0 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 94.0 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.98 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 93.97 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.96 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 93.95 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 93.94 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 93.92 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 93.92 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 93.92 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 93.91 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.91 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 93.91 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.89 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 93.88 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 93.88 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 93.88 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.86 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.85 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 93.85 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 93.84 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 93.8 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 93.79 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 93.79 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 93.79 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 93.77 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 93.76 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 93.76 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 93.74 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 93.73 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.69 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.68 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 93.65 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 93.65 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 93.65 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 93.64 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 93.61 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 93.61 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 93.6 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 93.6 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 93.57 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 93.56 | |
| PRK08727 | 233 | hypothetical protein; Validated | 93.56 | |
| KOG0079 | 198 | consensus GTP-binding protein H-ray, small G prote | 93.55 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 93.55 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 93.55 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 93.54 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 93.53 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 93.49 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 93.47 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 93.47 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 93.46 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 93.45 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 93.45 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 93.44 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 93.44 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.44 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 93.43 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.42 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 93.41 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.4 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 93.39 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 93.38 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.37 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 93.32 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 93.32 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 93.28 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 93.27 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 93.24 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 93.24 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.22 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 93.22 | |
| PRK06217 | 183 | hypothetical protein; Validated | 93.15 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 93.13 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.1 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 93.1 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 93.09 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 93.07 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 93.06 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 93.05 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 93.05 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 93.03 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 93.01 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 92.96 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 92.95 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 92.93 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 92.93 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 92.92 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 92.91 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 92.89 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 92.88 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 92.88 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 92.87 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 92.83 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 92.83 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 92.81 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 92.81 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 92.8 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 92.78 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 92.78 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 92.77 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 92.77 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 92.77 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 92.76 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 92.75 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 92.71 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 92.7 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 92.69 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 92.68 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 92.66 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 92.65 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 92.63 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 92.62 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 92.57 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 92.57 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 92.55 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 92.54 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 92.49 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 92.48 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 92.47 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 92.46 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 92.42 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 92.4 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 92.36 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 92.35 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 92.35 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 92.33 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 92.31 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 92.3 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 92.29 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 92.26 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 92.26 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 92.26 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 92.24 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 92.21 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 92.21 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 92.2 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 92.2 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 92.18 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 92.18 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 92.13 |
| >COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-73 Score=555.11 Aligned_cols=254 Identities=72% Similarity=1.111 Sum_probs=243.8
Q ss_pred ceeeEEEEECCEEEEEeCC--CChhhhhceEEeecCc-eeEEEEeeeccCceEEEEeecCCCCCCCCCEEEecCCCceec
Q 018957 86 AIGQVCQVIGAVVDVRFDE--GLPPILTALEVVDHSV-RLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITVP 162 (348)
Q Consensus 86 ~~G~V~~V~G~vV~v~f~~--glp~i~~~lev~~~~~-~~~~EVv~~lg~~~V~~i~~~~t~GL~~G~~V~~tg~~l~Vp 162 (348)
+.|+|+||+|+||||+|+. .+|.+++++++..... .+++||++|+|++.||+++|+.|+||.+|+.|.+||+|++||
T Consensus 2 ~~G~vvqv~g~VvdV~F~~~~~lP~I~naL~~~~~~~~~~~leV~q~lg~~~VR~Iam~~t~gl~rg~~v~dtg~pi~VP 81 (468)
T COG0055 2 NKGKVVQVIGPVVDVEFPEEDELPEIYNALEVQNGNQGTLVLEVAQHLGDNVVRTIAMGSTDGLVRGLEVIDTGKPISVP 81 (468)
T ss_pred CCceEEEEEeeEEEEEecCcccCchhhhhheeccCCcceEeeehHHHhCCCeEEEEEecCccCcccCcEEecCCCceEEe
Confidence 4699999999999999983 4999999999876532 589999999999999999999999999999999999999999
Q ss_pred CCccccccEEeeeCcccccCCCCccc--ccccccCCCcchhhcccccceeecceeeeeceeecccCceeEeecCCCCcHH
Q 018957 163 VGRVTLGRIMNVIGEPIDEKGDLKTE--HYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKT 240 (348)
Q Consensus 163 VG~~lLGRViD~lG~PiD~~g~i~~~--~~~pi~~~~p~~~~R~~~~e~l~TGIkvID~l~PigkGQr~gIfg~~GvGKT 240 (348)
||+++||||+|++|+|||+.+++... .+||||+++|...++.+..|+|+||||+||+|+|+.||+|+|||||+|||||
T Consensus 82 VG~~~lgri~nvlG~~iD~~~~~~~~~~~~~~Ih~~~p~~~e~~~~~EIleTGIKVIDll~P~~kGgKiGLFGGAGVGKT 161 (468)
T COG0055 82 VGKGTLGRIFNVLGEPIDEKGPIKAEDFEKWPIHRKAPSFEELSTKTEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKT 161 (468)
T ss_pred cchhhcccchhccCCcccccCCCCccccceeeccCCCCchhhcccchhhhhhCceEEEEecccccCceeeeeccCCccce
Confidence 99999999999999999999999765 8999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhhcCCEEEEEEeeccchhHHHHHHHHHHcCccccCcccCCCeeEEEEecCCCCHHHHHHHHHHHHHHHH
Q 018957 241 VLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAE 320 (348)
Q Consensus 241 ~L~~~ii~n~a~~~~~~~V~~~IGER~rEv~~~~~e~~~~~v~~~~~~~~~~rtvvV~~tsdep~~~r~~a~~~a~tiAE 320 (348)
+|++++|+|+++.|++++||+++|||.||.+|+|+||++++++ ++|++|++||||||++|+|++++|+|+||
T Consensus 162 Vl~~ELI~Nia~~h~g~SVFaGvGERtREGndLy~Em~es~vl--------~ktalv~gQMNEpPGaR~RValtGlT~AE 233 (468)
T COG0055 162 VLIQELINNIAKEHGGYSVFAGVGERTREGNDLYHEMKESGVL--------DKTALVFGQMNEPPGARMRVALTGLTMAE 233 (468)
T ss_pred eeHHHHHHHHHHHcCCeEEEEeccccccchHHHHHHHHhcCCC--------CceeEEEeecCCCCcceeeehhhhhhHHH
Confidence 9999999999999999999999999999999999999999976 59999999999999999999999999999
Q ss_pred HhhhcCCCcEEEEEechhHHHhhhccc
Q 018957 321 HFRDAEGQDVLLFIDNIFRFTQVSFIL 347 (348)
Q Consensus 321 yfrd~~G~dVLli~DslTR~A~A~~e~ 347 (348)
||||++|+|||||+|||+||.||++|+
T Consensus 234 yfRD~~gqdVLlFIDNIfRftQAGsEV 260 (468)
T COG0055 234 YFRDEEGQDVLLFIDNIFRFTQAGSEV 260 (468)
T ss_pred HhhcccCCeEEEEehhhhHHhhcchHH
Confidence 999988999999999999999999996
|
|
| >KOG1350 consensus F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >PRK02118 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >PRK13343 F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >PRK04192 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK07165 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06315 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PRK14698 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG1352 consensus Vacuolar H+-ATPase V1 sector, subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG1351 consensus Vacuolar H+-ATPase V1 sector, subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG1353 consensus F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >COG1158 Rho Transcription termination factor [Transcription] | Back alignment and domain information |
|---|
| >PF11421 Synthase_beta: ATP synthase F1 beta subunit; InterPro: IPR020971 F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel | Back alignment and domain information |
|---|
| >PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 348 | ||||
| 1mab_B | 479 | Rat Liver F1-Atpase Length = 479 | 1e-117 | ||
| 2w6e_D | 528 | Low Resolution Structures Of Bovine Mitochondrial F | 1e-115 | ||
| 1nbm_D | 480 | The Structure Of Bovine F1-Atpase Covalently Inhibi | 1e-115 | ||
| 1cow_D | 482 | Bovine Mitochondrial F1-Atpase Complexed With Aurov | 1e-115 | ||
| 1nbm_E | 480 | The Structure Of Bovine F1-Atpase Covalently Inhibi | 1e-115 | ||
| 4asu_D | 480 | F1-Atpase In Which All Three Catalytic Sites Contai | 1e-115 | ||
| 2xnd_D | 467 | Crystal Structure Of Bovine F1-C8 Sub-Complex Of At | 1e-115 | ||
| 2xok_D | 511 | Refined Structure Of Yeast F1c10 Atpase Complex To | 1e-106 | ||
| 3oeh_D | 484 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 1e-106 | ||
| 3fks_D | 484 | Yeast F1 Atpase In The Absence Of Bound Nucleotides | 1e-106 | ||
| 2hld_D | 478 | Crystal Structure Of Yeast Mitochondrial F1-Atpase | 1e-106 | ||
| 4b2q_E | 473 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 1e-106 | ||
| 4b2q_D | 470 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 1e-106 | ||
| 2qe7_D | 462 | Crystal Structure Of The F1-Atpase From The Thermoa | 7e-90 | ||
| 1sky_E | 473 | Crystal Structure Of The Nucleotide Free Alpha3beta | 8e-90 | ||
| 3oaa_D | 459 | Structure Of The E.Coli F1-Atp Synthase Inhibited B | 3e-82 | ||
| 1fx0_B | 498 | Crystal Structure Of The Chloroplast F1-Atpase From | 1e-80 | ||
| 3oaa_A | 513 | Structure Of The E.Coli F1-Atp Synthase Inhibited B | 7e-18 | ||
| 2obl_A | 347 | Structural And Biochemical Analysis Of A Prototypic | 2e-17 | ||
| 2qe7_A | 502 | Crystal Structure Of The F1-Atpase From The Thermoa | 8e-15 | ||
| 1sky_B | 502 | Crystal Structure Of The Nucleotide Free Alpha3beta | 3e-14 | ||
| 2r9v_A | 515 | Crystal Structure Of Atp Synthase Subunit Alpha (Tm | 5e-14 | ||
| 3mfy_A | 588 | Structural Characterization Of The Subunit A Mutant | 4e-13 | ||
| 2xnd_A | 492 | Crystal Structure Of Bovine F1-C8 Sub-Complex Of At | 4e-13 | ||
| 1cow_A | 510 | Bovine Mitochondrial F1-Atpase Complexed With Aurov | 4e-13 | ||
| 2w6e_A | 553 | Low Resolution Structures Of Bovine Mitochondrial F | 5e-13 | ||
| 1bmf_A | 510 | Bovine Mitochondrial F1-Atpase Length = 510 | 5e-13 | ||
| 1ohh_B | 487 | Bovine Mitochondrial F1-Atpase Complexed With The I | 5e-13 | ||
| 2jiz_A | 510 | The Structure Of F1-Atpase Inhibited By Resveratrol | 5e-13 | ||
| 3oee_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 6e-13 | ||
| 3ofn_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 6e-13 | ||
| 4b2q_A | 485 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 7e-13 | ||
| 2hld_A | 510 | Crystal Structure Of Yeast Mitochondrial F1-Atpase | 7e-13 | ||
| 4b2q_B | 486 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 7e-13 | ||
| 2xok_A | 545 | Refined Structure Of Yeast F1c10 Atpase Complex To | 7e-13 | ||
| 3m4y_A | 588 | Structural Characterization Of The Subunit A Mutant | 1e-12 | ||
| 2f43_A | 510 | Rat Liver F1-atpase Length = 510 | 1e-12 | ||
| 1mab_A | 510 | Rat Liver F1-Atpase Length = 510 | 1e-12 | ||
| 3ikj_A | 588 | Structural Characterization For The Nucleotide Bind | 2e-12 | ||
| 1vdz_A | 588 | Crystal Structure Of A-Type Atpase Catalytic Subuni | 2e-12 | ||
| 3se0_A | 588 | Structural Characterization Of The Subunit A Mutant | 2e-12 | ||
| 3sdz_A | 588 | Structural Characterization Of The Subunit A Mutant | 2e-12 | ||
| 3i4l_A | 588 | Structural Characterization For The Nucleotide Bind | 2e-12 | ||
| 3qjy_A | 588 | Crystal Structure Of P-Loop G234a Mutant Of Subunit | 8e-12 | ||
| 3qia_A | 588 | Crystal Structure Of P-Loop G237a Mutant Of Subunit | 8e-12 | ||
| 3qg1_A | 588 | Crystal Structure Of P-Loop G239a Mutant Of Subunit | 8e-12 | ||
| 3nd9_A | 588 | Structural Characterization For The Nucleotide Bind | 9e-12 | ||
| 3nd8_A | 588 | Structural Characterization For The Nucleotide Bind | 1e-11 | ||
| 2dpy_A | 438 | Crystal Structure Of The Flagellar Type Iii Atpase | 5e-11 | ||
| 3a5c_A | 578 | Inter-Subunit Interaction And Quaternary Rearrangem | 5e-10 | ||
| 1fx0_A | 507 | Crystal Structure Of The Chloroplast F1-Atpase From | 9e-10 | ||
| 3vr6_A | 600 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 1e-09 | ||
| 3vr2_A | 600 | Crystal Structure Of Nucleotide-free A3b3 Complex F | 2e-09 | ||
| 3gqb_A | 578 | Crystal Structure Of The A3b3 Complex From V-atpase | 2e-09 | ||
| 3vr6_D | 465 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 2e-08 | ||
| 3gqb_B | 464 | Crystal Structure Of The A3b3 Complex From V-atpase | 4e-07 | ||
| 3a5c_D | 478 | Inter-Subunit Interaction And Quaternary Rearrangem | 7e-07 | ||
| 3ssa_A | 460 | Crystal Structure Of Subunit B Mutant N157t Of The | 2e-06 | ||
| 3vr2_D | 465 | Crystal Structure Of Nucleotide-free A3b3 Complex F | 5e-06 | ||
| 2rkw_A | 469 | Intermediate Position Of Atp On Its Trail To The Bi | 6e-06 | ||
| 3tgw_A | 460 | Crystal Structure Of Subunit B Mutant H156a Of The | 6e-06 | ||
| 2c61_A | 469 | Crystal Structure Of The Non-Catalytic B Subunit Of | 6e-06 | ||
| 3tiv_A | 460 | Crystal Structure Of Subunit B Mutant N157a Of The | 6e-06 |
| >pdb|1MAB|B Chain B, Rat Liver F1-Atpase Length = 479 | Back alignment and structure |
|
| >pdb|2W6E|D Chain D, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 528 | Back alignment and structure |
| >pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 | Back alignment and structure |
| >pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 482 | Back alignment and structure |
| >pdb|1NBM|E Chain E, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 | Back alignment and structure |
| >pdb|4ASU|D Chain D, F1-Atpase In Which All Three Catalytic Sites Contain Bound Nucleotide, With Magnesium Ion Released In The Empty Site Length = 480 | Back alignment and structure |
| >pdb|2XND|D Chain D, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 467 | Back alignment and structure |
| >pdb|2XOK|D Chain D, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 511 | Back alignment and structure |
| >pdb|3OEH|D Chain D, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f Length = 484 | Back alignment and structure |
| >pdb|3FKS|D Chain D, Yeast F1 Atpase In The Absence Of Bound Nucleotides Length = 484 | Back alignment and structure |
| >pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 478 | Back alignment and structure |
| >pdb|4B2Q|E Chain E, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 473 | Back alignment and structure |
| >pdb|4B2Q|D Chain D, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 470 | Back alignment and structure |
| >pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 462 | Back alignment and structure |
| >pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 473 | Back alignment and structure |
| >pdb|3OAA|D Chain D, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 459 | Back alignment and structure |
| >pdb|1FX0|B Chain B, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 498 | Back alignment and structure |
| >pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 | Back alignment and structure |
| >pdb|2OBL|A Chain A, Structural And Biochemical Analysis Of A Prototypical Atpase From The Type Iii Secretion System Of Pathogenic Bacteria Length = 347 | Back alignment and structure |
| >pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 | Back alignment and structure |
| >pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 | Back alignment and structure |
| >pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 | Back alignment and structure |
| >pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 | Back alignment and structure |
| >pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 | Back alignment and structure |
| >pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 | Back alignment and structure |
| >pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 | Back alignment and structure |
| >pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 | Back alignment and structure |
| >pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 | Back alignment and structure |
| >pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 | Back alignment and structure |
| >pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 | Back alignment and structure |
| >pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 | Back alignment and structure |
| >pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 | Back alignment and structure |
| >pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 | Back alignment and structure |
| >pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 | Back alignment and structure |
| >pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 | Back alignment and structure |
| >pdb|3A5C|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 578 | Back alignment and structure |
| >pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 | Back alignment and structure |
| >pdb|3VR6|A Chain A, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 600 | Back alignment and structure |
| >pdb|3VR2|A Chain A, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 600 | Back alignment and structure |
| >pdb|3GQB|A Chain A, Crystal Structure Of The A3b3 Complex From V-atpase Length = 578 | Back alignment and structure |
| >pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 | Back alignment and structure |
| >pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 | Back alignment and structure |
| >pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 | Back alignment and structure |
| >pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 | Back alignment and structure |
| >pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 | Back alignment and structure |
| >pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 | Back alignment and structure |
| >pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 348 | |||
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 0.0 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 1e-180 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 1e-168 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 3e-82 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 1e-06 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 3e-76 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 3e-12 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 5e-55 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 7e-38 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 1e-34 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 5e-34 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 2e-18 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 3e-18 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 4e-18 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 3e-17 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 3e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-12 | |
| 1pyv_A | 54 | ATP synthase beta chain, mitochondrial precursor; | 1e-05 |
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Length = 482 | Back alignment and structure |
|---|
Score = 525 bits (1355), Expect = 0.0
Identities = 206/269 (76%), Positives = 226/269 (84%), Gaps = 2/269 (0%)
Query: 74 GGKITDEFTGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEG 133
+ + G++ VIGAVVDV+FDEGLPPIL ALEV RLVLEVAQH+GE
Sbjct: 1 AAQASPSPKAGATTGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGES 60
Query: 134 VVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPI 193
VRTIAMDGTEGLVRGQ+VL++G+PI +PVG TLGRIMNVIGEPIDE+G +KT+ + I
Sbjct: 61 TVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAI 120
Query: 194 HREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKA 253
H EAP FVE + EQ+ILVTGIKVVDLLAPY +GGKIGLFGGAGVGKTVLIMELINNVAKA
Sbjct: 121 HAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKA 180
Query: 254 HGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGL 313
HGG+SVFAGVGERTREGNDLY EMIESGVI L D A SK ALVYGQMNEPPGARARV L
Sbjct: 181 HGGYSVFAGVGERTREGNDLYHEMIESGVINLKD--ATSKVALVYGQMNEPPGARARVAL 238
Query: 314 TGLTVAEHFRDAEGQDVLLFIDNIFRFTQ 342
TGLTVAE+FRD EGQDVLLFIDNIFRFTQ
Sbjct: 239 TGLTVAEYFRDQEGQDVLLFIDNIFRFTQ 267
|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Length = 473 | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1pyv_A ATP synthase beta chain, mitochondrial precursor; hydrolase; NMR {Nicotiana plumbaginifolia} SCOP: j.36.4.1 Length = 54 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 100.0 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 100.0 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 100.0 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 100.0 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 100.0 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 100.0 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 100.0 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 100.0 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 100.0 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 100.0 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 100.0 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 100.0 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 100.0 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 100.0 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 100.0 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 100.0 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 100.0 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 100.0 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 97.83 | |
| 1pyv_A | 54 | ATP synthase beta chain, mitochondrial precursor; | 97.8 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 97.77 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.73 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 97.64 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.6 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 97.59 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.58 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.58 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.56 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 97.54 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 97.45 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.4 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.39 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 97.38 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 97.34 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.31 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.21 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 96.99 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.86 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 96.72 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 96.69 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 96.65 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.59 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.56 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 96.47 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.42 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 96.39 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.22 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 96.21 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.21 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.08 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 95.97 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 95.9 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 95.86 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 95.85 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 95.85 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 95.74 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 95.73 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.72 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 95.69 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 95.66 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 95.65 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 95.61 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 95.52 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.48 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 95.34 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 95.32 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.31 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 95.27 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 95.18 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 95.18 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.14 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 95.13 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 95.11 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 95.08 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 95.04 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 95.04 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 95.03 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 95.03 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 95.01 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 94.96 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 94.94 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 94.94 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 94.93 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 94.9 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 94.9 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 94.9 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 94.89 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 94.89 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 94.89 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 94.87 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 94.87 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 94.85 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 94.85 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 94.85 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 94.85 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 94.83 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 94.82 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 94.82 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 94.76 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 94.76 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 94.75 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 94.74 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 94.7 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 94.7 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 94.7 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 94.65 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 94.6 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 94.58 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 94.56 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 94.53 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 94.53 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 94.5 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 94.5 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 94.49 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 94.46 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 94.44 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 94.43 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 94.41 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 94.4 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 94.37 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 94.34 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 94.29 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 94.27 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 94.25 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 94.24 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 94.22 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 94.22 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.2 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 94.19 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 94.09 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 94.03 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 94.01 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 94.0 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 93.93 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 93.93 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 93.89 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 93.89 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 93.88 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 93.87 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 93.85 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 93.84 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 93.83 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 93.83 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 93.74 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 93.69 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 93.68 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 93.67 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 93.67 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 93.62 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 93.59 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 93.52 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 93.51 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 93.48 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 93.42 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 93.38 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 93.35 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 93.33 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 93.32 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 93.32 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 93.28 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 93.27 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 93.26 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 93.25 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 93.24 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 93.22 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 93.16 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.05 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 92.81 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 92.8 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 92.74 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 92.72 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 92.69 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 92.65 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 92.65 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 92.63 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 92.63 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 92.61 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 92.6 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 92.6 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 92.57 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 92.56 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 92.55 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 92.55 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 92.48 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 92.42 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 92.4 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 92.35 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 92.32 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 92.32 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 92.31 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 92.23 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 92.22 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 92.2 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 92.16 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 92.07 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 92.04 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 91.99 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 91.97 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 91.97 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 91.97 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.96 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 91.92 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 91.91 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 91.9 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 91.86 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 91.86 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 91.84 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 91.79 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 91.77 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 91.73 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 91.73 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 91.64 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 91.64 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 91.64 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 91.6 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 91.59 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 91.56 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 91.54 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 91.53 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 91.48 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 91.47 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 91.45 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 91.45 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 91.45 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 91.44 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 91.43 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 91.43 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 91.4 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 91.36 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 91.36 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 91.35 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 91.35 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 91.34 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 91.34 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 91.33 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 91.22 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 91.22 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 91.22 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 91.22 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 91.21 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 91.13 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 91.13 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 91.13 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 91.11 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 91.11 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 91.1 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 91.07 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 91.07 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 91.04 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 91.01 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 90.97 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 90.96 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 90.93 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 90.91 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 90.91 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 90.86 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 90.82 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 90.82 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 90.82 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 90.78 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 90.78 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 90.77 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 90.76 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 90.75 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 90.71 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 90.71 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 90.7 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 90.68 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 90.66 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 90.65 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 90.64 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 90.6 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 90.58 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 90.56 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 90.55 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 90.54 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 90.51 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 90.51 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 90.49 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 90.48 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 90.46 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 90.46 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 90.45 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 90.44 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 90.43 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 90.4 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 90.39 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 90.37 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 90.35 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 90.34 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 90.32 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 90.31 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 90.31 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 90.3 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 90.24 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 90.23 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 90.21 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 90.2 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 90.19 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 90.19 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 90.18 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 90.15 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 90.13 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 90.13 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 90.08 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 90.07 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 90.04 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 90.04 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 89.97 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 89.96 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 89.96 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 89.91 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 89.91 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 89.9 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 89.89 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 89.86 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 89.86 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 89.83 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 89.81 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 89.77 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 89.76 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 89.75 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 89.69 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 89.69 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 89.66 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 89.66 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 89.65 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 89.64 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 89.61 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 89.59 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 89.57 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 89.56 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 89.54 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 89.52 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 89.39 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 89.37 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 89.27 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 89.27 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 89.23 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 89.17 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 89.17 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 89.17 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 89.13 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 89.11 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 89.09 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 89.08 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 89.06 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 89.03 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 89.03 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 89.03 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 89.02 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 89.01 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 88.99 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 88.91 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 88.88 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 88.86 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 88.82 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 88.82 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 88.76 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 88.71 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 88.71 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 88.65 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 88.6 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 88.5 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 88.47 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 88.46 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 88.46 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 88.44 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 88.43 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 88.4 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 88.39 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 88.39 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 88.36 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 88.34 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 88.33 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 88.33 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 88.32 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 88.29 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 88.27 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 88.27 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 88.26 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 88.23 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 88.2 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 88.19 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 88.18 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 88.15 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 88.14 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 88.14 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 88.14 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 88.12 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 88.05 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 88.05 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 88.01 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 87.96 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 87.96 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 87.93 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 87.91 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 87.91 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 87.89 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 87.84 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 87.74 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 87.7 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 87.7 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 87.66 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 87.65 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 87.54 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 87.52 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 87.45 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 87.42 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 87.4 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 87.4 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 87.4 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 87.38 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 87.35 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 87.24 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 87.22 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 87.18 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 87.12 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 87.1 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 86.96 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 86.92 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 86.92 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 86.82 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 86.81 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 86.81 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 86.79 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 86.75 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 86.74 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 86.67 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 86.55 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 86.49 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 86.44 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 86.42 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 86.4 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 86.32 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 86.28 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 86.23 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 86.12 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 86.11 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 86.07 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 85.91 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 85.89 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 85.83 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 85.79 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 85.77 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 85.74 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 85.72 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 85.55 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 85.33 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 85.29 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 85.28 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 85.1 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 85.06 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 84.96 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 84.78 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 84.69 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 84.41 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 84.4 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 84.35 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 84.14 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 84.09 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 84.08 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 84.04 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 84.39 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 83.9 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 83.88 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 83.73 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 83.69 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 83.57 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 83.56 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 83.51 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 83.35 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 83.26 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 83.21 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 83.15 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 83.02 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 82.97 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 82.94 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 82.83 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 82.81 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 82.74 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 82.52 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 82.5 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 82.49 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 82.48 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 82.4 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 82.31 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 82.31 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 82.3 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 82.13 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 82.09 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 82.06 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 81.57 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 81.46 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 81.2 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 81.02 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 80.79 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 80.79 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 80.71 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 80.69 |
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
Probab=100.00 E-value=2.2e-70 Score=554.97 Aligned_cols=264 Identities=78% Similarity=1.183 Sum_probs=242.8
Q ss_pred ccCCceeeEEEEECCEEEEEeCCCChhhhhceEEeecCceeEEEEeeeccCceEEEEeecCCCCCCCCCEEEecCCCcee
Q 018957 82 TGKGAIGQVCQVIGAVVDVRFDEGLPPILTALEVVDHSVRLVLEVAQHMGEGVVRTIAMDGTEGLVRGQRVLNTGSPITV 161 (348)
Q Consensus 82 ~~~~~~G~V~~V~G~vV~v~f~~glp~i~~~lev~~~~~~~~~EVv~~lg~~~V~~i~~~~t~GL~~G~~V~~tg~~l~V 161 (348)
+...++|+|++|.|++|+++|+..+|.+++.+++...+.++++||++|++++.+++++|++++||++|++|.+||++++|
T Consensus 9 ~~~~~~G~v~~v~G~vv~v~~~~~~~~i~~~~~i~~~~~~~~~eV~~~~~~~~v~~~~~~~t~Gl~~G~~V~~tg~~~~v 88 (482)
T 2ck3_D 9 KAGATTGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIRI 88 (482)
T ss_dssp ----CEEEEEEEETTEEEEEESSCCCCTTCEEEESSCSSCCEEEEEEEEETTEEEEEESSCCTTCBTTCEEEECSSSCEE
T ss_pred ccCCcceEEEEEEccEEEEEecCccCcccceEEEeeCCCcEEEEEeEEecCCeEEEEeccCccCCCCCCEEEEcCCccee
Confidence 44556899999999999999975588898777764323468999999999999999999999999999999999999999
Q ss_pred cCCccccccEEeeeCcccccCCCCcccccccccCCCcchhhcccccceeecceeeeeceeecccCceeEeecCCCCcHHH
Q 018957 162 PVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTV 241 (348)
Q Consensus 162 pVG~~lLGRViD~lG~PiD~~g~i~~~~~~pi~~~~p~~~~R~~~~e~l~TGIkvID~l~PigkGQr~gIfg~~GvGKT~ 241 (348)
|||++|||||+|++|+|||+++++...++||+++++|++.+|.++++||+||||+||+|+||+||||++|||++|+|||+
T Consensus 89 pvG~~lLGRV~d~lG~PiDg~~~~~~~~~~pi~~~~P~~~~r~~~~e~l~TGir~ID~l~pigkGQr~~Ifgg~G~GKT~ 168 (482)
T 2ck3_D 89 PVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTV 168 (482)
T ss_dssp ECSGGGBTCEECTTSCBCSSSCSCCCCCEEESCCCCCCGGGCCCCCCEECCSCHHHHHHSCEETTCEEEEEECTTSSHHH
T ss_pred eccccccCCEEcccCcCcCCcCCCCccccccccccCCchHHhcccCcCCccceEEEecccccccCCeeeeecCCCCChHH
Confidence 99999999999999999999999888889999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhhcCCEEEEEEeeccchhHHHHHHHHHHcCccccCcccCCCeeEEEEecCCCCHHHHHHHHHHHHHHHHH
Q 018957 242 LIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEH 321 (348)
Q Consensus 242 L~~~ii~n~a~~~~~~~V~~~IGER~rEv~~~~~e~~~~~v~~~~~~~~~~rtvvV~~tsdep~~~r~~a~~~a~tiAEy 321 (348)
|++++|+|++++|+++|||++||||+||++||+++|.+.++++.. ..++||++|++|+|+||.+|++++|+|+|+|||
T Consensus 169 L~~~i~~~~~~~~~~v~V~~~iGER~rEv~e~~~~~~~~~~l~~~--~~~~rtvvV~~t~d~p~~~r~~~~~~a~tiAEy 246 (482)
T 2ck3_D 169 LIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLK--DATSKVALVYGQMNEPPGARARVALTGLTVAEY 246 (482)
T ss_dssp HHHHHHHHTTTTCSSEEEEEEESCCHHHHHHHHHHHHHHTSSCSS--SSCCCEEEEEECTTSCHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHhhHhhCCCEEEEEECCCcchHHHHHHHHhhhccccccc--cCCceEEEEEECCCCCHHHHHHHHHHHHHHHHH
Confidence 999999999888889999999999999999999999999876421 134699999999999999999999999999999
Q ss_pred hhhcCCCcEEEEEechhHHHhhhccc
Q 018957 322 FRDAEGQDVLLFIDNIFRFTQVSFIL 347 (348)
Q Consensus 322 frd~~G~dVLli~DslTR~A~A~~e~ 347 (348)
|||++|||||||+|||||||+|+||+
T Consensus 247 frd~~G~dVLll~DsitR~A~A~rEi 272 (482)
T 2ck3_D 247 FRDQEGQDVLLFIDNIFRFTQAGSEV 272 (482)
T ss_dssp HHHTTCSCEEEEEECTHHHHHHHHHH
T ss_pred HHHhcCCcEEEEeccHHHHHHHHHHh
Confidence 99977999999999999999999986
|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1pyv_A ATP synthase beta chain, mitochondrial precursor; hydrolase; NMR {Nicotiana plumbaginifolia} SCOP: j.36.4.1 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 348 | ||||
| d2jdid3 | 276 | c.37.1.11 (D:82-357) Central domain of beta subuni | 5e-79 | |
| d2jdia3 | 285 | c.37.1.11 (A:95-379) Central domain of alpha subun | 3e-67 | |
| d1fx0a3 | 276 | c.37.1.11 (A:97-372) Central domain of alpha subun | 7e-48 | |
| d2jdid2 | 72 | b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, d | 5e-31 | |
| d1fx0b2 | 79 | b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, d | 2e-28 | |
| d1skye2 | 82 | b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, do | 3e-27 | |
| d1xpua3 | 289 | c.37.1.11 (A:129-417) Transcription termination fa | 2e-25 |
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Central domain of beta subunit of F1 ATP synthase species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 241 bits (616), Expect = 5e-79
Identities = 153/184 (83%), Positives = 163/184 (88%), Gaps = 2/184 (1%)
Query: 159 ITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVD 218
I +PVG TLGRIMNVIGEPIDE+G +KT+ + IH EAP FVE + EQ+ILVTGIKVVD
Sbjct: 1 IRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVD 60
Query: 219 LLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMI 278
LLAPY +GGKIGLFGGAGVGKTVLIMELINNVAKAHGG+SVFAGVGERTREGNDLY EMI
Sbjct: 61 LLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMI 120
Query: 279 ESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIF 338
ESGVI L D A SK ALVYGQMNEPPGARARV LTGLTVAE+FRD EGQDVLLFIDNIF
Sbjct: 121 ESGVINLKD--ATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIF 178
Query: 339 RFTQ 342
RFTQ
Sbjct: 179 RFTQ 182
|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 | Back information, alignment and structure |
|---|
| >d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 72 | Back information, alignment and structure |
|---|
| >d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 79 | Back information, alignment and structure |
|---|
| >d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Length = 82 | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 100.0 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 100.0 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 100.0 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 100.0 | |
| d2jdid2 | 72 | F1 ATP synthase beta subunit, domain 1 {Rat (Rattu | 99.75 | |
| d1fx0b2 | 79 | F1 ATP synthase beta subunit, domain 1 {Spinach (S | 99.71 | |
| d1skye2 | 82 | F1 ATP synthase beta subunit, domain 1 {Bacillus s | 99.69 | |
| d1skyb2 | 75 | F1 ATP synthase alpha subunit, domain 1 {Bacillus | 98.5 | |
| d2jdia2 | 71 | F1 ATP synthase alpha subunit, domain 1 {Cow (Bos | 98.5 | |
| d1fx0a2 | 72 | F1 ATP synthase alpha subunit, domain 1 {Spinach ( | 98.35 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 98.05 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.93 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.77 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.62 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 97.6 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 97.6 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 97.58 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.57 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 97.48 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 97.23 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.96 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 95.98 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 95.94 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.91 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.9 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.86 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 95.85 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 95.84 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.65 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 95.58 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 95.48 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 95.43 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 95.38 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 95.34 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 95.29 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 95.28 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 95.24 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 95.2 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 95.13 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.12 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 95.12 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.09 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.08 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 95.06 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 94.99 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 94.99 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 94.97 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 94.94 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 94.85 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 94.85 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 94.8 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.63 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 94.62 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 94.54 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 94.54 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.53 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 94.51 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 94.44 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 94.42 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.41 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.41 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.33 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 94.31 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.23 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 94.23 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.19 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 94.18 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 94.13 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 94.04 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.02 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 93.86 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.81 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 93.76 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.67 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 93.64 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 93.63 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 93.59 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 93.58 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 93.48 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 93.34 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 93.33 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 93.33 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 93.32 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 93.31 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.24 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 93.24 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.22 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.17 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 93.16 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 93.16 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 93.12 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 93.12 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 93.11 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 93.1 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 93.1 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 93.08 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 93.08 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 93.06 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 93.05 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 93.04 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 92.98 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 92.97 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 92.94 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 92.88 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 92.87 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 92.85 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 92.84 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 92.82 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 92.78 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 92.77 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 92.73 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 92.72 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 92.71 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 92.67 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 92.64 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 92.61 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 92.55 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 92.5 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 92.49 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.48 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 92.47 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 92.43 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 92.4 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 92.38 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 92.38 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 92.23 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 92.14 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 92.12 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 92.1 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 92.1 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 92.09 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 91.98 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.97 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 91.93 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 91.92 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 91.8 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.8 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 91.65 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 91.65 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 91.63 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 91.54 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 91.38 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 91.36 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 91.33 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.31 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 91.25 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 91.24 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.22 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 91.21 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 91.16 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 91.13 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 91.06 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 90.96 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 90.9 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 90.9 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 90.85 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 90.84 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 90.84 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 90.78 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 90.78 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 90.68 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 90.63 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 90.55 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 90.49 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 90.42 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 90.38 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 90.36 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 90.21 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 90.06 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 89.95 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 89.88 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 89.84 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 89.78 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 89.47 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 89.41 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 89.01 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 88.78 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 88.72 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 88.59 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 88.35 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 88.28 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 88.24 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 88.13 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 87.81 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 87.75 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 87.43 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 87.4 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 87.39 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 87.37 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 87.08 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 86.88 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 86.86 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 86.76 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 86.18 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 85.43 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 85.17 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 84.66 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 84.34 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 84.09 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 84.08 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 83.83 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 82.85 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 82.7 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 82.13 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 82.04 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 81.19 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 81.18 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 81.02 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 80.89 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 80.54 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 80.16 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 80.14 |
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Central domain of beta subunit of F1 ATP synthase species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00 E-value=7.3e-61 Score=454.39 Aligned_cols=187 Identities=82% Similarity=1.234 Sum_probs=178.9
Q ss_pred ceecCCccccccEEeeeCcccccCCCCcccccccccCCCcchhhcccccceeecceeeeeceeecccCceeEeecCCCCc
Q 018957 159 ITVPVGRVTLGRIMNVIGEPIDEKGDLKTEHYLPIHREAPAFVEQATEQQILVTGIKVVDLLAPYQRGGKIGLFGGAGVG 238 (348)
Q Consensus 159 l~VpVG~~lLGRViD~lG~PiD~~g~i~~~~~~pi~~~~p~~~~R~~~~e~l~TGIkvID~l~PigkGQr~gIfg~~GvG 238 (348)
++||||++|||||+|++|+|||+++++...++|||++.+|+|++|..++++|+||||+||+|+||+||||++|||++|+|
T Consensus 1 l~vpVG~~lLGRVid~lG~piDg~~~i~~~~~~~i~~~~p~~~~R~~i~~~l~TGIraID~l~pigkGQr~~If~~~g~G 80 (276)
T d2jdid3 1 IRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVG 80 (276)
T ss_dssp CEEECSGGGBTCEECTTSCBCSSSCCCCCSCEEESCCCCCCGGGCCCCCCEECCSCHHHHHHSCEETTCEEEEEECTTSS
T ss_pred CeeecCccccCCEeCCCcceeCCCCCCCCcccccccCCCCChhHhcCCCcccccCceeeeeeccccCCCEEEeeCCCCCC
Confidence 58999999999999999999999999989999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHhhcCCEEEEEEeeccchhHHHHHHHHHHcCccccCcccCCCeeEEEEecCCCCHHHHHHHHHHHHHH
Q 018957 239 KTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQADSKCALVYGQMNEPPGARARVGLTGLTV 318 (348)
Q Consensus 239 KT~L~~~ii~n~a~~~~~~~V~~~IGER~rEv~~~~~e~~~~~v~~~~~~~~~~rtvvV~~tsdep~~~r~~a~~~a~ti 318 (348)
||+|+++|++|+.++|.++|||++||||+||+.+|+++|.+.+++.. ++.++|+++|++|+|+||.+|+++||+|+|+
T Consensus 81 Kt~l~~~i~~~~~~~~~~v~V~~~iGer~~ev~~~~~~~~~~~~~~~--~~~~~~tvvv~~~s~~~~~~r~~~~~~a~~i 158 (276)
T d2jdid3 81 KTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINL--KDATSKVALVYGQMNEPPGARARVALTGLTV 158 (276)
T ss_dssp HHHHHHHHHHHHTTTCSSEEEEEEESCCHHHHHHHHHHHHHHTSSCS--SSSCCCEEEEEECTTSCHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHhhCCCeEEEEEeccChHHHHHHHHHHHhcCcccc--ccccceEEEEEECCCCCHHHHHHHHHHHHHH
Confidence 99999999999877788999999999999999999999999997653 3468899999999999999999999999999
Q ss_pred HHHhhhcCCCcEEEEEechhHHHhhhccc
Q 018957 319 AEHFRDAEGQDVLLFIDNIFRFTQVSFIL 347 (348)
Q Consensus 319 AEyfrd~~G~dVLli~DslTR~A~A~~e~ 347 (348)
||||||++||||||++|||||||+|+||+
T Consensus 159 AEyf~~~~G~~VLv~~Dsltr~A~A~rei 187 (276)
T d2jdid3 159 AEYFRDQEGQDVLLFIDNIFRFTQAGSEV 187 (276)
T ss_dssp HHHHHHTTCSCEEEEEECTHHHHHHHHHH
T ss_pred HHHHHhcCCCeEEEEEcchhHHHHHHHHH
Confidence 99999867999999999999999999986
|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|